BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254781193|ref|YP_003065606.1| putative DNA polymerase from
bacteriophage origin [Candidatus Liberibacter asiaticus str. psy62]
         (675 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254781193|ref|YP_003065606.1| putative DNA polymerase from bacteriophage origin [Candidatus
           Liberibacter asiaticus str. psy62]
 gi|254040870|gb|ACT57666.1| putative DNA polymerase from bacteriophage origin [Candidatus
           Liberibacter asiaticus str. psy62]
 gi|317120755|gb|ADV02576.1| DNA polymerase A [Candidatus Liberibacter asiaticus]
          Length = 675

 Score = 1410 bits (3651), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 675/675 (100%), Positives = 675/675 (100%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHDPVMPQVLKEA 60
           MATLFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHDPVMPQVLKEA
Sbjct: 1   MATLFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHDPVMPQVLKEA 60

Query: 61  LENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKLSS 120
           LENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKLSS
Sbjct: 61  LENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKLSS 120

Query: 121 QKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREIFKRLEPLSS 180
           QKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREIFKRLEPLSS
Sbjct: 121 QKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREIFKRLEPLSS 180

Query: 181 KEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSSSRCLEKLK 240
           KEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSSSRCLEKLK
Sbjct: 181 KEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSSSRCLEKLK 240

Query: 241 TWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLNTLVEAMNS 300
           TWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLNTLVEAMNS
Sbjct: 241 TWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLNTLVEAMNS 300

Query: 301 DGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITSDPDPLQII 360
           DGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITSDPDPLQII
Sbjct: 301 DGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITSDPDPLQII 360

Query: 361 SDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVA 420
           SDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVA
Sbjct: 361 SDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVA 420

Query: 421 PAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVKTNSAPEEWEDAEN 480
           PAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVKTNSAPEEWEDAEN
Sbjct: 421 PAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVKTNSAPEEWEDAEN 480

Query: 481 FCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELHQAFEQTIENGKAIIA 540
           FCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELHQAFEQTIENGKAIIA
Sbjct: 481 FCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELHQAFEQTIENGKAIIA 540

Query: 541 RKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNNRSYLNTTTRQLTREYTYGGKLTEN 600
           RKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNNRSYLNTTTRQLTREYTYGGKLTEN
Sbjct: 541 RKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNNRSYLNTTTRQLTREYTYGGKLTEN 600

Query: 601 IVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKG 660
           IVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKG
Sbjct: 601 IVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKG 660

Query: 661 LPLKAEGYESKRYRK 675
           LPLKAEGYESKRYRK
Sbjct: 661 LPLKAEGYESKRYRK 675


>gi|315121967|ref|YP_004062456.1| putative DNA polymerase from bacteriophage origin [Candidatus
           Liberibacter solanacearum CLso-ZC1]
 gi|313495369|gb|ADR51968.1| putative DNA polymerase from bacteriophage origin [Candidatus
           Liberibacter solanacearum CLso-ZC1]
          Length = 673

 Score =  814 bits (2103), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/677 (59%), Positives = 491/677 (72%), Gaps = 6/677 (0%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHDPVMPQVLKEA 60
           M  LFID ETRSP  L K G+  YAE+  + L A+  +D  ++LWDC  +PVMP  L + 
Sbjct: 1   MPKLFIDIETRSPKPLPKVGVWAYAEEAKITLCAYAHNDETIKLWDCTANPVMPSDLLKH 60

Query: 61  LENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKLSS 120
           L++  V  VAHNS FER + K   N+ IP  RWICT  LAR NGLP++LK    ALK   
Sbjct: 61  LKDDTVVCVAHNSLFERILFKKSLNITIPPRRWICTSTLARINGLPASLKNACMALKFPE 120

Query: 121 Q--KMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREIFKRLEPL 178
              KMEEGK LIARFCKG   E  YD  + NH +AW+LFGEYCK DV  TRE++KRL PL
Sbjct: 121 TLTKMEEGKALIARFCKGSIEESPYDAKRANHVQAWQLFGEYCKRDVEATRELYKRLTPL 180

Query: 179 SSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSSSRCLEK 238
           S  E+ LW LDQ INDRGY +D+ L   L +++  ER KLD+EL++LT+G++ SSR  + 
Sbjct: 181 SENERHLWLLDQEINDRGYAIDLNLVKKLQELIAFEREKLDEELKTLTFGVIGSSRKTDL 240

Query: 239 LKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLNTLVEAM 298
           L  +LFL  GL L D+ E+T    LS    +T +A  + NNR+ +S+SA+LKLNTL  A+
Sbjct: 241 LNKYLFLYMGLDLPDMAESTIATALS-QPNITQRAKDILNNRLSSSQSAILKLNTLSGAV 299

Query: 299 NSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITSDPDPLQ 358
           + D RLRGTLQF GASRTGRWSGCVF PQNLPRP+ SHE +++ I    ++  SD DPL+
Sbjct: 300 SPDLRLRGTLQFYGASRTGRWSGCVFQPQNLPRPNTSHETIEEAIES--SNFPSD-DPLR 356

Query: 359 IISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFN 418
             SDCVRSC+IAS GKKLVVADLAGIEARVLAW+AGEQWKL AF  GED+Y T Y+++FN
Sbjct: 357 FASDCVRSCIIASTGKKLVVADLAGIEARVLAWIAGEQWKLNAFANGEDIYKTAYSKAFN 416

Query: 419 VAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVKTNSAPEEWEDA 478
           +  + VTKDQRAIGKVMELALGYQGGA+ FQ MAS  GL+L  F+  +K  +  ++WE A
Sbjct: 417 IPLSNVTKDQRAIGKVMELALGYQGGARVFQTMASNLGLDLKQFSKSIKQTATGDDWEQA 476

Query: 479 ENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELHQAFEQTIENGKAI 538
           +  C WMQE +PE A+ D FIGTACE VK AWR KH  V +LW +  +AF+  I++G++I
Sbjct: 477 QRRCLWMQETYPEFAVHDPFIGTACELVKTAWRAKHKGVVQLWKDCEEAFDCVIKDGRSI 536

Query: 539 IARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNNRSYLNTTTRQLTREYTYGGKLT 598
            AR+   VP + MKK   N+ + LPS R LVYRDV ++RSYLNT T Q+ RE TYGGKLT
Sbjct: 537 SARRVAGVPPLLMKKQHQNVFITLPSNRKLVYRDVKSDRSYLNTATAQIMRERTYGGKLT 596

Query: 599 ENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWA 658
           ENIVQA+SRDILA GM+NAT+AGYDIVLTVHDEIVCETPDT EF++  L  LMT NP WA
Sbjct: 597 ENIVQAISRDILACGMINATRAGYDIVLTVHDEIVCETPDTPEFSSDELCFLMTQNPKWA 656

Query: 659 KGLPLKAEGYESKRYRK 675
           KGLPLKAEGYE+ RYRK
Sbjct: 657 KGLPLKAEGYEALRYRK 673


>gi|315122935|ref|YP_004063424.1| putative DNA polymerase from bacteriophage origin [Candidatus
           Liberibacter solanacearum CLso-ZC1]
 gi|313496337|gb|ADR52936.1| putative DNA polymerase from bacteriophage origin [Candidatus
           Liberibacter solanacearum CLso-ZC1]
          Length = 675

 Score =  813 bits (2099), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/678 (58%), Positives = 490/678 (72%), Gaps = 6/678 (0%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHDPVMPQVLKEA 60
           M  LFID ETRSP  L K G+  YAE+  + L A+  +D  ++LWDC  +PVMP  L + 
Sbjct: 1   MPKLFIDIETRSPKPLPKVGVWAYAEEAKITLCAYAHNDETIKLWDCTANPVMPSDLLKH 60

Query: 61  LENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKLSS 120
           L++  V  VAHNS FER + K   N+ IP  RWICT  LAR NGLP++LK    ALK   
Sbjct: 61  LKDDTVVCVAHNSLFERILFKKSLNITIPPRRWICTSTLARINGLPASLKNACMALKFPE 120

Query: 121 Q--KMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREIFKRLEPL 178
              KMEEGK LIARFCKG   E  YD  + NH +AW+LFGEYCK DV  TRE++KRL PL
Sbjct: 121 TLTKMEEGKALIARFCKGSIEESPYDAKRANHVQAWQLFGEYCKRDVEATRELYKRLTPL 180

Query: 179 SSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSSSRCLEK 238
           S  E+ LW LDQ INDRGY +D+ L   L +++  ER +LD+E + LT G++ S+R  + 
Sbjct: 181 SENERHLWLLDQEINDRGYAIDLNLVKKLQELIAFERERLDEEFKELTAGVIGSARKTDL 240

Query: 239 LKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQ-AIQVFNNRMRASRSAVLKLNTLVEA 297
           L  +LFL TGL L D+ E+T    LS      PQ +  + NNR+ +S+SA+LKLNTL  A
Sbjct: 241 LNKYLFLYTGLDLPDMAESTVLTALSQPD--IPQLSKAILNNRLSSSQSAILKLNTLSGA 298

Query: 298 MNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITSDPDPL 357
           ++ D RLRGTLQF GASRTGRWSGCVF PQNLPR + + +E++++I  L + +    DPL
Sbjct: 299 VSPDNRLRGTLQFFGASRTGRWSGCVFQPQNLPRQTLAVDEIERLIRGLDSGVPIK-DPL 357

Query: 358 QIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSF 417
           +  SDCVRSC+IAS GKKL+VADLAGIEARVLAW+AGEQWKL AF  GED+Y T Y+++F
Sbjct: 358 RFASDCVRSCIIASPGKKLIVADLAGIEARVLAWVAGEQWKLNAFANGEDIYKTAYSKAF 417

Query: 418 NVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVKTNSAPEEWED 477
           NV  + VTKDQRAIGKVMELALGYQGGA+ FQKMAST GLNL  F+  +K  +  E+WE 
Sbjct: 418 NVPLSDVTKDQRAIGKVMELALGYQGGARVFQKMASTLGLNLQQFSKSIKNTATSEDWEQ 477

Query: 478 AENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELHQAFEQTIENGKA 537
           A+  C WMQE HPE A+ D FIGTACE VK+AWR KH  V +LW +  +AF+  I++G++
Sbjct: 478 AQRRCLWMQETHPEFAVPDPFIGTACELVKEAWRAKHKGVVQLWKDCEEAFDCVIKDGRS 537

