HHsearch alignment for GI: 254781193 and conserved domain: PRK05761

>PRK05761 DNA polymerase I; Reviewed.
Probab=96.77  E-value=0.0072  Score=36.96  Aligned_cols=102  Identities=21%  Similarity=0.166  Sum_probs=55.2

Q ss_pred             CHHHHHHHHHHHCCCCCEEEEEEH-HHHHHHHHH---HCCCCCC---C---------CCEEEH------H-HHHH-----
Q ss_conf             104379999986388981999730-774999998---6089988---4---------203316------8-8999-----
Q gi|254781193|r   50 DPVMPQVLKEALENTDVTIVAHNS-YFERTVLKA---CFNLDIP---I---------HRWICT------L-VLAR-----  101 (675)
Q Consensus        50 ~~~~~~~l~~~L~~~~~~kV~HNa-~FD~~~L~~---~~Gi~i~---~---------~~~~DT------m-i~A~-----  101 (675)
T Consensus       198 E~elL~~f~~~i~~~DPDIi-yN~d~FD~PYL~~Ra~~lgi~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~y~~~~~  276 (777)
T PRK05761        198 EKELLAELFKIIEDYPPVIT-FNGDNFDLPYLYNRALKLGIPKEELPFNVKYASLKTGIHIDLYKFFQNRAIRSYAFYGK  276 (777)
T ss_pred             HHHHHHHHHHHHHHCCCCEE-ECCCCCCHHHHHHHHHHHCCCCHHCCCCCCCCCCCCCEEEECCCCCCHHHHHHEEECCE
T ss_conf             99999999999974698299-80787648999999998389900066515665402444650445312113553010547


Q ss_pred             HHCCCCCHHHHHHHCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             867899968989982998110043799998620211234332346785853289999998998999999996
Q gi|254781193|r  102 SNGLPSALKAVGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREIFK  173 (675)
Q Consensus       102 ~l~~~~sL~~la~~l~l~~~k~~~~k~l~~~~~k~~~~~~~~~~~~~~~~~~~~~~~~Ya~~Dv~~t~~L~~  173 (675)
T Consensus       277 ~~~~~y~Ld~Va~~l-Lg~~K~~~--------------------~~~~~~~~~~~l~~Y~l~Da~l~~~L~~  327 (777)
T PRK05761        277 YRHREAALDAVARAL-LGESKVEL--------------------EKNISELNYWELAEYNYRDAEITLKLTF  327 (777)
T ss_pred             ECCCCEEHHHHHHHH-CCCCCCCC--------------------CCCCCCCCHHHHHHHHHHHHHHHHHHHH
T ss_conf             424745547889997-59974103--------------------1246633478899998999999999875