RPS-BLAST 2.2.22 [Sep-27-2009] Database: pdb70 24,244 sequences; 5,693,230 total letters Searching..................................................done Query= gi|254781190|ref|YP_003065603.1| hypothetical protein CLIBASIA_05485 [Candidatus Liberibacter asiaticus str. psy62] (233 letters) >3kdr_A HK97 family phage portal protein; PSI, MCSG, structural genomics, protein structure initiative; 2.90A {Corynebacterium diphtheriae} Length = 310 Score = 28.7 bits (64), Expect = 1.1 Identities = 6/32 (18%), Positives = 12/32 (37%), Gaps = 3/32 (9%) Query: 108 YTWSIAPHALKVEE---LPLLTPDEVEYFFEF 136 T+ + P +E P + D + +F Sbjct: 255 VTFGVEPLMSAIEARLNQPDMHADHLANPLKF 286 >1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Score = 27.3 bits (59), Expect = 3.1 Identities = 11/47 (23%), Positives = 18/47 (38%), Gaps = 21/47 (44%) Query: 74 KKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKVE 120 +KQ + +K+Q L+ Y S AP AL ++ Sbjct: 18 EKQ-ALKKLQASLKL--YADD----------------S-AP-ALAIK 43 >1m4u_A Noggin; BMP antagonist, BMP-7, bone morphogenetic protein, cystine knot, hormone/growth factor complex; HET: NAG; 2.42A {Homo sapiens} SCOP: g.17.1.7 Length = 206 Score = 27.3 bits (60), Expect = 3.6 Identities = 6/32 (18%), Positives = 13/32 (40%) Query: 138 DTITTPRDKEKSYRKLSKIWKSHNNRRYTNIE 169 D I P++K+ + L + H + + Sbjct: 25 DPIFDPKEKDLNETLLRSLLGGHYDPGFMATS 56 >1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2otg_B* 2os8_B* 2ec6_B Length = 156 Score = 27.2 bits (59), Expect = 3.7 Identities = 10/75 (13%), Positives = 18/75 (24%) Query: 125 LTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCFGEEFYNG 184 L +++ E F I RD S + I + G + Sbjct: 12 LPQKQIQEMKEAFSMIDVDRDGFVSKEDIKAISEQLGRAPDDKELTAMLKEAPGPLNFTM 71 Query: 185 SHDEWIPVVMAIHYE 199 + + E Sbjct: 72 FLSIFSDKLSGTDSE 86 >2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolecular disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} Length = 347 Score = 27.0 bits (58), Expect = 3.9 Identities = 6/31 (19%), Positives = 17/31 (54%), Gaps = 2/31 (6%) Query: 102 PKTQRAYTWSIAPHALKVEELPL--LTPDEV 130 P+TQ+ + + L+ +++P+ +E+ Sbjct: 3 PETQKGVIFYESHGKLEYKDIPVPKPKANEL 33 >1ra6_A P3D, genome polyprotein; nucleotidyltransferase, RNA-dependent, polymerase, N-terminus; 2.00A {Human poliovirus 1 mahoney} SCOP: e.8.1.4 PDB: 1ra7_A* 2ily_A* 2ilz_A* 2im0_A* 2im1_A* 2im2_A* 2im3_A* 2ijf_A 1tql_A 1rdr_A 1raj_A 3ddk_A 3cdu_A 3cdw_A Length = 461 Score = 26.8 bits (59), Expect = 4.3 Identities = 19/94 (20%), Positives = 30/94 (31%), Gaps = 10/94 (10%) Query: 140 ITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYE 199 +T +D E R +K+ R IE + G+ Sbjct: 155 VTYVKD-EL--RSKTKV--EQGKSR--LIEASSLNDSVAMRMAFGNLYAAF---HKNPGV 204 Query: 200 TRGSAEGKEIVREWCKLGRTYDEKSFNAKWDSFD 233 GSA G + W K+ +EK F + +D Sbjct: 205 ITGSAVGXDPDLFWSKIPVLMEEKLFAFDYTGYD 238 >3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Length = 196 Score = 26.7 bits (58), Expect = 4.9 Identities = 19/122 (15%), Positives = 36/122 (29%), Gaps = 12/122 (9%) Query: 124 LLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHN------------NRRYTNIEIR 171 + T +V+ F E F I +D S + + S I Sbjct: 50 MFTQHQVQEFKEAFQLIDQDKDGFISKNDIRATFDSLGRLCTEQELDSMVAEAPGPINFT 109 Query: 172 AFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIVREWCKLGRTYDEKSFNAKWDS 231 FL+ FG+ ++ I + E G + + + R G + + + Sbjct: 110 