HHsearch alignment for GI: 254781193 and conserved domain: PRK07556

>PRK07556 consensus.
Probab=100.00  E-value=0  Score=914.91  Aligned_cols=540  Identities=19%  Similarity=0.234  Sum_probs=459.7

Q ss_pred             CEEEEEECCCCCCCCCCCCCHHHCCCCEEEEEEEEECCEEEEEEECCCCH------------------HHHHHHHHHHCC
Q ss_conf             68999814178987000440011279819999999848039999788810------------------437999998638
Q gi|254781193|r    2 ATLFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHDP------------------VMPQVLKEALEN   63 (675)
Q Consensus         2 k~i~lD~ET~~~~dl~~~Gl~~y~~~~~i~~i~~a~~~~~v~~~d~~~~~------------------~~~~~l~~~L~~   63 (675)
T Consensus       388 ~~~a~DtETtsld--------~--~~a~lVGisls~~~~~a~YIPl~h~~~~~~~~~~~~~~~ql~~~~vL~~LkplLed  457 (977)
T PRK07556        388 GIVAFDTETTSLD--------P--MQAELVGFSLALAPGRACYIPLGHKSGDGDLFGGGLAEGQIPLRDALAALKPVLED  457 (977)
T ss_pred             CEEEEEEECCCCC--------H--HHCCEEEEEEEECCCCEEEEECCCCCCCCCHHCCCCCHHHCCHHHHHHHHHHHHCC
T ss_conf             9589997318878--------3--01553579998068978999614445642011022223230599999998988538


Q ss_pred             CCCEEEEEEHHHHHHHHHHHCCCCCCCCCEEEHHHHHHHHCC---CCCHHHHHHHC-CCCCCHHHHHHHHHHHHCCCCCC
Q ss_conf             898199973077499999860899884203316889998678---99968989982-99811004379999862021123
Q gi|254781193|r   64 TDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGL---PSALKAVGEAL-KLSSQKMEEGKELIARFCKGETH  139 (675)
Q Consensus        64 ~~~~kV~HNa~FD~~~L~~~~Gi~i~~~~~~DTmi~A~~l~~---~~sL~~la~~l-~l~~~k~~~~k~l~~~~~k~~~~  139 (675)
T Consensus       458 ~~i~KighnlK~d~~vL~~~-gi~l~--~i~DtmLaaYLLdp~~~~~~Ld~La~~yL~~~~~~---~~dl~g--------  523 (977)
T PRK07556        458 PSVLKIGQNMKYDALVLARH-GITVA--PFDDTMLISYALDAGRGGHGMDALSERWLGHTPIA---YKDLTG--------  523 (977)
T ss_pred             CCHHHHHHHHHHHHHHHHHC-CCCCC--CCCCHHHHHHHHCCCCCCCCHHHHHHHHCCCCCCC---CHHCCC--------
T ss_conf             73114441256889999976-96026--85318888888348866478799999964887621---000034--------


Q ss_pred             CCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCH----------HCCCCHHHHHHHHHHCCCCCCHHHHHHHHH
Q ss_conf             4332346785853289999998998999999996301040----------001513366665311562137999999999
Q gi|254781193|r  140 ECLYDRNKPNHREAWRLFGEYCKGDVTVTREIFKRLEPLS----------SKEQELWYLDQTINDRGYCVDVALAHTLNQ  209 (675)
Q Consensus       140 ~~~~~~~~~~~~~~~~~~~~Ya~~Dv~~t~~L~~~l~~~~----------~~E~~~~~~~~~me~~Gi~vD~e~l~~l~~  209 (675)
T Consensus       524 --~gk~~~~f~~v~~~~~~~YaaedA~~t~~L~~~L~~~L~~~~l~~Ly~~IE~PLi~VLa~ME~~GI~vD~~~L~~l~~  601 (977)
T PRK07556        524 --SGKSAITFDQVDIDRATAYAAEDADVTLRLWQVLKPRLAAEGLTTVYERLERPLVPVLARMEERGISVDRQVLSRLSG  601 (977)
T ss_pred             --CCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHCCEEECHHHHHHHHH
T ss_conf             --550104765520689999999999999999999999998423578999999789999999985696986999999999


Q ss_pred             HHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHCCCCCCCCCC----CCHHHHHHHHHCC-CCHHHHHHHHHHHHH
Q ss_conf             99999999999999872885476788799988777755888888988----5338998721304-823899999999976
Q gi|254781193|r  210 IVDVERTKLDQELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSNKKL-TPQAIQVFNNRMRAS  284 (675)
Q Consensus       210 ~~~~~~~~l~~~i~~~~~~~~~n~~S~~ql~~~L~~~lg~~~~~~~k----~t~~~~L~~~~~~-~~~~~~~l~~r~~~~  284 (675)
T Consensus       602 ~l~~~l~~le~~I~~~a-G~eFNi~SpkQL~~iLF~~l~lp~~kktKtG~~STd~~vLe~L~~~~h~i~~~iL~yR-~l~  679 (977)
T PRK07556        602 EFAQKAARLEAEIYELA-GEPFNIGSPKQLGDILFGKMGLPGGSKTKTGQWSTSAQVLEDLAAEGHELPRKILDWR-QLS  679 (977)
T ss_pred             HHHHHHHHHHHHHHHHC-CCCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCHHHHHHHH-HHH
T ss_conf             99999999999999870-8987878899999999986089888868889979709999998745785689999998-899


