HHsearch alignment for GI: 254781193 and conserved domain: PRK08835

>PRK08835 consensus.
Probab=100.00  E-value=0  Score=899.79  Aligned_cols=539  Identities=20%  Similarity=0.221  Sum_probs=458.3

Q ss_pred             CEEEEEECCCCCCCCCCCCCHHHCCCCEEEEEEEEECCEEEEEEECCCC----------HHHHHHHHHHHCCCCCEEEEE
Q ss_conf             6899981417898700044001127981999999984803999978881----------043799999863889819997
Q gi|254781193|r    2 ATLFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHD----------PVMPQVLKEALENTDVTIVAH   71 (675)
Q Consensus         2 k~i~lD~ET~~~~dl~~~Gl~~y~~~~~i~~i~~a~~~~~v~~~d~~~~----------~~~~~~l~~~L~~~~~~kV~H   71 (675)
T Consensus       352 ~~~a~dtEt~~l--------d~~--~a~lvGis~~~~~g~a~YiPl~h~~l~~~~ql~~d~vl~~LkplLed~~i~KIgh  421 (931)
T PRK08835        352 ELFAFDTETDSL--------DYM--VANLVGLSFAVAEGEAAYVPVAHDYLDAPEQLDRDWVLAQLKPLLEDDAKAKVGQ  421 (931)
T ss_pred             CEEEEEEECCCC--------CHH--HCCCCCEEEEECCCCEEEEEECCCCCCCHHHCCHHHHHHHHHHHHCCCCHHHHHC
T ss_conf             859999504874--------322--2133542687647857999712333455101369999999799842842436622


Q ss_pred             EHHHHHHHHHHHCCCCCCCCCEEEHHHHHHHHCC---CCCHHHHHHHC-CCCCCHHHHHHHHHHHHCCCCCCCCCCCCCC
Q ss_conf             3077499999860899884203316889998678---99968989982-9981100437999986202112343323467
Q gi|254781193|r   72 NSYFERTVLKACFNLDIPIHRWICTLVLARSNGL---PSALKAVGEAL-KLSSQKMEEGKELIARFCKGETHECLYDRNK  147 (675)
Q Consensus        72 Na~FD~~~L~~~~Gi~i~~~~~~DTmi~A~~l~~---~~sL~~la~~l-~l~~~k~~~~k~l~~~~~k~~~~~~~~~~~~  147 (675)
T Consensus       422 NlK~d~~vL~~~-gI~l~-gi~fDTmLAaYLLnp~~~~~~Ld~La~~~L~~~~i---~~e~l~----------gkgk~q~  486 (931)
T PRK08835        422 NLKYDASVLARY-GIEMK-GIKHDTMLASYVYNSVGGKHDMDSLALRFLQHSCI---SFEQVA----------GKGKNQL  486 (931)
T ss_pred             CHHHHHHHHHHC-CCCCC-CCCCCHHHHHHHCCCCCCCCCHHHHHHHHCCCCCC---CHHHHC----------CCCCCCC
T ss_conf             115789999977-97767-86612435753004777878989999986487763---477651----------4453447


Q ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCH-----------HCCCCHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHH
Q ss_conf             85853289999998998999999996301040-----------0015133666653115621379999999999999999
Q gi|254781193|r  148 PNHREAWRLFGEYCKGDVTVTREIFKRLEPLS-----------SKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERT  216 (675)
Q Consensus       148 ~~~~~~~~~~~~Ya~~Dv~~t~~L~~~l~~~~-----------~~E~~~~~~~~~me~~Gi~vD~e~l~~l~~~~~~~~~  216 (675)
T Consensus       487 ~f~~v~~~~~~~YaaedA~~t~~L~~~L~~~L~~~~~L~~Ly~~IE~PLi~VLa~ME~~GI~vD~~~L~~ls~el~~~l~  566 (931)
T PRK08835        487 TFNQIDLEEAAPYAAEDADVTLRLHNRLFANIEQDEKLKSVYEEIEMPLVPVLSRIERTGVLIDDMLLSAQSQEIAARLD  566 (931)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCEEECHHHHHHHHHHHHHHHH
T ss_conf             83343288999999999999999999999999854778899999986899999999972848789999999999999999


Q ss_pred             HHHHHHHHHHCCCCCCCCCHHHHHHHHHHHCCCCCCCCCC----CCHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9999999872885476788799988777755888888988----533899872130482389999999997655101335
Q gi|254781193|r  217 KLDQELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLN  292 (675)
Q Consensus       217 ~l~~~i~~~~~~~~~n~~S~~ql~~~L~~~lg~~~~~~~k----~t~~~~L~~~~~~~~~~~~~l~~r~~~~k~~~~~~~  292 (675)
T Consensus       567 ~le~~I~~~-aG~eFNinSPKQL~~vLF~~l~Lp~~kKtktG~~ST~~~vLe~L~~~hpi~~~il~yR~-l~KL~sTy~~  644 (931)
T PRK08835        567 ELEQKAYEI-AGQEFNMNSPKQLQTILFEKMGLPVIKKTPSGTPSTNEEVLQELALDYPLPKVILEYRG-LAKLKSTYTD  644 (931)
T ss_pred             HHHHHHHHH-CCCCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCHHHHHHHHH-HHHHHHHHHH
T ss_conf             999999876-27856779999999999986099878858899967559999987651777899999978-9888888775