Query: 538 IIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNNRSYLNTTTRQLTREYTYGGKL 597
           I AR+   VP + MKK   N+ + LPS R LVYRDV ++RSYLNT T Q+ RE TYGGKL
Sbjct: 538 ISARRVLGVPPLLMKKQHQNVFITLPSNRKLVYRDVKSDRSYLNTATAQIMRERTYGGKL 597

Query: 598 TENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSW 657
           TENIVQA+SRDILA GM+NATKAGYDIVLTVHDEIVCE PDT EF++  L  LMT NP+W
Sbjct: 598 TENIVQAISRDILATGMINATKAGYDIVLTVHDEIVCEVPDTPEFSSDDLCSLMTRNPTW 657

Query: 658 AKGLPLKAEGYESKRYRK 675
           AKGLPLKAEGYE+ RYRK
Sbjct: 658 AKGLPLKAEGYEAVRYRK 675


>gi|255957611|dbj|BAH96662.1| DNA-directed DNA polymerase [Candidatus Liberibacter asiaticus]
 gi|255957616|dbj|BAH96666.1| DNA-directed DNA polymerase [Candidatus Liberibacter asiaticus]
 gi|255957626|dbj|BAH96674.1| DNA-directed DNA polymerase [Candidatus Liberibacter asiaticus]
 gi|255957641|dbj|BAH96686.1| DNA-directed DNA polymerase [Candidatus Liberibacter asiaticus]
 gi|255957661|dbj|BAH96702.1| DNA-directed DNA polymerase [Candidatus Liberibacter asiaticus]
 gi|255957666|dbj|BAH96706.1| DNA-directed DNA polymerase [Candidatus Liberibacter asiaticus]
 gi|255957671|dbj|BAH96710.1| DNA-directed DNA polymerase [Candidatus Liberibacter asiaticus]
 gi|255957676|dbj|BAH96714.1| DNA-directed DNA polymerase [Candidatus Liberibacter asiaticus]
 gi|255957686|dbj|BAH96722.1| DNA-directed DNA polymerase [Candidatus Liberibacter asiaticus]
          Length = 675

 Score =  793 bits (2047), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/677 (59%), Positives = 484/677 (71%), Gaps = 4/677 (0%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHDPVMPQVLKEA 60
           M+ LFID ETRSP  L K G+  YAE   + L A+ +DD PV+LWD      MP  L + 
Sbjct: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQY 60

Query: 61  LENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKLSS 120
           L +  V  VAHNS FER + K    +DIP  RWICT VLAR+NGLPS+LK    AL  S 
Sbjct: 61  LRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNFSE 120

Query: 121 Q--KMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREIFKRLEPL 178
              KMEEGK LIARFCKG      YD  + NH +AW+LFGEYCK DV  TRE+FKRL PL
Sbjct: 121 HLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRLIPL 180

Query: 179 SSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSSSRCLEK 238
           S  E++LW LDQTINDRGY +D+ L   L +++  ER KLD+++  LT G++ SSR    
Sbjct: 181 SDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSRQTYT 240

Query: 239 LKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLNTLVEAM 298
           L+ +LFL TG+ L D++E T + +LS +  +T  A  +  NR+ +S SA+LKLNTL EA+
Sbjct: 241 LRMYLFLITGIDLVDMSEGTLKSILS-HSNITQLAKDLILNRLASSGSAILKLNTLSEAV 299

Query: 299 NSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITSDPDPLQ 358
           +SDGRLRGTLQF GASRTGRWSGCVF PQNLPR  RS E L Q I  L    T   DPL 
Sbjct: 300 SSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGETI-ADPLG 358

Query: 359 IISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFN 418
           + SDCVRSC+IAS GKKLVVADLAGIEARVLAW+AGE WK+KAF  GED+YVTTYA++FN
Sbjct: 359 LASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFN 418

Query: 419 VAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVKTNSAPEEWEDA 478
               +V+K+QRAIGKVMELALGYQGGAK F+ MAS  GL+L  F+  VK+ S  E+WE A
Sbjct: 419 TPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTSTFEDWEQA 478

Query: 479 ENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELHQAFEQTIENGKAI 538
           E+   WMQ+ +PE A++D  IGTACE VKKAWR KH  V +LW +L + F   ++ G +I
Sbjct: 479 ESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACVVQEGGSI 538

Query: 539 IARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNNRSYLNTTTRQLTREYTYGGKLT 598
            AR+  +VP + M++ K ++ ++LPS R LVY DV  + SYLNT T QL RE TYGGKLT
Sbjct: 539 SARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYLNTATSQLMRERTYGGKLT 598

Query: 599 ENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWA 658
           ENIVQA+SRDIL EGM NATK GYDIVLTVHDEIV ETPDT  F+   L  LMT NPSWA
Sbjct: 599 ENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWA 658

Query: 659 KGLPLKAEGYESKRYRK 675
           KGLPLKAEGYE+KRYRK
Sbjct: 659 KGLPLKAEGYEAKRYRK 675


>gi|254780127|ref|YP_003064540.1| putative DNA polymerase from bacteriophage origin [Candidatus
           Liberibacter asiaticus str. psy62]
 gi|254039804|gb|ACT56600.1| putative DNA polymerase from bacteriophage origin [Candidatus
           Liberibacter asiaticus str. psy62]
 gi|317120698|gb|ADV02521.1| DNA polymerase A [Liberibacter phage SC1]
 gi|317120741|gb|ADV02563.1| DNA polymerase A [Liberibacter phage SC2]
 gi|317120802|gb|ADV02623.1| DNA polymerase A [Liberibacter phage SC2]
 gi|317120842|gb|ADV02663.1| DNA polymerase A [Liberibacter phage SC1]
          Length = 675

 Score =  793 bits (2047), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/677 (59%), Positives = 484/677 (71%), Gaps = 4/677 (0%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHDPVMPQVLKEA 60
           M+ LFID ETRSP  L K G+  YAE   + L A+ +DD PV+LWD      MP  L + 
Sbjct: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQY 60

Query: 61  LENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKLSS 120
           L +  V  VAHNS FER + K    +DIP  RWICT VLAR+NGLPS+LK    AL  S 
Sbjct: 61  LRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNFSE 120

Query: 121 Q--KMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREIFKRLEPL 178
              KMEEGK LIARFCKG      YD  + NH +AW+LFGEYCK DV  TRE+FKRL PL
Sbjct: 121 HLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRLIPL 180

Query: 179 SSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSSSRCLEK 238
           S  E++LW LDQTINDRGY +D+ L   L +++  ER KLD+++  LT G++ SSR    
Sbjct: 181 SDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSRQTYA 240

Query: 239 LKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLNTLVEAM 298
           L+ +LFL TG+ L D++E T + +LS +  +T  A  +  NR+ +S SA+LKLNTL EA+
Sbjct: 241 LRMYLFLITGIDLVDMSEGTLKSILS-HSNITQLAKDLILNRLASSGSAILKLNTLSEAV 299

Query: 299 NSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITSDPDPLQ 358
           +SDGRLRGTLQF GASRTGRWSGCVF PQNLPR  RS E L Q I  L    T   DPL 
Sbjct: 300 SSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGETI-ADPLG 358

Query: 359 IISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFN 418
           + SDCVRSC+IAS GKKLVVADLAGIEARVLAW+AGE WK+KAF  GED+YVTTYA++FN
Sbjct: 359 LASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFN 418

Query: 419 VAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVKTNSAPEEWEDA 478
               +V+K+QRAIGKVMELALGYQGGAK F+ MAS  GL+L  F+  VK+ S  E+WE A
Sbjct: 419 TPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTSTFEDWEQA 478

Query: 479 ENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELHQAFEQTIENGKAI 538
           E+   WMQ+ +PE A++D  IGTACE VKKAWR KH  V +LW +L + F   ++ G +I
Sbjct: 479 ESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACVVQEGGSI 538

Query: 539 IARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNNRSYLNTTTRQLTREYTYGGKLT 598
            AR+  +VP + M++ K ++ ++LPS R LVY DV  + SYLNT T QL RE TYGGKLT
Sbjct: 539 SARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYLNTATSQLMRERTYGGKLT 598

Query: 599 ENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWA 658
           ENIVQA+SRDIL EGM NATK GYDIVLTVHDEIV ETPDT  F+   L  LMT NPSWA
Sbjct: 599 ENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWA 658

Query: 659 KGLPLKAEGYESKRYRK 675
           KGLPLKAEGYE+KRYRK
Sbjct: 659 KGLPLKAEGYEAKRYRK 675


>gi|255957561|dbj|BAH96622.1| DNA-directed DNA polymerase [Candidatus Liberibacter asiaticus]
 gi|255957566|dbj|BAH96626.1| DNA-directed DNA polymerase [Candidatus Liberibacter asiaticus]
 gi|255957571|dbj|BAH96630.1| DNA-directed DNA polymerase [Candidatus Liberibacter asiaticus]
 gi|255957576|dbj|BAH96634.1| DNA-directed DNA polymerase [Candidatus Liberibacter asiaticus]
 gi|255957581|dbj|BAH96638.1| DNA-directed DNA polymerase [Candidatus Liberibacter asiaticus]
 gi|255957586|dbj|BAH96642.1| DNA-directed DNA polymerase [Candidatus Liberibacter asiaticus]
 gi|255957591|dbj|BAH96646.1| DNA-directed DNA polymerase [Candidatus Liberibacter asiaticus]
 gi|255957601|dbj|BAH96654.1| DNA-directed DNA polymerase [Candidatus Liberibacter asiaticus]
 gi|255957631|dbj|BAH96678.1| DNA-directed DNA polymerase [Candidatus Liberibacter asiaticus]
 gi|255957636|dbj|BAH96682.1| DNA-directed DNA polymerase [Candidatus Liberibacter asiaticus]
 gi|255957646|dbj|BAH96690.1| DNA-directed DNA polymerase [Candidatus Liberibacter asiaticus]
 gi|255957651|dbj|BAH96694.1| DNA-directed DNA polymerase [Candidatus Liberibacter asiaticus]
 gi|255957656|dbj|BAH96698.1| DNA-directed DNA polymerase [Candidatus Liberibacter asiaticus]
 gi|255957681|dbj|BAH96718.1| DNA-directed DNA polymerase [Candidatus Liberibacter asiaticus]
          Length = 675

