HHsearch alignment for GI: 254781193 and conserved domain: PRK06063

>PRK06063 DNA polymerase III subunit epsilon; Provisional.
Probab=98.96  E-value=1.6e-08  Score=73.65  Aligned_cols=66  Identities=29%  Similarity=0.423  Sum_probs=51.6

Q ss_pred             HHHHHHHHHCCCCCEEEEEEHHHHHHHHHHH---CCCCCCCCCEEEHHHHHHHHCC---CCCHHHHHHHCCCCC
Q ss_conf             3799999863889819997307749999986---0899884203316889998678---999689899829981
Q gi|254781193|r   53 MPQVLKEALENTDVTIVAHNSYFERTVLKAC---FNLDIPIHRWICTLVLARSNGL---PSALKAVGEALKLSS  120 (675)
Q Consensus        53 ~~~~l~~~L~~~~~~kV~HNa~FD~~~L~~~---~Gi~i~~~~~~DTmi~A~~l~~---~~sL~~la~~l~l~~  120 (675)
T Consensus        84 v~~~l~~~l~--g~vlVAHNa~FD~~FL~~e~~r~g~~~p~~~~lcTl~lARr~~~~l~~~kL~tla~~~Gi~~  155 (313)
T PRK06063         84 IAGELAEVLR--GRTLVAHNVAFDYSFLAAEAELAGAELPVDQVMCTVELARRLDLGLPNLRLETLAAHWGVVQ  155 (313)
T ss_pred             HHHHHHHHHC--CCEEEEECCHHHHHHHHHHHHHCCCCCCCCCEEEHHHHHHHHCCCCCCCCHHHHHHHCCCCC
T ss_conf             9999999978--99799968565299999999973998899966768998865448999974788999809998