RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254781191|ref|YP_003065604.1| hypothetical protein CLIBASIA_05490 [Candidatus Liberibacter asiaticus str. psy62] (165 letters) >d1cjya2 c.19.1.2 (A:142-721) Cytosolic phospholipase A2 catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 580 Score = 31.5 bits (71), Expect = 0.036 Identities = 10/43 (23%), Positives = 19/43 (44%), Gaps = 3/43 (6%) Query: 108 LSPTETEQLVKRKKVSETTWEQLQKFITRKDGKQVIVPCDLPV 150 L E +RK+ E ++K + K+ + + D+PV Sbjct: 9 LCDQEKTFRQQRKEH---IRESMKKLLGPKNSEGLHSARDVPV 48 >d1ojxa_ c.1.10.1 (A:) Archaeal fructose 1,6-bisphosphate aldolase {Archaeon Thermoproteus tenax [TaxId: 2271]} Length = 251 Score = 26.2 bits (57), Expect = 1.4 Identities = 7/22 (31%), Positives = 11/22 (50%) Query: 134 ITRKDGKQVIVPCDLPVNHLKA 155 I + GK +I+ D + H A Sbjct: 9 IFARRGKSIILAYDHGIEHGPA 30 >d3bzka1 a.60.2.6 (A:474-563) Transcriptional accessory factor Tex {Pseudomonas aeruginosa [TaxId: 287]} Length = 90 Score = 25.0 bits (55), Expect = 3.5 Identities = 8/26 (30%), Positives = 15/26 (57%) Query: 114 EQLVKRKKVSETTWEQLQKFITRKDG 139 ++L K ++ E T+EQ F+ +G Sbjct: 65 DELKKVSRLGEKTFEQAAGFLRVMNG 90 >d2fa8a1 c.47.1.23 (A:4-89) Hypothetical protein Atu0228 {Agrobacterium tumefaciens [TaxId: 358]} Length = 86 Score = 24.2 bits (53), Expect = 6.3 Identities = 8/23 (34%), Positives = 11/23 (47%) Query: 6 CRFCRAKPRCGALAVKALSTFSE 28 C C R G +A + L TF+ Sbjct: 10 CTQCNWLLRAGWMAQEILQTFAS 32 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.315 0.130 0.371 Gapped Lambda K H 0.267 0.0692 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 571,072 Number of extensions: 23644 Number of successful extensions: 58 Number of sequences better than 10.0: 1 Number of HSP's gapped: 57 Number of HSP's successfully gapped: 8 Length of query: 165 Length of database: 2,407,596 Length adjustment: 79 Effective length of query: 86 Effective length of database: 1,322,926 Effective search space: 113771636 Effective search space used: 113771636 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (22.7 bits)