Q ss_pred             HHHHHCCC-CCCEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCCCCCCCCCHHHHHEEEECC
Q ss_conf             78874086-89676778840001322112478884448888865113455431012333345544321003333012668
Q gi|254781193|r  293 TLVEAMNS-DGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITSDPDPLQIISDCVRSCVIAS  371 (675)
Q Consensus       293 ~~~~~~~~-dgRih~~~~~~gat~TGR~S~~~pNlQnlPr~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~iR~~f~a~  371 (675)
T Consensus       645 ~L~~~i~~~~gRiHt~f~Q~~-t~TGRLSS~~PNLQNIPiRt~~G~~-------------------------iR~aFva~  698 (931)
T PRK08835        645 KLPKMINPSTGRVHTSYHQAV-TATGRLSSTDPNLQNIPIRNEEGRR-------------------------IRQAFVAP  698 (931)
T ss_pred             HHHHHHCCCCCEECCHHHHCC-CCCCCCCCCCCCCCCCCCCCHHHCC-------------------------HHHHEECC
T ss_conf             557652867588787343101-5524525799630267888601110-------------------------00534669


Q ss_pred             CCCEEEEEECCCCCHHHHHHHCCCCCHHHHHHHCCCCHHHHHHHHCCCCHHHHCCHHHHHCCCCEEEEECCCCHHHHHHH
Q ss_conf             98789998345372333323114620113454113310101476448795670620111016520210028888889987
Q gi|254781193|r  372 EGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKM  451 (675)
Q Consensus       372 ~G~~lv~aDySqiElRvlA~ls~d~~l~~af~~g~D~h~~tA~~~~g~~~~~~~~~~R~~aK~~~~g~~YG~G~~~l~~~  451 (675)
T Consensus       699 ~g~~l~saDYSQIELRilAh~s~d~~li~af~~~~DiH~~tA~~if~v~~~~v~~~~R~~AK~vnfgi~YG~~~~gLa~-  777 (931)
T PRK08835        699 HGYKILAVDYSQIELRIMAHLSGDQALLDAFRDGKDIHAATAAEIMGVSIEQVSSEQRRRAKAVNFGLIYGMSAFGLAK-  777 (931)
T ss_pred             CCCEEEEECHHHHHHHHHHHHCCCHHHHHHHHCCCCHHHHHHHHHHCCCHHHCCHHHHHHHHHHHHHHHHCCCHHHHHH-
T ss_conf             9887997043189999999982998999998669980678999995999466899898775833311244578777998-


Q ss_pred             HHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHH
Q ss_conf             98708883113455655545555678888999988764310001022078889999999987887899999999999999
Q gi|254781193|r  452 ASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELHQAFEQT  531 (675)
Q Consensus       452 ~~~~G~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ea~~~~~~~r~~~p~i~~~~~~~~~~~~~~  531 (675)
T Consensus       778 -------------------------------------------~l~i~~~eA~~~i~~yf~~yp~v~~~~~~~~~~a~~-  813 (931)
T PRK08835        778 -------------------------------------------QLGIPRGEAQAYMDKYFERYPGVMQYMEDTRSRAAQ-  813 (931)
T ss_pred             -------------------------------------------HHCCCHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHH-
T ss_conf             -------------------------------------------709899999999999988682299999999999987-


Q ss_pred             HHCCEEEEECCCCCCCCCCCCCCCCCCEEECCCCCCCCCCCCCCCHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             75491796215421133222344564023247663101678662102101002345677753145655453688999999
Q gi|254781193|r  532 IENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNNRSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILA  611 (675)
Q Consensus       532 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~GR~~~~~~~~~~~~~~~~~~~~~~r~~~~~~k~~n~~iQgtaadi~k  611 (675)
T Consensus       814 -------------------------~g~v~Tl~gRrr~~p~i~s~n~~~r~~---~eR~------a~N~piQGtaADiiK  859 (931)
T PRK08835        814 -------------------------QGYVETIFGRRLHLPEITSRNGMRRKA---AERA------AINAPMQGTAADIIK  859 (931)
T ss_pred             -------------------------CCCEECCCCCCCCCCCCCCCCHHHHHH---HHHH------HHCCCCCHHHHHHHH
T ss_conf             -------------------------791788788731488656888778868---9999------957124455999999


Q ss_pred             HHHHHHHH----CC---CCEEEEECCEEEEECCCCHHHHH-HHHHHHHCCCCHHCCCCCCEEEECCCCCCC
Q ss_conf             99999996----79---81889952589997792489999-999998456520215995157401004631
Q gi|254781193|r  612 EGMMNATK----AG---YDIVLTVHDEIVCETPDTDEFNA-SMLYHLMTSNPSWAKGLPLKAEGYESKRYR  674 (675)
Q Consensus       612 ~ami~l~~----~g---~~ivl~VHDEiv~evp~~~~~~~-~~i~~~M~~~~~w~~~~pl~ae~~~~~~y~  674 (675)
T Consensus       860 ~AMi~~~~~l~~~~~~~~~~~lqvHDEli~e~~~~~~~~~~~~v~~~Me~~~~--l~Vpl~v~~~~G~nW~  928 (931)
T PRK08835        860 KAMLLVDEWIEEEGNGRVKLLMQVHDELVFEVEESSLSEIESKVQQLMESAAE--LDVPLVAEAGHGDNWD  928 (931)
T ss_pred             HHHHHHHHHHHHCCCCCCEEEEEECCEEEEEECHHHHHHHHHHHHHHHHCCCC--CCCCEEEECCCCCCHH
T ss_conf             99999999998556777628986672778831688999999999999727632--7786374238076978