 Score =  790 bits (2041), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/677 (59%), Positives = 483/677 (71%), Gaps = 4/677 (0%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHDPVMPQVLKEA 60
           M+ LFID ETRSP  L K G+  YAE   + L A+ +DD PV+LWD      MP  L + 
Sbjct: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQY 60

Query: 61  LENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKLSS 120
           L +  V  VAHNS FER + K    +DIP  RWICT VLAR+NGLPS+LK    AL  S 
Sbjct: 61  LRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNFSE 120

Query: 121 Q--KMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREIFKRLEPL 178
              KMEEGK LIARFC G      YD  + NH +AW+LFGEYCK DV  TRE+FKRL PL
Sbjct: 121 HLTKMEEGKALIARFCNGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRLIPL 180

Query: 179 SSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSSSRCLEK 238
           S  E++LW LDQTINDRGY +D+ L   L +++  ER KLD+++  LT G++ SSR    
Sbjct: 181 SDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSRQTYT 240

Query: 239 LKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLNTLVEAM 298
           L+ +LFL TG+ L D++E T + +LS +  +T  A  +  NR+ +S SA+LKLNTL EA+
Sbjct: 241 LRMYLFLITGIDLVDMSEGTLKSILS-HSNITQLAKDLILNRLASSGSAILKLNTLSEAV 299

Query: 299 NSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITSDPDPLQ 358
           +SDGRLRGTLQF GASRTGRWSGCVF PQNLPR  RS E L Q I  L    T   DPL 
Sbjct: 300 SSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGETI-ADPLG 358

Query: 359 IISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFN 418
           + SDCVRSC+IAS GKKLVVADLAGIEARVLAW+AGE WK+KAF  GED+YVTTYA++FN
Sbjct: 359 LASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFN 418

Query: 419 VAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVKTNSAPEEWEDA 478
               +V+K+QRAIGKVMELALGYQGGAK F+ MAS  GL+L  F+  VK+ S  E+WE A
Sbjct: 419 TPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTSTFEDWEQA 478

Query: 479 ENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELHQAFEQTIENGKAI 538
           E+   WMQ+ +PE A++D  IGTACE VKKAWR KH  V +LW +L + F   ++ G +I
Sbjct: 479 ESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACVVQEGGSI 538

Query: 539 IARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNNRSYLNTTTRQLTREYTYGGKLT 598
            AR+  +VP + M++ K ++ ++LPS R LVY DV  + SYLNT T QL RE TYGGKLT
Sbjct: 539 SARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYLNTATSQLMRERTYGGKLT 598

Query: 599 ENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWA 658
           ENIVQA+SRDIL EGM NATK GYDIVLTVHDEIV ETPDT  F+   L  LMT NPSWA
Sbjct: 599 ENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWA 658

Query: 659 KGLPLKAEGYESKRYRK 675
           KGLPLKAEGYE+KRYRK
Sbjct: 659 KGLPLKAEGYEAKRYRK 675


>gi|255957621|dbj|BAH96670.1| DNA-directed DNA polymerase [Candidatus Liberibacter asiaticus]
          Length = 675

 Score =  790 bits (2041), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/677 (59%), Positives = 483/677 (71%), Gaps = 4/677 (0%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHDPVMPQVLKEA 60
           M+ LFID ETRSP  L K G+  YAE   + L A+ +DD PV+LWD      MP  L + 
Sbjct: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQY 60

Query: 61  LENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKLSS 120
           L +  V  VAHNS FER + K    +DIP  RWICT VLAR+NGLPS+LK    AL  S 
Sbjct: 61  LRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNFSE 120

Query: 121 Q--KMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREIFKRLEPL 178
              KMEEGK LIARFCKG      YD  + NH +AW+LFGEYCK DV  TRE+FKRL PL
Sbjct: 121 HLTKMEEGKALIARFCKGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRLIPL 180

Query: 179 SSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSSSRCLEK 238
           S  E++LW LDQTINDRGY +D+ L   L +++  ER KLD+++  LT G++ SSR    
Sbjct: 181 SDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSRQTYT 240

Query: 239 LKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLNTLVEAM 298
           L+ +LFL TG+ L D++E T + +LS +  +T  A  +  NR+ +S SA+LKLNTL E +
Sbjct: 241 LRMYLFLITGIDLVDMSEGTLKSILS-HSNITQLAKDLILNRLASSGSAILKLNTLSETV 299

Query: 299 NSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITSDPDPLQ 358
           +SDGRLRGTLQF GASRTGRWSGCVF PQNLPR  RS E L Q I  L    T   DPL 
Sbjct: 300 SSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGETI-ADPLG 358

Query: 359 IISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFN 418
           + SDCVRSC+IAS GKKLVVADLAGIEARVLAW+AGE WK+KAF  GED+YVTTYA++FN
Sbjct: 359 LASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFN 418

Query: 419 VAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVKTNSAPEEWEDA 478
               +V+K+QRAIGKVMELALGYQGGAK F+ MAS  GL+L  F+  VK+ S  E+WE A
Sbjct: 419 TPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTSTFEDWEQA 478

Query: 479 ENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELHQAFEQTIENGKAI 538
           E+   WMQ+ +PE A++D  IGTACE VKKAWR KH  V +LW +L + F   ++ G +I
Sbjct: 479 ESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACVVQEGGSI 538

Query: 539 IARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNNRSYLNTTTRQLTREYTYGGKLT 598
            AR+  +VP + M++ K ++ ++LPS R LVY DV  + SYLNT T QL RE TYGGKLT
Sbjct: 539 SARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYLNTATSQLMRERTYGGKLT 598

Query: 599 ENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWA 658
           ENIVQA+SRDIL EGM NATK GYDIVLTVHDEIV ETPDT  F+   L  LMT NPSWA
Sbjct: 599 ENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWA 658

Query: 659 KGLPLKAEGYESKRYRK 675
           KGLPLKAEGYE+KRYRK
Sbjct: 659 KGLPLKAEGYEAKRYRK 675


>gi|255957556|dbj|BAH96618.1| DNA-directed DNA polymerase [Candidatus Liberibacter asiaticus]
          Length = 675

 Score =  790 bits (2039), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/677 (59%), Positives = 482/677 (71%), Gaps = 4/677 (0%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHDPVMPQVLKEA 60
           M+ LFID ETRSP  L K G+  YAE   + L A+ +DD PV+LWD      MP  L + 
Sbjct: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQY 60

Query: 61  LENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKLSS 120
           L +  V  VAHNS FER + K    +DIP  RWICT VLAR+NGLPS+LK    AL  S 
Sbjct: 61  LRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNFSE 120

Query: 121 Q--KMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREIFKRLEPL 178
              KMEEGK LIARFC G      YD  + NH +AW+LFGEYCK DV  TRE+FKRL PL
Sbjct: 121 HLTKMEEGKALIARFCNGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRLIPL 180

Query: 179 SSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSSSRCLEK 238
           S  E++LW LDQTINDRGY +D+ L   L +++  ER KLD+++  LT G++ SSR    
Sbjct: 181 SDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSRQTYT 240

Query: 239 LKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLNTLVEAM 298
           L+ +LFL TG+ L D++E T + +LS +  +T  A  +  NR+ +S SA+LKLNTL EA+
Sbjct: 241 LRMYLFLITGIDLVDMSEGTLKSILS-HSNITQLAKDLILNRLASSGSAILKLNTLSEAV 299

Query: 299 NSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITSDPDPLQ 358
           +SDGRLRGTLQF GASRTGRWSGCVF PQNLPR  RS E L Q I  L    T   DPL 
Sbjct: 300 SSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGETI-ADPLG 358

Query: 359 IISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFN 418
           + SDCVRSC+IAS GKKLVVADLAGIEARVLAW+AGE WK+KAF  GED+YVTTYA++FN
Sbjct: 359 LASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFN 418

Query: 419 VAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVKTNSAPEEWEDA 478
               +V+K+QRAIGKVMELALGYQGGAK F+ MAS  GL+L  F+  VK+ S  E+WE A
Sbjct: 419 TPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTSTFEDWEQA 478

Query: 479 ENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELHQAFEQTIENGKAI 538
           E+   WMQ+ +PE A++D  IGTACE VKKAWR KH  V +LW +L + F   ++ G +I
Sbjct: 479 ESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACVVQEGGSI 538

Query: 539 IARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNNRSYLNTTTRQLTREYTYGGKLT 598
            AR+  +VP + M++ K ++ ++LPS R LVY DV  + SYLNT T QL RE TYGGKLT
Sbjct: 539 SARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYLNTATSQLMRERTYGGKLT 598

Query: 599 ENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWA 658
           ENIVQA+SRDIL EGM NATK GYDIVLTVHDEIV ETPDT  F+   L  LMT NPSWA
Sbjct: 599 ENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDTPYFSVGTLCSLMTKNPSWA 658

Query: 659 KGLPLKAEGYESKRYRK 675
           KG PLKAEGYE+KRYRK
Sbjct: 659 KGFPLKAEGYEAKRYRK 675


>gi|255957596|dbj|BAH96650.1| DNA-directed DNA polymerase [Candidatus Liberibacter asiaticus]
 gi|255957606|dbj|BAH96658.1| DNA-directed DNA polymerase [Candidatus Liberibacter asiaticus]
          Length = 675

 Score =  788 bits (2035), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/677 (59%), Positives = 482/677 (71%), Gaps = 4/677 (0%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHDPVMPQVLKEA 60
           M+ LFID ETRSP  L K G+  YAE   + L A+ +DD PV+LWD      MP  L + 
Sbjct: 1   MSKLFIDIETRSPQPLPKVGVWAYAEQAVITLCAYAWDDEPVKLWDRTEQSAMPSDLLQY 60

Query: 61  LENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKLSS 120
           L +  V  VAHNS FER + K    +DIP  RWICT VLAR+NGLPS+LK    AL  S 
Sbjct: 61  LRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALNFSE 120

Query: 121 Q--KMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREIFKRLEPL 178
              KMEEGK LIARFC G      YD  + NH +AW+LFGEYCK DV  TRE+FKRL PL
Sbjct: 121 HLTKMEEGKALIARFCNGSIDSPPYDCTRANHVQAWQLFGEYCKRDVEATRELFKRLIPL 180

Query: 179 SSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSSSRCLEK 238
           S  E++LW LDQTINDRGY +D+ L   L +++  ER KLD+++  LT G++ SSR    
Sbjct: 181 SDGERDLWLLDQTINDRGYRIDLDLVLKLQELIAQERKKLDEDIVKLTDGIIRSSRQTYT 240

