RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254781192|ref|YP_003065605.1| hypothetical protein CLIBASIA_05495 [Candidatus Liberibacter asiaticus str. psy62] (198 letters) >2azj_A Geranylgeranyl pyrophosphate synthetase; hexpps, trans-prenyltransferase; 2.40A {Sulfolobus solfataricus} PDB: 2azk_A (A:1-132) Length = 132 Score = 28.1 bits (62), Expect = 0.85 Identities = 9/61 (14%), Positives = 17/61 (27%), Gaps = 1/61 (1%) Query: 78 LKDGDQKISTSLKPEAYEVY-AGQYYITPKNKKVRPRLVDRHVQEVTENIQEVFYSGCHV 136 D+ I L YI K+ R L + +I++ + + Sbjct: 19 KATIDRLIEQFLNSNRDWDLVDISSYILKDGKRFRGTLNMFFTVALGGDIKDSYGGALAI 78 Query: 137 N 137 Sbjct: 79 E 79 >1wy0_A Geranylgeranyl pyrophosphate synthetase; structural genomics, riken structural genomics/proteomics initiative, RSGI, transferase; 2.20A {Pyrococcus horikoshii OT3} (A:) Length = 342 Score = 26.8 bits (58), Expect = 2.2 Identities = 18/81 (22%), Positives = 29/81 (35%), Gaps = 6/81 (7%) Query: 61 SNMSALIERMKRTGRYPLKDGDQKISTSLKPEAYEVY--AGQYYITPKNKKVRPRLVDRH 118 L R+K K D+KI + + V A ++Y K+VRP +V Sbjct: 2 EKYEELFARIKEK----AKLIDEKIFELIPEKDPRVLYEAARHYPLAGGKRVRPFVVLTS 57 Query: 119 VQEVTENIQEVFYSGCHVNAI 139 + V + Y + I Sbjct: 58 TEAVGGDPLRAIYPAVAIELI 78 >2h8o_A Geranyltranstransferase; geranyltransferase,agrobacterium tumefaciens, structural genomics, PSI-2, protein structure initiative; 1.60A {Agrobacterium tumefaciens str} (A:) Length = 335 Score = 26.1 bits (56), Expect = 3.1 Identities = 8/42 (19%), Positives = 19/42 (45%) Query: 98 AGQYYITPKNKKVRPRLVDRHVQEVTENIQEVFYSGCHVNAI 139 A ++ + K++RP LV V + + + + G + + Sbjct: 76 AMRHGVLNGGKRLRPFLVIESVALLGGDAEAGLHVGAALECL 117 >1v4e_A Octoprenyl-diphosphate synthase; trans-type prenyltransferase, thermophilic; 2.28A {Thermotoga maritima} (A:1-124) Length = 124 Score = 26.0 bits (57), Expect = 3.3 Identities = 7/34 (20%), Positives = 11/34 (32%), Gaps = 2/34 (5%) Query: 82 DQKISTSLKPEAYEVYAGQYYITPKNKKVRPRLV 115 ++I L E + K +R RL Sbjct: 17 KERIEQILSQFFPEQI--MKDLPLYGKMLRVRLS 48 >1yhl_A Farnesyl pyrophosphate synthase; farnesyl diphosphate synthase, bisphosphonate, dimethyl allyl pyrophosphate sulfate, FPPS, transferase; HET: DMA RIS; 1.95A {Trypanosoma cruzi} PDB: 1yhk_A* 1yhm_A* (A:1-228) Length = 228 Score = 26.0 bits (56), Expect = 3.5 Identities = 8/55 (14%), Positives = 13/55 (23%), Gaps = 1/55 (1%) Query: 61 SNMSALIERMKRTGRYPLKDGDQKISTSLKPEAYEVYAGQYYITPKNKKVRPRLV 115 ++M + + L D Q A + K R V Sbjct: 2 ASMERFLSVYDEVQAF-LLDQLQSKYEIDPNRARYLRIMMDTTCLGGKYFRGMTV 55 >2j1p_A Geranylgeranyl pyrophosphate synthetase; transferase, isoprene biosynthesis, multifunctional enzyme, carotenoid biosynthesis; HET: GRG; 1.8A {Sinapis alba} PDB: 2j1o_A (A:) Length = 293 Score = 25.7 bits (55), Expect = 4.3 Identities = 9/57 (15%), Positives = 21/57 (36%), Gaps = 6/57 (10%) Query: 61 SNMSALIERMKRTGRYPLKDGDQKISTSLKPEAYEVY--AGQYYITPKNKKVRPRLV 115 + + I + R ++ + +++ A +Y + K+VRP L Sbjct: 8 HHHTDPISYIIRK----ADSVNKALDSAVPLREPLKIHEAXRYSLLAGGKRVRPVLC 60 >2eg9_A ADP-ribosyl cyclase 1; hydrolase, cell sueface