Q ss_pred             HHHHHHHHHHHHHCCCC-CCEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCCCCCCCCCHHH
Q ss_conf             55101335788740868-96767788400013221124788844488888651134554310123333455443210033
Q gi|254781193|r  285 RSAVLKLNTLVEAMNSD-GRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITSDPDPLQIISDC  363 (675)
Q Consensus       285 k~~~~~~~~~~~~~~~d-gRih~~~~~~gat~TGR~S~~~pNlQnlPr~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  363 (675)
T Consensus       680 KL~sTY~d~L~~~i~~~~gRiHt~fnq~~-t~TGRlSS~~PNLQNIPir~e~G~~-------------------------  733 (977)
T PRK07556        680 KLKSTYTDALPGYIHPQTGRVHTSYALAA-TTTGRLSSSDPNLQNIPVRTEEGRK-------------------------  733 (977)
T ss_pred             HHHHHHHHHHHHHCCCCCCEECCCHHHHC-EECCCCCCCCCCCCCCCCCCCCCCH-------------------------
T ss_conf             99999999988623789880777302323-1057645699864678887632303-------------------------


Q ss_pred             HHEEEECCCCCEEEEEECCCCCHHHHHHHCCCCCHHHHHHHCCCCHHHHHHHHCCCCHHHHCCHHHHHCCCCEEEEECCC
Q ss_conf             33012668987899983453723333231146201134541133101014764487956706201110165202100288
Q gi|254781193|r  364 VRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQG  443 (675)
Q Consensus       364 iR~~f~a~~G~~lv~aDySqiElRvlA~ls~d~~l~~af~~g~D~h~~tA~~~~g~~~~~~~~~~R~~aK~~~~g~~YG~  443 (675)
T Consensus       734 iR~aFv~~~g~~l~saDYSQIELRilAh~s~d~~li~af~~~~DiH~~tA~~if~~~~~~v~~~~R~~aK~iNfgi~YG~  813 (977)
T PRK07556        734 IRTAFIATPGHKLVSADYSQIELRILAHIADIPALKQAFADGLDIHAMTASEMFGVPVEGMPSEVRRRAKAINFGIIYGI  813 (977)
T ss_pred             HHEEECCCCCCEEEEECHHHHHHHHHHHHHCCHHHHHHHCCCCCHHHHHHHHHHCCCHHHCCHHHHHHHHEEEEHHHHCC
T ss_conf             23216049998799833668899999998178899987635987789999999599935489999865260420345566


Q ss_pred             CHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCHHHHHHHHH
Q ss_conf             88889987987088831134556555455556788889999887643100010220788899999999878878999999
Q gi|254781193|r  444 GAKAFQKMASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNE  523 (675)
Q Consensus       444 G~~~l~~~~~~~G~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ea~~~~~~~r~~~p~i~~~~~~  523 (675)
T Consensus       814 ~~~gL~~---~-----------------------------------------l~i~~~eA~~~i~~yf~~y~~v~~~~~~  849 (977)
T PRK07556        814 SAFGLAN---Q-----------------------------------------LGIPREEAGAYIKRYFERFPGIRAYMDA  849 (977)
T ss_pred             CHHHHHH---H-----------------------------------------CCCCHHHHHHHHHHHHHHCCHHHHHHHH
T ss_conf             8777998---7-----------------------------------------1989999999999999868039999999


Q ss_pred             HHHHHHHHHHCCEEEEECCCCCCCCCCCCCCCCCCEEECCCCCCCCCCCCCCCHHHHCCHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999754917962154211332223445640232476631016786621021010023456777531456554536
Q gi|254781193|r  524 LHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNNRSYLNTTTRQLTREYTYGGKLTENIVQ  603 (675)
Q Consensus       524 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~GR~~~~~~~~~~~~~~~~~~~~~~r~~~~~~k~~n~~iQ  603 (675)
T Consensus       850 ~~~~a~~---~-----------------------gyv~Tl~gRrr~~p~i~s~n~~~r~~---~eR~------a~N~piQ  894 (977)
T PRK07556        850 TKAFARE---H-----------------------GYVETLFGRRIHYPDIKASNPSVRAF---NERA------AINAPIQ  894 (977)
T ss_pred             HHHHHHH---C-----------------------CCEECCCCCEECCCCCCCCCHHHHHH---HHHH------HHCCCCC
T ss_conf             9999997---7-----------------------97788878703287556899889979---9999------8277643


Q ss_pred             HHHHHHHHHHHHHHHH------CCCCEEEEECCEEEEECCCCHHHHH-HHHHHHHCCCC--HHCCCCCCEEEECCCCCCC
Q ss_conf             8899999999999996------7981889952589997792489999-99999845652--0215995157401004631
Q gi|254781193|r  604 AVSRDILAEGMMNATK------AGYDIVLTVHDEIVCETPDTDEFNA-SMLYHLMTSNP--SWAKGLPLKAEGYESKRYR  674 (675)
Q Consensus       604 gtaadi~k~ami~l~~------~g~~ivl~VHDEiv~evp~~~~~~~-~~i~~~M~~~~--~w~~~~pl~ae~~~~~~y~  674 (675)
T Consensus       895 GtaAdiiK~ami~~~~~l~~~~~~~~milqvHDEli~e~~~~e~e~~~~~v~~~Me~a~~~~~~l~VPL~v~~~~G~nW~  974 (977)
T PRK07556        895 GTAADIIRRAMIRMEDALAEEKLSARMLLQVHDELIFEVPEDEVEATIPVVRHVMENAAMPAVSLSVPLTVDARAADNWD  974 (977)
T ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCCEEEEEECEEEEEEECHHHHHHHHHHHHHHHHCCCCCCCEECCCEEEECCCCCCHH
T ss_conf             55999999999999999983698862899977277896468899999999999973677678031156686548186978