RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254781190|ref|YP_003065603.1| hypothetical protein CLIBASIA_05485 [Candidatus Liberibacter asiaticus str. psy62] (233 letters) >2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolecular disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} (A:1-146,A:314-347) Length = 180 Score = 26.7 bits (58), Expect = 2.8 Identities = 6/31 (19%), Positives = 17/31 (54%), Gaps = 2/31 (6%) Query: 102 PKTQRAYTWSIAPHALKVEELPL--LTPDEV 130 P+TQ+ + + L+ +++P+ +E+ Sbjct: 3 PETQKGVIFYESHGKLEYKDIPVPKPKANEL 33 >3goh_A Alcohol dehydrogenase, zinc-containing; NP_718042.1, alcohol dehydrogenase superfamily protein; 1.55A {Shewanella oneidensis mr-1} (A:1-140,A:255-315) Length = 201 Score = 26.4 bits (57), Expect = 3.5 Identities = 3/30 (10%), Positives = 14/30 (46%), Gaps = 2/30 (6%) Query: 103 KTQRAYTWSIAPHALKVEELPL--LTPDEV 130 + + + + H++ + + + L D++ Sbjct: 3 EQHQVWAYQTKTHSVTLNSVDIPALAADDI 32 >3gqv_A Enoyl reductase; medium-chain reductase (MDR superfamily), rossmann fold, NADP-binding, oxidoreductase; HET: NAP; 1.74A {Aspergillus terreus} PDB: 3b6z_A* 3b70_A* (A:1-127,A:284-371) Length = 215 Score = 25.7 bits (56), Expect = 5.5 Identities = 8/31 (25%), Positives = 10/31 (32%), Gaps = 2/31 (6%) Query: 102 PKTQRAYTWSIAPHALKVEELPL--LTPDEV 130 P Q A T + P L D+V Sbjct: 9 PPQQTALTVNDHDEVTVWNAAPCPMLPRDQV 39 >2v0c_A Aminoacyl-tRNA synthetase; ligase, nucleotide-binding, protein biosynthesis; HET: LMS ANZ; 1.85A {Thermus thermophilus} PDB: 1h3n_A* 1obc_A* 1obh_A* 2bte_A* 2byt_A 2v0g_A* (A:432-495) Length = 64 Score = 25.5 bits (56), Expect = 6.0 Identities = 7/19 (36%), Positives = 10/19 (52%) Query: 114 PHALKVEELPLLTPDEVEY 132 + EELP+L PD + Sbjct: 13 VVPVPEEELPVLLPDLKDV 31 >2wan_A Pullulanase; hydrolase, glycoside hydrolase, polysaccharide, amylase, starch, carbohydrate; 1.65A {Bacillus acidopullulyticus} (A:831-921) Length = 91 Score = 25.5 bits (56), Expect = 7.2 Identities = 6/26 (23%), Positives = 14/26 (53%) Query: 75 KQKSEEKIQGHLEFLAYGQQFVAYNI 100 + + ++I+ +L FL VA+ + Sbjct: 1 RMTTADQIKQNLTFLESPTNTVAFEL 26 >2e8y_A AMYX protein, pullulanase; multiple domain, beta-alpha-barrel, alpha-amylase-family, hydrolase; 2.11A {Bacillus subtilis} PDB: 2e8z_A* 2e9b_A* (A:620-718) Length = 99 Score = 25.1 bits (55), Expect = 8.5 Identities = 9/26 (34%), Positives = 14/26 (53%) Query: 75 KQKSEEKIQGHLEFLAYGQQFVAYNI 100 + +S IQ HLE L + +AY + Sbjct: 1 RLRSAADIQRHLECLTLKEHLIAYRL 26 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.321 0.137 0.431 Gapped Lambda K H 0.267 0.0519 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 1,934,993 Number of extensions: 87602 Number of successful extensions: 278 Number of sequences better than 10.0: 1 Number of HSP's gapped: 278 Number of HSP's successfully gapped: 24 Length of query: 233 Length of database: 4,956,049 Length adjustment: 86 Effective length of query: 147 Effective length of database: 2,048,819 Effective search space: 301176393 Effective search space used: 301176393 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 53 (24.7 bits)