Query: 239 LKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLNTLVEAM 298
           L+ +LFL TG+ L D++E T + +LS +  +T  A  +  NR+ +S SA+LKLNTL EA+
Sbjct: 241 LRMYLFLITGIDLVDMSEGTLKSILS-HSNITQLAKDLILNRLASSGSAILKLNTLSEAV 299

Query: 299 NSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITSDPDPLQ 358
           +SDGRLRGTLQF GASRTGRWSGCVF PQNLPR  RS E L Q I  L    T   DPL 
Sbjct: 300 SSDGRLRGTLQFYGASRTGRWSGCVFQPQNLPRQERSEEILTQTIQALNRGETI-ADPLG 358

Query: 359 IISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFN 418
           + SDCVRSC+IAS GKKLVVADLAGIEARVLAW+AGE WK+KAF  GED+YVTTYA++FN
Sbjct: 359 LASDCVRSCIIASNGKKLVVADLAGIEARVLAWIAGEDWKIKAFANGEDIYVTTYAKAFN 418

Query: 419 VAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVKTNSAPEEWEDA 478
               +V+K+QRAIGKVMELALGYQGGAK F+ MAS  GL+L  F+  VK+ S  E+WE A
Sbjct: 419 TPIDKVSKEQRAIGKVMELALGYQGGAKVFKTMASHCGLDLQQFSQNVKSTSTFEDWEQA 478

Query: 479 ENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELHQAFEQTIENGKAI 538
           E+   WMQ+ +PE A++D  IGTACE VKKAWR KH  V +LW +L + F   ++ G +I
Sbjct: 479 ESHHLWMQDQYPEFAVKDKLIGTACELVKKAWRAKHQGVLQLWKDLTEGFACVVQEGGSI 538

Query: 539 IARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNNRSYLNTTTRQLTREYTYGGKLT 598
            AR+  +VP + M++ K ++ ++LPS R LVY DV  + SYLNT T QL RE TYGGKLT
Sbjct: 539 SARRVANVPRLVMRRHKRDVHIVLPSSRRLVYSDVKGDCSYLNTATSQLMRERTYGGKLT 598

Query: 599 ENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWA 658
           ENIVQA+SRDIL EGM NATK GYDIVLTVHDEIV ETPD   F+   L  LMT NPSWA
Sbjct: 599 ENIVQAISRDILCEGMKNATKNGYDIVLTVHDEIVSETPDIPYFSVGTLCSLMTKNPSWA 658

Query: 659 KGLPLKAEGYESKRYRK 675
           KGLPLKAEGYE+KRYRK
Sbjct: 659 KGLPLKAEGYEAKRYRK 675


>gi|291283829|ref|YP_003500647.1| DNA polymerase I - 3''''-5'''' exonuclease and polymerase domains
           [Escherichia coli O55:H7 str. CB9615]
 gi|290763702|gb|ADD57663.1| DNA polymerase I - 3''''-5'''' exonuclease and polymerase domains
           [Escherichia coli O55:H7 str. CB9615]
          Length = 687

 Score =  453 bits (1166), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 273/696 (39%), Positives = 394/696 (56%), Gaps = 38/696 (5%)

Query: 4   LFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHDPVMPQVLKEALEN 63
           L+ D ET   I +T  G   YAE V V+LFA+  +D PV +WD      +P  L EA+ +
Sbjct: 5   LWGDLETYCEIPITN-GTHAYAEGVEVMLFAWAINDGPVNVWDITAGGGIPHGLYEAIAD 63

Query: 64  TDVTIVAHNSYFERTVLK-ACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKLSSQK 122
            +  +  HNS+F+RTVL+ A   L  P+ RW  T+V A ++GLP +L  + E L +   K
Sbjct: 64  PETLLYFHNSHFDRTVLRYAMPRLAPPVERWRDTMVQALAHGLPGSLGELCEILGVPQDK 123

Query: 123 ME--EGKELIARFCKGETHECLYDR-NKPNHREAWRLFGEYCKGDVTVTREIFKRLEPLS 179
            +  EGK LI  FCK         R     H E WR F  Y   D+   RE++KRL   +
Sbjct: 124 AKNKEGKALIQLFCKPRPKNSKLRRATSKTHPEEWRRFVAYAGLDIEAMREVYKRLPKWN 183

Query: 180 SKEQEL--WYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSSSRCLE 237
            +  EL  W+ DQ INDRG C+D+ LA    + VD E+ +L +  + +T G V ++   +
Sbjct: 184 YQGTELALWHRDQQINDRGVCMDMQLARAAIEAVDQEQKRLAKRTQEMTDGEVQAATQRD 243

Query: 238 KLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLNTLVEA 297
            L   +    G+ L D+  +T +R ++ +  L     ++   R++AS ++  K   L++ 
Sbjct: 244 ALIKHIVESYGVELPDMQRSTLERRIA-DPHLPSAVKELLAIRLQASTTSTSKYKALMKG 302

Query: 298 MNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITS--DPD 355
           ++ DGRLRGTLQF GASRTGRW+G +F PQNLPRPS   E++D+ I  L          +
Sbjct: 303 VSHDGRLRGTLQFCGASRTGRWAGRLFQPQNLPRPSLKQEQIDEGIEALKAGCAGLLFDN 362

Query: 356 PLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFE-----TGEDLYV 410
            +++ S  +R C+IA  GKKLVV+DL+ IE R+LAW+AGE+WKL AF      TG DLY 
Sbjct: 363 IMELTSSALRGCIIAPTGKKLVVSDLSNIEGRMLAWLAGEEWKLNAFREYDAGTGPDLYK 422

Query: 411 TTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVKTNS 470
             YA++F++AP  V K  R IGKVMEL LGY GG  AF   A   GL+L+  A+    N 
Sbjct: 423 LAYAKAFDIAPDDVDKHMRQIGKVMELGLGYGGGVSAFITFALVYGLDLDELANAALPNI 482

Query: 471 APEEWEDAENFCRWMQENHPEHAI----EDLFIGTACERVKKAWRQKHSRVSELWNELHQ 526
             +   +A++   W  E+    +     E +FI  AC+ +K+ WR+ H    + W EL  
Sbjct: 483 PRDVIREAKS---WYNESVKHKSTFGLSERVFI--ACDSLKRLWRRAHPATCDFWYEL-- 535

Query: 527 AFEQTIENGKAIIARKRRDVPLVYMK--KDKNNLILMLPSGRSLVYRDV---GNNRSYL- 580
             E+T+   +  IA  ++ +   Y+K  +D   L + LPSGR++ Y        N +Y+ 
Sbjct: 536 --ERTV---RTAIATPQKTLYCGYLKIRRDGAWLRIQLPSGRAVCYPSPIIEKGNITYMG 590

Query: 581 -NTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETPDT 639
            N+ +R+  R  TYGGKL EN+ QA +RD+LA  M     AGY IVLTVHDE++ E PDT
Sbjct: 591 VNSYSRKWQRLKTYGGKLVENVTQAAARDVLAGNMPLIEDAGYSIVLTVHDEVITEAPDT 650

Query: 640 DEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           ++FN   L  L+++NP WA  +PL A G+E+  YRK
Sbjct: 651 EDFNDKALSALLSTNPEWAPDIPLNAGGFEAYHYRK 686


>gi|191173996|ref|ZP_03035513.1| DNA polymerase [Escherichia coli F11]
 gi|190905687|gb|EDV65309.1| DNA polymerase [Escherichia coli F11]
 gi|324014350|gb|EGB83569.1| hypothetical protein HMPREF9533_01582 [Escherichia coli MS 60-1]
          Length = 687

 Score =  453 bits (1166), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 273/696 (39%), Positives = 393/696 (56%), Gaps = 38/696 (5%)

Query: 4   LFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHDPVMPQVLKEALEN 63
           L+ D ET   I +T  G   YAE V V+LFA+  +D PV +WD      +P  L EA+  
Sbjct: 5   LWGDLETYCEIPITN-GTHAYAEGVEVMLFAWAINDEPVNVWDITAGGGIPHGLYEAIAA 63

Query: 64  TDVTIVAHNSYFERTVLK-ACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKLSSQK 122
            +  +  HNS+F+RTVL+ A   L  P+ RW  T+V A ++GLP +L  + E L +   K
Sbjct: 64  PETLLYFHNSHFDRTVLRYAMPRLAPPVERWRDTMVQALAHGLPGSLGELCEVLGVPQDK 123

Query: 123 ME--EGKELIARFCKGETHECLYDR-NKPNHREAWRLFGEYCKGDVTVTREIFKRLEPLS 179
            +  EGK LI  FCK         R     H E WR F  Y   D+   RE++KRL   +
Sbjct: 124 AKDKEGKALIQLFCKPRPKNSKLRRATSKTHPEEWRRFVAYAGLDIEAMREVYKRLPKWN 183

Query: 180 SKEQEL--WYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSSSRCLE 237
            +  EL  W+ DQ INDRG C+D+ LA    + VD E+ +L +  + +T G V ++   +
Sbjct: 184 YQGTELALWHRDQQINDRGVCMDIQLARAAIEAVDQEQKRLAKRTQEMTDGEVQAATQRD 243

Query: 238 KLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLNTLVEA 297
            L   +    G+ L D+  +T +R ++ +  L     ++   R++AS ++  K   L++ 
Sbjct: 244 ALIKHIVESYGVELPDMQRSTLERRIA-DPDLPSAVKELLAIRLQASTTSTSKYKALMKG 302

Query: 298 MNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITS--DPD 355
           ++ DGRLRGTLQF GASRTGRW+G +F PQNLPRPS   E++D+ I  L          +
Sbjct: 303 VSHDGRLRGTLQFCGASRTGRWAGRLFQPQNLPRPSLKQEQIDEGIEALKAGCADLLFDN 362

Query: 356 PLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFE-----TGEDLYV 410
            +++ S  +R C+IA  GKKLVV+DL+ IE R+LAW+AGE+WKL AF      TG DLY 
Sbjct: 363 IMELTSSALRGCIIAPTGKKLVVSDLSNIEGRMLAWLAGEEWKLNAFREYDAGTGPDLYK 422

Query: 411 TTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVKTNS 470
             YA++F++AP  V K  R IGKVMEL LGY GG  AF   A   GL+L+  A+    N 
Sbjct: 423 LAYAKAFDIAPDDVDKHMRQIGKVMELGLGYGGGVSAFITFALVYGLDLDELANAALPNI 482

