BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254781191|ref|YP_003065604.1| hypothetical protein CLIBASIA_05490 [Candidatus Liberibacter asiaticus str. psy62] (165 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254781191|ref|YP_003065604.1| hypothetical protein CLIBASIA_05490 [Candidatus Liberibacter asiaticus str. psy62] Length = 165 Score = 343 bits (879), Expect = 1e-96, Method: Compositional matrix adjust. Identities = 165/165 (100%), Positives = 165/165 (100%) Query: 1 MDENACRFCRAKPRCGALAVKALSTFSEHMQILSNRQLSQVMNVLPLIETWMKGVKEEAL 60 MDENACRFCRAKPRCGALAVKALSTFSEHMQILSNRQLSQVMNVLPLIETWMKGVKEEAL Sbjct: 1 MDENACRFCRAKPRCGALAVKALSTFSEHMQILSNRQLSQVMNVLPLIETWMKGVKEEAL 60 Query: 61 NVLSSGEDLPNYELKEGRKGSRTYNNDNQVEQLLMRELGDEAYNRTLLSPTETEQLVKRK 120 NVLSSGEDLPNYELKEGRKGSRTYNNDNQVEQLLMRELGDEAYNRTLLSPTETEQLVKRK Sbjct: 61 NVLSSGEDLPNYELKEGRKGSRTYNNDNQVEQLLMRELGDEAYNRTLLSPTETEQLVKRK 120 Query: 121 KVSETTWEQLQKFITRKDGKQVIVPCDLPVNHLKANISEFSVLKD 165 KVSETTWEQLQKFITRKDGKQVIVPCDLPVNHLKANISEFSVLKD Sbjct: 121 KVSETTWEQLQKFITRKDGKQVIVPCDLPVNHLKANISEFSVLKD 165 >gi|254780124|ref|YP_003064537.1| hypothetical protein CLIBASIA_00015 [Candidatus Liberibacter asiaticus str. psy62] Length = 388 Score = 136 bits (343), Expect = 2e-34, Method: Compositional matrix adjust. Identities = 68/165 (41%), Positives = 110/165 (66%), Gaps = 2/165 (1%) Query: 1 MDENACRFCRAKPRCGALAVKALSTFSEHMQILSNRQLSQVMNVLPLIETWMKGVKEEAL 60 +++++CRFCRAK RC AL+ L ++ + +LS+ + + LI++++K ++E Sbjct: 223 VNDDSCRFCRAKVRCPALSRHVLLEATKDPSTNTTVELSKAYSSISLIKSYVKACEDEMF 282 Query: 61 NVLSSGEDLPNYELKEGRKGSRTYNNDNQVEQLLMRELGDEAYNRTLLSPTETEQLVKRK 120 L++G+++ Y+L EGRKG+R++ + N+ ++LL LG+EA+ R L +P E EQL K + Sbjct: 283 KRLNAGDEIQGYQLVEGRKGNRSFKDINRAQELLTSVLGEEAFKRILKTPKELEQLYKEQ 342 Query: 121 KVSETTWEQLQKFITRKDGKQVIVPCDLPVNH--LKANISEFSVL 163 KVS+ WE+LQ+ ITR DGK VI P D+P N K+ +SEF VL Sbjct: 343 KVSDEFWEELQELITRGDGKPVIAPRDIPTNKQTQKSQLSEFEVL 387 >gi|254781103|ref|YP_003065516.1| penicillin-binding transmembrane protein [Candidatus Liberibacter asiaticus str. psy62] Length = 598 Score = 23.1 bits (48), Expect = 2.6, Method: Composition-based stats. Identities = 8/34 (23%), Positives = 22/34 (64%) Query: 110 PTETEQLVKRKKVSETTWEQLQKFITRKDGKQVI 143 P ++++RK SET ++ L++ ++ + K+++ Sbjct: 158 PNLDSEMIRRKLSSETKFQWLRRKLSPQQQKRIL 191 >gi|254780202|ref|YP_003064615.1| hypothetical protein CLIBASIA_00435 [Candidatus Liberibacter asiaticus str. psy62] Length = 211 Score = 22.3 bits (46), Expect = 5.0, Method: Compositional matrix adjust. Identities = 10/21 (47%), Positives = 12/21 (57%) Query: 49 ETWMKGVKEEALNVLSSGEDL 69 E W+ G KE VL+ GE L Sbjct: 76 EQWITGEKEGRYCVLTGGEPL 96 >gi|254780413|ref|YP_003064826.1| PAS/PAC sensor signal transduction histidine kinase [Candidatus Liberibacter asiaticus str. psy62] Length = 820 Score = 21.9 bits (45), Expect = 6.2, Method: Compositional matrix adjust. Identities = 10/28 (35%), Positives = 17/28 (60%) Query: 39 SQVMNVLPLIETWMKGVKEEALNVLSSG 66 + N +P I ++ VK+ ALN+LS+ Sbjct: 688 TSFANNIPRILADLRSVKQIALNILSNA 715 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.315 0.130 0.371 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 97,140 Number of Sequences: 1233 Number of extensions: 3523 Number of successful extensions: 11 Number of sequences better than 100.0: 6 Number of HSP's better than 100.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 5 Number of HSP's gapped (non-prelim): 6 length of query: 165 length of database: 328,796 effective HSP length: 68 effective length of query: 97 effective length of database: 244,952 effective search space: 23760344 effective search space used: 23760344 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 35 (18.1 bits)