antigen, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.80A {Mus musculus} (A:1-169) Length = 169 Score = 25.6 bits (56), Expect = 4.4 Identities = 20/79 (25%), Positives = 32/79 (40%), Gaps = 11/79 (13%) Query: 109 KVRPRLVDRHVQEVTENI---QEVFYSGCHVNAIISVYAYTFQGTKGVTF--TLTGVQFV 163 + V+ VT+ I + +F+S + YT+ K T TL G ++ Sbjct: 69 DITREDYAPLVKLVTQTIPCDKTLFWSKSK----HLAHQYTWIQGKMFTLEDTLLG--YI 122 Query: 164 KDDTRWGGQLRASSSDFES 182 DD RW G S ++ S Sbjct: 123 ADDLRWCGDPSTSDMNYVS 141 >1uby_A FPS, farnesyl diphosphate synthase; transferase, isoprene biosynthesis, cholesterol biosynthesis; HET: DMA; 2.40A {Gallus gallus} (A:1-233) Length = 233 Score = 25.6 bits (55), Expect = 4.9 Identities = 8/53 (15%), Positives = 12/53 (22%), Gaps = 2/53 (3%) Query: 63 MSALIERMKRTGRYPLKDGDQKISTSLKPEAYEVYAGQYYITPKNKKVRPRLV 115 + + R +DG + Y P K R V Sbjct: 28 REEFVGFFPQIVRDLTEDGIGHPEVGDAVARLK--EVLQYNAPGGKCNRGLTV 78 >1wmw_A Geranylgeranyl diphosphate synthetase; GGPP, prenyl diphosphate synthase, structural genomics; 1.55A {Thermus thermophilus HB8} (A:1-192,A:308-330) Length = 215 Score = 25.1 bits (54), Expect = 6.1 Identities = 6/59 (10%), Positives = 14/59 (23%), Gaps = 1/59 (1%) Query: 82 DQKISTSLKPEAYEVY-AGQYYITPKNKKVRPRLVDRHVQEVTENIQEVFYSGCHVNAI 139 +++ L Q Y K +R L ++ + + Sbjct: 13 QERLLARLDHPDPLYRDLLQDYPRRGGKMLRGLLTVYSALAHGAPLEAGLEAATALELF 71 >1mul_A NS2, HU-2, DNA binding protein HU-alpha; histone-like; HET: DNA; 2.30A {Escherichia coli} (A:) Length = 90 Score = 25.1 bits (55), Expect = 6.2 Identities = 11/48 (22%), Positives = 22/48 (45%) Query: 44 DKLEQAIREAGEEKFGGSNMSALIERMKRTGRYPLKDGDQKISTSLKP 91 + ++++E + G + R +RTGR P + KI+ + P Sbjct: 30 AAITESLKEGDAVQLVGFGTFKVNHRAERTGRNPQTGKEIKIAAANVP 77 >3f6y_A ADP-ribosyl cyclase 1; calcium loaded structure, active site closure, inhibitory conformation, alternative splicing, diabetes mellitus; 1.45A {Homo sapiens} PDB: 2o3s_A* 3dzh_A* 2i67_A* 2pgj_A* 3dzf_A* 2i66_A* 3dzg_A* 3dzi_A* 3dzk_A* 3i9m_A* 3i9n_A* 2o3t_A* 2o3q_A* 2i65_A* 2o3u_A* 2pgl_A* 2o3r_A* 2hct_A* 3dzj_A* 1yh3_A ... (A:1-162) Length = 162 Score = 25.2 bits (55), Expect = 6.3 Identities = 13/79 (16%), Positives = 29/79 (36%), Gaps = 11/79 (13%) Query: 109 KVRPRLVDRHVQEVTENI---QEVFYSGCHVNAIISVYAYTFQGTKGVTF--TLTGVQFV 163 + ++ T+ + + + +S + +T T TL G ++ Sbjct: 62 DITEEDYQPLMKLGTQTVPCNKILLWSRIK----DLAHQFTQVQRDMFTLEDTLLG--YL 115 Query: 164 KDDTRWGGQLRASSSDFES 182 DD W G+ S +++S Sbjct: 116 ADDLTWCGEFDTSKINYQS 134 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.314 0.133 0.378 Gapped Lambda K H 0.267 0.0615 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 1,486,151 Number of extensions: 63612 Number of successful extensions: 191 Number of sequences better than 10.0: 1 Number of HSP's gapped: 191 Number of HSP's successfully gapped: 16 Length of query: 198 Length of database: 4,956,049 Length adjustment: 84 Effective length of query: 114 Effective length of database: 2,116,429 Effective search space: 241272906 Effective search space used: 241272906 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 52 (24.1 bits)