Query: 471 APEEWEDAENFCRWMQENHPEHAI----EDLFIGTACERVKKAWRQKHSRVSELWNELHQ 526
             +   +A++   W  E+    +     E +FI  AC+ +K+ WR+ H    + W EL  
Sbjct: 483 PRDVIREAKS---WYNESVKRKSTFGLSERVFI--ACDSLKRLWRRAHPATCDFWYEL-- 535

Query: 527 AFEQTIENGKAIIARKRRDVPLVYMK--KDKNNLILMLPSGRSLVYRDV---GNNRSYL- 580
             E+T+   +  IA  ++ +   Y+K  +D   L + LPSGR++ Y        N +Y+ 
Sbjct: 536 --ERTV---RTAIATPQKTLYCGYLKIRRDGAWLRIQLPSGRAVCYPSPVIEKGNITYMG 590

Query: 581 -NTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETPDT 639
            N+ +R+  R  TYGGKL EN+ QA +RD+LA  M     AGY IVLTVHDE++ E PDT
Sbjct: 591 VNSYSRKWQRLKTYGGKLVENVTQAAARDVLAGNMPLIEDAGYSIVLTVHDEVITEAPDT 650

Query: 640 DEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           ++FN   L  L+++NP WA  +PL A G+E+  YRK
Sbjct: 651 EDFNDKALSALLSTNPEWAPDIPLNAGGFEAYHYRK 686


>gi|260845239|ref|YP_003223017.1| putative DNA polymerase [Escherichia coli O103:H2 str. 12009]
 gi|257760386|dbj|BAI31883.1| putative DNA polymerase [Escherichia coli O103:H2 str. 12009]
          Length = 687

 Score =  452 bits (1164), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 275/696 (39%), Positives = 392/696 (56%), Gaps = 38/696 (5%)

Query: 4   LFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHDPVMPQVLKEALEN 63
           L+ D ET   I +T  G   YAE V V+LFA+  +D PV +WD      +P  L EA+  
Sbjct: 5   LWGDLETYCEIPITN-GTHAYAEGVEVMLFAWAINDGPVNVWDITAGGGIPHGLYEAIAA 63

Query: 64  TDVTIVAHNSYFERTVLK-ACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKLSSQK 122
            +  +  HNS+F+RTVL+ A   L  P+ RW  T+V A ++GLP AL  + E L +   K
Sbjct: 64  PETLLYFHNSHFDRTVLRYAMPRLAPPVERWRDTMVQALAHGLPGALGELCEVLGVPQDK 123

Query: 123 ME--EGKELIARFCKGETHECLYDR-NKPNHREAWRLFGEYCKGDVTVTREIFKRLEPLS 179
            +  EGK LI  FCK         R     H E WR F  Y   D+   RE++KRL   +
Sbjct: 124 AKDKEGKALIQLFCKPRPKNSKLRRATSKTHPEEWRRFVAYAGLDIEAMREVYKRLPKWN 183

Query: 180 SKEQEL--WYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSSSRCLE 237
            +  EL  W+ DQ INDRG C+DV LA      VD E+ +L +  + +T G V ++   +
Sbjct: 184 YQGTELALWHRDQQINDRGVCMDVELARAAIDAVDQEQKRLAKRTQEMTDGEVQAATQRD 243

Query: 238 KLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLNTLVEA 297
            L   +    G+ L D+  +T +R ++ +  L     ++   R++AS ++  K   L++ 
Sbjct: 244 ALIKHIVESYGVELPDMQRSTLERRIA-DPDLPSAVKELLAIRLQASTTSTSKYKALMKG 302

Query: 298 MNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITS--DPD 355
           ++ DGRLRGTLQF GASRTGRW+G +F PQNLPRPS   E++D+ I  L          +
Sbjct: 303 VSHDGRLRGTLQFCGASRTGRWAGRLFQPQNLPRPSLKQEQIDEGIEALKAGCADLLFDN 362

Query: 356 PLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFE-----TGEDLYV 410
            +++ S  +R C+IA  GKKLVV+DL+ IE R+LAW+AGE+WKL AF      TG DLY 
Sbjct: 363 IMELTSSALRGCIIAPTGKKLVVSDLSNIEGRMLAWLAGEEWKLNAFREYDAGTGPDLYK 422

Query: 411 TTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVKTNS 470
             YA++F++AP  V K  R IGKVMEL LGY GG  AF   A   GL+L+  A+    N 
Sbjct: 423 LAYAKAFDIAPDDVDKHMRQIGKVMELGLGYGGGVSAFITFALVYGLDLDGLANAALPNI 482

Query: 471 APEEWEDAENFCRWMQENHPEHAI----EDLFIGTACERVKKAWRQKHSRVSELWNELHQ 526
             +   +A++   W  E+    +     E +FI  AC+ +K+ WR+ H    + W EL  
Sbjct: 483 PRDVIREAKS---WYDESVKRKSTYGLSERVFI--ACDSLKRLWRRAHPATCDFWYEL-- 535

Query: 527 AFEQTIENGKAIIARKRRDVPLVYMK--KDKNNLILMLPSGRSLVYRDV---GNNRSYL- 580
             E T+   +  IA  ++ +   Y+K  +D   L + LPSGR++ Y        N +Y+ 
Sbjct: 536 --ECTV---RTAIATPQKTLYCGYLKIRRDGAWLRIQLPSGRAVCYPSPVIEQGNITYMG 590

Query: 581 -NTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETPDT 639
            N+ +R+  R  TYGGKL EN+ QA +RD+LA  M     AGY IVLTVHDE++ E+PDT
Sbjct: 591 VNSYSRKWQRLKTYGGKLVENVTQAAARDVLAGNMPLIEDAGYSIVLTVHDEVITESPDT 650

Query: 640 DEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           ++FN   L  L+++NP WA  +PL A G+E+  YRK
Sbjct: 651 EDFNDKALSALLSTNPEWAPDIPLNAGGFEAYHYRK 686


>gi|323159211|gb|EFZ45201.1| DNA-directed DNA polymerase [Escherichia coli E128010]
          Length = 687

 Score =  452 bits (1162), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 274/696 (39%), Positives = 393/696 (56%), Gaps = 38/696 (5%)

Query: 4   LFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHDPVMPQVLKEALEN 63
           L+ D ET   I +T  G   YAE V V+LFA+  +D PV +WD      +P  L EA+ +
Sbjct: 5   LWGDLETYCEIPITN-GTHAYAEGVEVMLFAWAINDGPVNVWDITAGGGIPHGLYEAIAD 63

Query: 64  TDVTIVAHNSYFERTVLK-ACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKLSSQK 122
            +  +  HNS+F+RTVL+ A   L  P+ RW  T+V A ++GLP +L  + E L +   K
Sbjct: 64  PETLLYFHNSHFDRTVLRYAMPRLAPPVERWRDTMVQALAHGLPGSLGELCEVLGVPQDK 123

Query: 123 ME--EGKELIARFCKGETHECLYDR-NKPNHREAWRLFGEYCKGDVTVTREIFKRLEPLS 179
            +  EGK LI  FCK         R     H E WR F  Y   D+   RE++KRL   +
Sbjct: 124 AKDKEGKALIQLFCKPRPKNSKLRRATSKTHPEEWRRFVAYAGLDIEAMREVYKRLPKWN 183

Query: 180 SKEQEL--WYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSSSRCLE 237
            +  EL  W+ DQ INDRG C+DV LA      VD E+ +L +  + +T G V ++   +
Sbjct: 184 YQGTELALWHRDQQINDRGVCMDVELARAAIDAVDQEQKRLAKRTQEMTDGEVQAATQRD 243

Query: 238 KLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLNTLVEA 297
            L   +    G+ L D+  +T +R ++ +  L     ++   R++AS ++  K   L++ 
Sbjct: 244 ALIKHIVESYGVELPDMQRSTLERRIA-DPDLPSAVKELLAIRLQASTTSTSKYKALMKG 302

Query: 298 MNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITS--DPD 355
           ++ DGRLRGTLQF GASRTGRW+G +F PQNLPRPS   E++D+ I  L          +
Sbjct: 303 VSHDGRLRGTLQFCGASRTGRWAGRLFQPQNLPRPSLKQEQIDEGIEALKAGCADLLFDN 362

Query: 356 PLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFE-----TGEDLYV 410
            +++ S  +R C+IA  GKKLVV+DL+ IE R+LAW+AGE+WKL AF      TG DLY 
Sbjct: 363 IMELTSSALRGCIIAPTGKKLVVSDLSNIEGRMLAWLAGEEWKLNAFREYDAGTGPDLYK 422

Query: 411 TTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVKTNS 470
             YA++F++AP  V K  R IGKVMEL LGY GG  AF   A   GL+L+  A+    N 
Sbjct: 423 LAYAKAFDIAPDDVDKHMRQIGKVMELGLGYGGGVSAFITFALVYGLDLDELANAALPNI 482

Query: 471 APEEWEDAENFCRWMQENHPEHAI----EDLFIGTACERVKKAWRQKHSRVSELWNELHQ 526
             +   +A++   W  E+    +     E +FI  AC+ +K+ WR+ H    + W EL  
Sbjct: 483 PRDVIREAKS---WYDESVKRKSTYGLSERVFI--ACDSLKRLWRRAHPATCDFWYEL-- 535

Query: 527 AFEQTIENGKAIIARKRRDVPLVYMK--KDKNNLILMLPSGRSLVYRDV---GNNRSYL- 580
             E+T+   +  IA  ++ +   Y+K  +D   L + LPSGR++ Y        N +Y+ 
Sbjct: 536 --ERTV---RTAIATPQKTLYCGYLKIRRDGAWLRIQLPSGRAVCYPSPVIEKGNITYMG 590

Query: 581 -NTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETPDT 639
            N+ +R+  R  TYGGKL ENI QA +RDILA  M     AGY IVLTVHDE++ E PDT
Sbjct: 591 VNSYSRKWQRLKTYGGKLVENITQAAARDILAGNMPLIEDAGYSIVLTVHDEVITEAPDT 650

Query: 640 DEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           ++FN   L  L++++P WA  +PL A G+E+  Y+K
Sbjct: 651 EDFNDKALSALLSTDPEWAPDIPLNAGGFEAYHYKK 686