MFLTIFGDRIAGTDEEDVIVNAFNLFDEGDGKCKEETLKRSLTTWGEKFSQDEVDQALSE 169 Query: 232 FD 233 Sbjct: 170 AP 171 >1xff_A D-fructose-6-, glucosamine--fructose-6-phosphate aminotransferase [isomerizing]; complex (transferase/inhibitor), glutamine amidotransferase; HET: GLU; 1.80A {Escherichia coli} SCOP: d.153.1.1 PDB: 1xfg_A* Length = 240 Score = 26.7 bits (58), Expect = 5.3 Identities = 12/64 (18%), Positives = 20/64 (31%) Query: 139 TITTPRDKEKSYRKLSKIWKSHNNRRYTNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHY 198 T P + I HN + +R L G F + + E I ++ Sbjct: 76 THGEPSEVNAHPHVSEHIVVVHNGIIENHEPLREELKARGYTFVSETDTEVIAHLVNWEL 135 Query: 199 ETRG 202 + G Sbjct: 136 KQGG 139 >2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Length = 1688 Score = 26.3 bits (57), Expect = 5.9 Identities = 16/63 (25%), Positives = 28/63 (44%), Gaps = 5/63 (7%) Query: 117 LKVEELPLLTPDEVEYFFEFFDTITTPRDKEKSYRKLSKIWKSHNNRRYTNIE-IRAFLS 175 L+ EE+P + D+ E+ E T + E R + W + +R I +R L+ Sbjct: 1273 LEAEEIP--SEDQNEFLLE--RTREIHNEAESQLRAAQQQWGNDFYKRDPRIAPLRGALA 1328 Query: 176 CFG 178 +G Sbjct: 1329 TYG 1331 >1zv4_X RGS17, regulator of G-protein signaling 17; human RGSZ2, human RGS17(Z2), MU-opioid receptor interacting protein, GTPase- activating proteins (GAP); 2.40A {Homo sapiens} Length = 158 Score = 26.5 bits (58), Expect = 6.0 Identities = 15/72 (20%), Positives = 25/72 (34%), Gaps = 3/72 (4%) Query: 60 PKTLMLFRMQETNLKKQKSEEKIQGHLEFLAYGQQFVAYNIHPKTQRAYTWSIAPHALKV 119 P LFR L+ + SEE + L ++ I K + Y I+ + K Sbjct: 44 PAGRNLFR---EFLRTEYSEENLLFWLACEDLKKEQNKKVIEEKARMIYEDYISILSPKE 100 Query: 120 EELPLLTPDEVE 131 L + + Sbjct: 101 VSLDSRVREVIN 112 >3gqv_A Enoyl reductase; medium-chain reductase (MDR superfamily), rossmann fold, NADP-binding, oxidoreductase; HET: NAP; 1.74A {Aspergillus terreus} PDB: 3b6z_A* 3b70_A* Length = 371 Score = 26.3 bits (56), Expect = 6.3 Identities = 9/33 (27%), Positives = 11/33 (33%), Gaps = 2/33 (6%) Query: 100 IHPKTQRAYTWSIAPHALKVEELPL--LTPDEV 130 I P Q A T + P L D+V Sbjct: 7 IPPPQQTALTVNDHDEVTVWNAAPCPMLPRDQV 39 >2ijd_1 Picornain 3C, RNA-directed RNA polymerase; RNA-dependent RNA polymerase, picornavirus, protease, hydrolase, transferase; 3.40A {Human poliovirus 1 mahoney} SCOP: b.47.1.4 e.8.1.4 Length = 644 Score = 26.1 bits (57), Expect = 8.1 Identities = 16/83 (19%), Positives = 25/83 (30%), Gaps = 7/83 (8%) Query: 151 RKLSKIWKSHNNRRYTNIEIRAFLSCFGEEFYNGSHDEWIPVVMAIHYETRGSAEGKEIV 210 R +K+ R IE + G+ GSA G + Sbjct: 346 RSKTKV--EQGKSR--LIEASSLNDSVAMRMAFGNLYAAF---HKNPGVITGSAVGCDPD 398 Query: 211 REWCKLGRTYDEKSFNAKWDSFD 233 W K+ +EK F + +D Sbjct: 399 LFWSKIPVLMEEKLFAFDYTGYD 421 Database: pdb70 Posted date: Jan 26, 2011 11:21 AM Number of letters in database: 5,693,230 Number of sequences in database: 24,244 Lambda K H 0.321 0.137 0.431 Gapped Lambda K H 0.267 0.0519 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 24244 Number of Hits to DB: 2,176,261 Number of extensions: 99612 Number of successful extensions: 313 Number of sequences better than 10.0: 1 Number of HSP's gapped: 312 Number of HSP's successfully gapped: 26 Length of query: 233 Length of database: 5,693,230 Length adjustment: 89 Effective length of query: 144 Effective length of database: 3,535,514 Effective search space: 509114016 Effective search space used: 509114016 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 55 (25.5 bits)