>gi|331654014|ref|ZP_08355015.1| putative DNA polymerase (P45) [Escherichia coli M718]
 gi|331048863|gb|EGI20939.1| putative DNA polymerase (P45) [Escherichia coli M718]
          Length = 687

 Score =  451 bits (1161), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 274/696 (39%), Positives = 392/696 (56%), Gaps = 38/696 (5%)

Query: 4   LFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHDPVMPQVLKEALEN 63
           L+ D ET   I +T  G   YAE V V+LFA+  +D PV +WD      +P  L EA+  
Sbjct: 5   LWGDLETYCEIPITN-GTHAYAEGVEVMLFAWAINDGPVNVWDITAGGGIPHGLYEAIAA 63

Query: 64  TDVTIVAHNSYFERTVLK-ACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKLSSQK 122
            +  +  HNS+F+RTVL+ A   L  P+ RW  T+V A ++GLP +L  + E L +   K
Sbjct: 64  PETLLYFHNSHFDRTVLRYAMPRLAPPVERWRDTMVQALAHGLPGSLGELCEVLGVPQDK 123

Query: 123 ME--EGKELIARFCKGETHECLYDR-NKPNHREAWRLFGEYCKGDVTVTREIFKRLEPLS 179
            +  EGK LI  FCK         R     H E WR F  Y   D+   RE++KRL   +
Sbjct: 124 AKDKEGKALIQLFCKPRPKNSKLRRATSKTHPEEWRRFVAYAGLDIEAMREVYKRLPKWN 183

Query: 180 SKEQEL--WYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSSSRCLE 237
            +  EL  W+ DQ INDRG C+DV LA      VD E+ +L +  + +T G V ++   +
Sbjct: 184 YQGTELALWHRDQQINDRGVCMDVELARAAIDAVDQEQKRLAKRTQEMTDGEVQAATQRD 243

Query: 238 KLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLNTLVEA 297
            L   +    G+ L D+  +T +R ++ +  L     ++   R++AS ++  K   L++ 
Sbjct: 244 ALIKHIVESYGVELPDMQRSTLERRIA-DPDLPSAVKELLAIRLQASTTSTSKYKALMKG 302

Query: 298 MNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITS--DPD 355
           ++ DGRLRGTLQF GASRTGRW+G +F PQNLPRPS   E++D+ I  L          +
Sbjct: 303 VSHDGRLRGTLQFCGASRTGRWAGRLFQPQNLPRPSLKQEQIDEGIEALKAGCADLLFDN 362

Query: 356 PLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFE-----TGEDLYV 410
            +++ S  +R C+IA  GKKLVV+DL+ IE R+LAW+AGE+WKL AF      TG DLY 
Sbjct: 363 IMELTSSALRGCIIAPTGKKLVVSDLSNIEGRMLAWLAGEEWKLNAFREYDAGTGPDLYK 422

Query: 411 TTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVKTNS 470
             YA++F++AP  V K  R IGKVMEL LGY GG  AF   A   GL+L+  A+    N 
Sbjct: 423 LAYAKAFDIAPDDVDKHMRQIGKVMELGLGYGGGVSAFITFALVYGLDLDGLANAALPNI 482

Query: 471 APEEWEDAENFCRWMQENHPEHAI----EDLFIGTACERVKKAWRQKHSRVSELWNELHQ 526
             +   +A++   W  E+    +     E +FI  AC+ +K+ WR+ H    + W EL  
Sbjct: 483 PRDVIREAKS---WYDESVKRKSTYGLSERVFI--ACDSLKRLWRRAHPATCDFWYEL-- 535

Query: 527 AFEQTIENGKAIIARKRRDVPLVYMK--KDKNNLILMLPSGRSLVYRDV---GNNRSYL- 580
             E T+   +  IA  ++ +   Y+K  +D   L + LPSGR++ Y        N +Y+ 
Sbjct: 536 --ECTV---RTAIATPQKTLYCGYLKIRRDGAWLRIQLPSGRAVCYPSPVIEQGNITYMG 590

Query: 581 -NTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETPDT 639
            N+ +R+  R  TYGGKL EN+ QA +RD+LA  M     AGY IVLTVHDE++ E+PDT
Sbjct: 591 VNSYSRKWQRLKTYGGKLVENVTQAAARDVLAGNMPLIEDAGYSIVLTVHDEVITESPDT 650

Query: 640 DEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           ++FN   L  L+++NP WA  +PL A G+E+  YRK
Sbjct: 651 EDFNDKALSALLSTNPEWAPDIPLNAGGFEAYHYRK 686


>gi|218555134|ref|YP_002388047.1| putative DNA polymerase from bacteriophage origin [Escherichia coli
           IAI1]
 gi|218361902|emb|CAQ99502.1| putative DNA polymerase from bacteriophage origin [Escherichia coli
           IAI1]
          Length = 687

 Score =  451 bits (1161), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 274/696 (39%), Positives = 393/696 (56%), Gaps = 38/696 (5%)

Query: 4   LFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHDPVMPQVLKEALEN 63
           L+ D ET   I +T  G   YAE V V+LFA+  +D PV +WD      +P  L EA+ +
Sbjct: 5   LWGDLETYCEIPITN-GTHAYAEGVEVMLFAWAINDGPVNVWDITAGVGIPHGLYEAIAD 63

Query: 64  TDVTIVAHNSYFERTVLK-ACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKLSSQK 122
            +  +  HNS+F+RTVL+ A   L  P+ RW  T+V A ++GLP +L  + E L +   K
Sbjct: 64  PETLLYFHNSHFDRTVLRYAMPRLAPPVERWRDTMVQALAHGLPGSLGELCEVLGVPQDK 123

Query: 123 ME--EGKELIARFCKGETHECLYDR-NKPNHREAWRLFGEYCKGDVTVTREIFKRLEPLS 179
            +  EGK LI  FCK         R     H E WR F  Y   D+   RE++KRL   +
Sbjct: 124 AKDKEGKALIQLFCKPRPKNSKLRRATSKTHPEEWRRFVAYAGLDIEAMREVYKRLPKWN 183

Query: 180 SKEQEL--WYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSSSRCLE 237
            +  EL  W+ DQ INDRG C+DV LA      VD E+ +L +  + +T G V ++   +
Sbjct: 184 YQGTELALWHRDQQINDRGVCMDVELARAAIDAVDQEQKRLAKRTQEMTDGEVQAATQRD 243

Query: 238 KLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLNTLVEA 297
            L   +    G+ L D+  +T +R ++ +  L     ++   R++AS ++  K   L++ 
Sbjct: 244 ALIKHIVESYGVELPDMQRSTLERRIA-DPDLPSAVKELLAIRLQASTTSTSKYKALMKG 302

Query: 298 MNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITS--DPD 355
           ++ DGRLRGTLQF GASRTGRW+G +F PQNLPRPS   E++D+ I  L          +
Sbjct: 303 VSHDGRLRGTLQFCGASRTGRWAGRLFQPQNLPRPSLKQEQIDEGIEALKAGCADLLFDN 362

Query: 356 PLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFE-----TGEDLYV 410
            +++ S  +R C+IA  GKKLVV+DL+ IE R+LAW+AGE+WKL AF      TG DLY 
Sbjct: 363 IMELTSSALRGCIIAPTGKKLVVSDLSNIEGRMLAWLAGEEWKLNAFREYDAGTGPDLYK 422

Query: 411 TTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVKTNS 470
             YA++F++AP  V K  R IGKVMEL LGY GG  AF   A   GL+L+  A+    N 
Sbjct: 423 LAYAKAFDIAPDDVDKHMRQIGKVMELGLGYGGGVSAFITFALVYGLDLDELANAALPNI 482

Query: 471 APEEWEDAENFCRWMQENHPEHAI----EDLFIGTACERVKKAWRQKHSRVSELWNELHQ 526
             +   +A++   W  E+    +     E +FI  AC+ +K+ WR+ H    + W EL  
Sbjct: 483 PRDVIREAKS---WYDESVKRKSTYGLSERVFI--ACDSLKRLWRRAHPATCDFWYEL-- 535

Query: 527 AFEQTIENGKAIIARKRRDVPLVYMK--KDKNNLILMLPSGRSLVYRDV---GNNRSYL- 580
             E+T+   +  IA  ++ +   Y+K  +D   L + LPSGR++ Y        N +Y+ 
Sbjct: 536 --ERTV---RTAIATPQKTLYCGYLKIRRDGAWLRIQLPSGRAVCYPSPVIEKGNITYMG 590

Query: 581 -NTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETPDT 639
            N+ +R+  R  TYGGKL ENI QA +RDILA  M     AGY IVLTVHDE++ E PDT
Sbjct: 591 VNSYSRKWQRLKTYGGKLVENITQAAARDILAGNMPLIEDAGYSIVLTVHDEVITEAPDT 650

Query: 640 DEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           ++FN   L  L++++P WA  +PL A G+E+  Y+K
Sbjct: 651 EDFNDKALSALLSTDPEWAPDIPLNAGGFEAYHYKK 686


>gi|194429286|ref|ZP_03061813.1| DNA polymerase [Escherichia coli B171]
 gi|194412694|gb|EDX28989.1| DNA polymerase [Escherichia coli B171]
          Length = 687

 Score =  450 bits (1157), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 273/696 (39%), Positives = 393/696 (56%), Gaps = 38/696 (5%)

Query: 4   LFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHDPVMPQVLKEALEN 63
           L+ D ET   I +T  G   YAE V V+LFA+  +D PV +WD      +P  L EA+ +
Sbjct: 5   LWGDLETYCEIPITN-GTHAYAEGVEVMLFAWAINDGPVNVWDITAGGGIPHGLYEAIAD 63

Query: 64  TDVTIVAHNSYFERTVLK-ACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKLSSQK 122
            +  +  HNS+F+RTVL+ A   L  P+ RW  T+V A ++GLP +L  + E L +   K
Sbjct: 64  PETLLYFHNSHFDRTVLRYAMPRLAPPVERWRDTMVQALAHGLPGSLGELCEVLGVPQDK 123

Query: 123 ME--EGKELIARFCKGETHECLYDR-NKPNHREAWRLFGEYCKGDVTVTREIFKRLEPLS 179
            +  EGK LI  FCK         R     H E WR F  Y   D+   RE++KRL   +
Sbjct: 124 AKDKEGKALIQLFCKPRPKNSKLRRATSKTHPEEWRRFVAYAGLDIEAMREVYKRLPKWN 183

Query: 180 SKEQEL--WYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSSSRCLE 237
            +  EL  W+ DQ INDRG C+DV LA      VD E+ +L +  + +T G V ++   +
Sbjct: 184 YQGTELALWHRDQQINDRGVCMDVELARAAIDAVDQEQKRLAKRTQEMTDGEVQAATQRD 243

Query: 238 KLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLNTLVEA 297
            L   +    G+ L D+  +T +R ++ +  L     ++   R++AS ++  K   L++ 
Sbjct: 244 ALIKHIVESYGVELPDMQRSTLERRIA-DPDLPSAVKELLAIRLQASTTSTSKYKALMKG 302

Query: 298 MNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITS--DPD 355
           ++ DGRLRGTLQF GASRTGRW+G +F PQNLPRPS   E++D+ I  L          +
Sbjct: 303 VSHDGRLRGTLQFCGASRTGRWAGRLFQPQNLPRPSLKQEQIDEGIEALKAGCADLLFDN 362

Query: 356 PLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFE-----TGEDLYV 410
            +++ S  +R C+IA  GKKLVV+DL+ IE R+LAW+AGE+WKL AF      TG DLY 
Sbjct: 363 IMELTSSALRGCIIAPTGKKLVVSDLSNIEGRMLAWLAGEEWKLNAFREYDAGTGPDLYK 422

Query: 411 TTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVKTNS 470
             YA++F++AP  V K  R IGKVMEL LGY GG  AF   A   GL+L+  A+    N 
Sbjct: 423 LAYAKAFDIAPDDVDKHMRQIGKVMELGLGYGGGVSAFITFALVYGLDLDELANAALPNI 482

Query: 471 APEEWEDAENFCRWMQENHPEHAI----EDLFIGTACERVKKAWRQKHSRVSELWNELHQ 526
             +   +A++   W  E+    +     E +FI  AC+ +K+ WR+ H    + W EL  
Sbjct: 483 PRDVIREAKS---WYDESVKRKSTYGLSERVFI--ACDSLKRLWRRAHPATCDFWYEL-- 535

Query: 527 AFEQTIENGKAIIARKRRDVPLVYMK--KDKNNLILMLPSGRSLVYRDV---GNNRSYL- 580
             E+T+   +  IA  ++ +   Y+K  +D   L + LPSGR++ Y        N +Y+ 
Sbjct: 536 --ERTV---RTAIATPQKTLYCGYLKIRRDGAWLRIQLPSGRAVCYPSPVIEKGNITYMG 590

Query: 581 -NTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETPDT 639
            N+ +R+  R  TYGGKL ENI QA +RDILA  M     AGY IVLTVH+E++ E PDT
Sbjct: 591 VNSYSRKWQRLKTYGGKLVENITQAAARDILAGNMPLIEDAGYSIVLTVHNEVITEAPDT 650

Query: 640 DEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           ++FN   L  L++++P WA  +PL A G+E+  Y+K
Sbjct: 651 EDFNDKALSALLSTDPEWAPDIPLNAGGFEAYHYKK 686


>gi|331648300|ref|ZP_08349389.1| putative DNA polymerase (P45) [Escherichia coli M605]
 gi|331042849|gb|EGI14990.1| putative DNA polymerase (P45) [Escherichia coli M605]
          Length = 687

 Score =  448 bits (1152), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 271/696 (38%), Positives = 393/696 (56%), Gaps = 38/696 (5%)

Query: 4   LFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHDPVMPQVLKEALEN 63
           L+ D ET   I +   G   YAE V V+LFA+  +D PV +WD      +P  L EA+ +
Sbjct: 5   LWGDLETYCDIPINN-GTHAYAEGVEVMLFAWAINDGPVNVWDITAGGGIPHGLYEAIAD 63

Query: 64  TDVTIVAHNSYFERTVLK-ACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKLSSQK 122
            +  +  HNS+F+RTVL+ A   L  P+ RW  T+V A ++GLP +L  + E L +   K
Sbjct: 64  PETLLYFHNSHFDRTVLRYAMPRLAPPVERWRDTMVQALAHGLPGSLGELCEILGVPQDK 123

Query: 123 ME--EGKELIARFCKGETHECLYDR-NKPNHREAWRLFGEYCKGDVTVTREIFKRLEPLS 179
            +  EGK LI  FCK         R     H E WR F  Y   D+   RE+ KRL   +
Sbjct: 124 AKDKEGKALIQLFCKPRPKNSKLRRATSKTHPEEWRRFVAYAGLDIEAMREVCKRLPKWN 183

Query: 180 SKEQEL--WYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSSSRCLE 237
            +  EL  W+ DQ INDRG C+D+ LA    + VD E+ +L +  + +T G V ++   +
Sbjct: 184 YQGTELALWHRDQQINDRGVCMDMQLARAAIEAVDQEQKRLAKRTQEMTDGEVQAATQRD 243

Query: 238 KLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLNTLVEA 297
            L   +    G+ L D+  +T +R ++ +  L     ++   R++AS ++  K   L++ 
Sbjct: 244 ALIKHIVESYGVELPDMQRSTLERRIA-DPDLPSAVKELLAIRLQASTTSTSKYKALMKG 302

Query: 298 MNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITS--DPD 355
           ++ DGRLRGTLQF GASRTGRW+G +F PQNLPRPS   E++D+ I  L          +
Sbjct: 303 VSHDGRLRGTLQFCGASRTGRWAGRLFQPQNLPRPSLKQEQIDEGIEALKAGCADLLFDN 362

Query: 356 PLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFE-----TGEDLYV 410
            +++ S  +R C+IA  GKK+VV+DL+ IE R+LAW+AGE+WKL AF      TG DLY 
Sbjct: 363 IMELTSSALRGCIIAPTGKKMVVSDLSNIEGRMLAWLAGEEWKLNAFREYDAGTGPDLYK 422

Query: 411 TTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVKTNS 470
             YA++F++AP  V K  R IGKVMEL LGY GG  AF   A   GL+L+  A+    N 
Sbjct: 423 LAYAKAFDIAPDDVDKHMRQIGKVMELGLGYGGGVSAFITFALVYGLDLDELANAALPNI 482

Query: 471 APEEWEDAENFCRWMQENHPEHAI----EDLFIGTACERVKKAWRQKHSRVSELWNELHQ 526
             +   +A++   W  E+    +     E +FI  AC+ +K+ WR+ H    + W EL  
Sbjct: 483 PRDVIREAKS---WYGESVKRKSTYGLSERVFI--ACDSLKRLWRRAHPATCDFWYEL-- 535

Query: 527 AFEQTIENGKAIIARKRRDVPLVYMK--KDKNNLILMLPSGRSLVYRDV---GNNRSYL- 580
             E+T+   +  IA  ++ +   Y+K  +D   L + LPSGR++ Y        N +Y+ 
Sbjct: 536 --ERTV---RTAIATPQKTLYCGYLKIRRDGAWLRIQLPSGRAVCYPSPVIEKGNITYMG 590

Query: 581 -NTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETPDT 639
            N+ +R+  R  TYGGKL EN+ QA +RD+LA  M     AGY IVLTVHDE++ E+PDT
Sbjct: 591 VNSYSRKWQRLKTYGGKLVENVTQAAARDVLAGNMPLIEDAGYSIVLTVHDEVITESPDT 650

Query: 640 DEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           ++FN   L  L+++NP WA  +PL A G+E+  YRK
Sbjct: 651 EDFNDKALSALLSTNPEWAPDIPLNAGGFEAYHYRK 686


>gi|212712317|ref|ZP_03320445.1| hypothetical protein PROVALCAL_03405 [Providencia alcalifaciens DSM
           30120]
 gi|212685063|gb|EEB44591.1| hypothetical protein PROVALCAL_03405 [Providencia alcalifaciens DSM
           30120]
          Length = 685

 Score =  447 bits (1150), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 272/694 (39%), Positives = 384/694 (55%), Gaps = 34/694 (4%)

Query: 3   TLFIDFETRS--PIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHDPVMPQVLKEA 60
           TL++D ET S  PI   K G   YAE V ++LFA+  +++ V++WD      +P  LK+A
Sbjct: 4   TLWLDLETFSEKPI---KYGTHSYAETVEIMLFAWALNNNLVQVWDVTDKSPIPTELKQA 60

Query: 61  LENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEAL--KL 118
           L + +  I AHNS+F+RT+L     + I + RW  T+V A ++GLP AL A+ E L   L
Sbjct: 61  LSDPNTIIYAHNSHFDRTMLNHS-GIKIDVSRWRDTMVQALAHGLPGALGALCEVLGVPL 119

Query: 119 SSQKMEEGKELIARFCKGETHECLYDR-NKPNHREAWRLFGEYCKGDVTVTREIFKRLEP 177
              K +EGK LI  FCK         R     H E W+ F  Y   D+   RE+ KRL  
Sbjct: 120 DKAKDKEGKALIQLFCKPRPKNSALRRATSKTHPEEWKRFVAYAGLDIEAMREVHKRLPS 179

Query: 178 LSSKEQEL--WYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSSSRC 235
            +  + EL  W+ DQ INDRG  +D+ LA    + V++E+ +L +  + LT   V ++  
Sbjct: 180 WNYCDNELEHWHRDQRINDRGVYMDIQLATAAIEAVEIEQKRLAKLTQDLTDNEVQAATQ 239

Query: 236 LEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLNTLV 295
            + L   +    G+ L D+ ++T +R ++      P   ++   R+++S ++  K   L+
Sbjct: 240 RDALLQHISAAFGVDLPDMQKSTLERRINDPDIPLPLR-ELLAIRLQSSTTSTSKYKALM 298

Query: 296 EAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITS--D 353
             ++SDGRLRGTLQF GASRTGRW+G +F PQNLPRP+     +D+ I  L         
Sbjct: 299 NGVSSDGRLRGTLQFCGASRTGRWAGRLFQPQNLPRPTLDQNTIDKGIEALKAGCADLIY 358

Query: 354 PDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFE-----TGEDL 408
            D +Q+ S  +R C++A EGKKLVV+DL+ IE R+LAW+AGE WK+ AF       G DL
Sbjct: 359 DDIMQLTSSTLRGCIMAPEGKKLVVSDLSNIEGRMLAWLAGEAWKITAFSEFDKGIGADL 418

Query: 409 YVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVKT 468
           Y   YAR+FN++P  V K  R IGKVMEL LGY GG  AF   A T  L+L+  A     
Sbjct: 419 YKLAYARAFNISPEDVDKHMRQIGKVMELGLGYGGGVAAFLTFALTYSLDLDELAEAALP 478

Query: 469 NSAPEEWEDAENFCRWMQENHPEHAI-EDLFIGTACERVKKAWRQKHSRVSELWNELHQA 527
           N  P+   DA ++ +   E    + + E +FI   C+ +K+ WR  H      W EL   
Sbjct: 479 NIPPKVKHDALSWYQKSVETKKTYGLSETVFI--TCDSLKRMWRNAHPETVSFWYELEDT 536

Query: 528 FEQTIEN-GKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVY---RDVGNNRSYL--N 581
               I + G     RK +      +++DK  L ++LPSGR++ Y   R+     SY+  N
Sbjct: 537 VRHAISSPGITFPCRKLK------VRRDKAWLRIVLPSGRAVCYPSPRNDNGQISYMGVN 590

Query: 582 TTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETPDTDE 641
             +R+  R  TYGGKL EN+ QA +RD+LA  M      GYDIVLTVHDE++ E PD   
Sbjct: 591 PYSRKWQRLKTYGGKLVENVTQAAARDVLAGNMPTIEDHGYDIVLTVHDEVLTEAPDNPA 650

Query: 642 FNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           FN   L  L+ +NP WA  LPL A G+E+  YRK
Sbjct: 651 FNHEHLSELLATNPEWALDLPLSAGGFEAYHYRK 684


>gi|41179402|ref|NP_958711.1| Bbp42 [Bordetella phage BPP-1]
 gi|45569535|ref|NP_996604.1| DNA polymerase [Bordetella phage BMP-1]
 gi|45580786|ref|NP_996652.1| DNA polymerase [Bordetella phage BIP-1]
 gi|40950141|gb|AAR97707.1| Bbp42 [Bordetella phage BPP-1]
          Length = 688

 Score =  441 bits (1135), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 273/698 (39%), Positives = 388/698 (55%), Gaps = 34/698 (4%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHDPVMPQVLKEA 60
           M+TLF+D ET   + + + G   YAE   V+LFA+  D+ PV +WD      MP  L+ A
Sbjct: 1   MSTLFLDLETYCEVPI-QNGTHAYAEKAEVLLFAYALDNGPVYVWDAASGEKMPDDLRWA 59

Query: 61  LENTDVTIVAHNSYFERTVLK-ACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKLS 119
           L + +V + AHNS+F+RTVL+ A  +  + + RW  T+V A ++ LP AL  + + LK+ 
Sbjct: 60  LIDENVALCAHNSHFDRTVLRHAMPDYPLALPRWRDTMVKALAHSLPGALGDLCDILKVP 119

Query: 120 SQKMEE--GKELIARFCKGETHECLYDR-NKPNHREAWRLFGEYCKGDVTVTREIFKRLE 176
           + K ++  GK+LI  FCK         R  +  H   W  F EY   D+   R I ++L 
Sbjct: 120 TDKAKDKAGKQLIMLFCKPRPATSKLRRATRETHPAEWAKFVEYAGLDIEAMRVIDQKLP 179

Query: 177 PLSSKEQEL--WYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSSSR 234
             + +  EL  W+LDQTINDRG  VD  LAH   + V+  +  L      +T G V ++ 
Sbjct: 180 AWNYQGTELALWHLDQTINDRGVMVDTDLAHAAIRAVERTQKVLAARTSDITLGAVQAAT 239

Query: 235 CLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLNTL 294
             + +   +    GL L D+ ++T +R ++ +  L  +  ++   R++AS ++  K  TL
Sbjct: 240 QRDAMLRHVLAAYGLDLPDMQQSTLERRIA-DPDLPAELRELLGIRLQASTTSTSKYKTL 298

Query: 295 VEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITS-- 352
            + ++SDGRLRGTLQF GASRTGRW+G +F PQNLPRP    + +++ I  L        
Sbjct: 299 AKGVSSDGRLRGTLQFNGASRTGRWAGRLFQPQNLPRPVLKQDAIERGIAALKADCADLL 358

Query: 353 DPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFE-----TGED 407
             + +++ S  +R C++A EGKKLVVADL+ IE R++AW+AGE WKL AF       G D
Sbjct: 359 FANVMELTSSAIRGCIVAPEGKKLVVADLSNIEGRMIAWLAGEDWKLAAFREFDDGAGPD 418

Query: 408 LYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVK 467
           LY   YA++F V+P  V KDQR IGKVMEL LGY+GG  AF   A+T G++L+  A    
Sbjct: 419 LYKLAYAKAFAVSPDSVDKDQRQIGKVMELMLGYEGGVGAFLTGAATYGIDLDAMADAAW 478

Query: 468 TNSAPEEWEDAENFCRWMQENHPEHAIEDLFIG----TACERVKKAWRQKHSRVSELWNE 523
            +   +   +AE F  W  E      + D  +       C+ +K+ WR+ H  VS  W E
Sbjct: 479 PSIPADIIAEAEQFLAWRTEQR----LGDFGLKPKTFVVCDALKRLWRRAHPAVSSFWKE 534

Query: 524 LHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYR----DVGNNRSY 579
           L +A    +            D   +  ++D   L + LPSGR L Y     D     SY
Sbjct: 535 LEEAARLAVLRPGTTY-----DCRTLKARRDGAWLRIRLPSGRFLCYPSPQLDDAGKLSY 589

Query: 580 L--NTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETP 637
           +  N  +R+ +R  TYGGKL EN+ QA SRD+LA  M     AGY IVL+VHDE + E  
Sbjct: 590 MGVNQYSRKWSRLKTYGGKLAENVTQAASRDVLAANMPAIEAAGYQIVLSVHDENITEAD 649

Query: 638 DTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           D DEF+A+ L  LM +NP WA GLPL A G+E+ RYRK
Sbjct: 650 DRDEFSAAHLAGLMATNPPWAAGLPLAAAGFEAYRYRK 687


>gi|330862112|emb|CBX72276.1| putative DNA polymerase [Yersinia enterocolitica W22703]
          Length = 699

 Score =  432 bits (1112), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 272/714 (38%), Positives = 388/714 (54%), Gaps = 62/714 (8%)

Query: 4   LFIDFET--RSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHDPVMPQVLKEAL 61
           L+ D ET   +PI   K G   YAE V V++  +  +D PV  WD      MP+ LK  L
Sbjct: 5   LWFDSETFCETPI---KNGTHAYAEHVEVMIITYALNDDPVSEWDITSGAKMPEDLKAYL 61

Query: 62  ENTDVTIVAHNSYFERTVLKACFNLDIP------IHRWICTLVLARSNGLPSALKAVGEA 115
           ++  + I A NS+F+RT+++     D+P      I RW  T+V A ++GLP  L  + E 
Sbjct: 62  QDPSIEIYAQNSHFDRTMMRH----DMPSVIAGGIERWRDTMVKALAHGLPGGLGVLCEI 117

Query: 116 LKLSSQKME--EGKELIARFCKGETHECLYDR-NKPNHREAWRLFGEYCKGDVTVTREIF 172
           L ++  K +  EGK LI  FCK         R     H E W+ F +Y   D+   R I 
Sbjct: 118 LGITQDKAKDKEGKALIQLFCKPRAKNSTIHRATSKTHPEEWKRFLKYAGNDIEAMRAID 177

Query: 173 KRLEPL---SSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGL 229
           K+L P+     KE  LW+ DQ INDRG  +D  LA      V  E+  L +  ++LT   
Sbjct: 178 KKL-PVWNYQGKELALWHFDQLINDRGVQMDTVLAEAAVTAVVDEQKLLAKRTQNLTDNE 236

Query: 230 VSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVL 289
           V ++   + L   +    G+ L D+ ++T +R ++ + +L     ++   R++AS ++  
Sbjct: 237 VQAATQRDALLRHIVESFGVDLPDMQKSTLERRIA-DPELPSVLRELLAIRLQASTTSTS 295

Query: 290 KLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTS 349
           K  TL++ ++ DGRLRGTLQF GASRTGRW+G +F PQNLPRP    E +D  I  L   
Sbjct: 296 KYKTLLKGVSKDGRLRGTLQFCGASRTGRWAGRLFQPQNLPRPVLDQETIDTGIEALKAG 355

Query: 350 ITS--DPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAF----- 402
                  + +++IS  +R C++A +GKKLVV+DL+ IE RVLAW+AGE+WKL+AF     
Sbjct: 356 CADLLFDNVMELISSALRGCIVAPKGKKLVVSDLSNIEGRVLAWLAGEEWKLEAFRDYDT 415

Query: 403 -----ETGE------DLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKM 451
                E GE      DLY   YAR+FN++P  VTK QR IGKVMEL LG+ GG  AF   
Sbjct: 416 IIGYDEGGEALREGPDLYKLAYARAFNISPDDVTKLQRQIGKVMELGLGFGGGVAAFLTF 475

Query: 452 ASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAI----EDLFIGTACERVK 507
           A   GL+L+  A+    N       +A++   W Q +  +       E +FI  AC+ +K
Sbjct: 476 ALVYGLDLDELANAALPNVPTSIQREAQS---WYQASVKQKRTFGLSEQVFI--ACDSLK 530

Query: 508 KAWRQKHSRVSELWNELHQAFEQTIENGK-AIIARKRRDVPLVYMKKDKNNLILMLPSGR 566
           + WR  H      W+E+     + I N K   + RK +      +++D + L + LPSGR
Sbjct: 531 RMWRNAHPETVSFWSEIENTVRRAIINPKQTFVCRKLK------IRRDGSWLRIQLPSGR 584

Query: 567 SLVYRDV---GNNRSYL--NTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAG 621
           S+ Y  +   G+  SY+  NT +R+  R  TYGGKL EN  QA +RD++A  M      G
Sbjct: 585 SVCYPGIRIEGDKISYMGVNTYSRKWQRLKTYGGKLAENATQAAARDVMANNMPLIEARG 644

Query: 622 YDIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           Y+I LTVHDE++ E PDTD F +  L  L+ +NP WA  LPL A G+E+  YRK
Sbjct: 645 YEITLTVHDEVLTEAPDTDAFTSDKLSELLATNPEWALDLPLSAGGFEAYHYRK 698


>gi|170023450|ref|YP_001719955.1| DNA-directed DNA polymerase [Yersinia pseudotuberculosis YPIII]
 gi|169749984|gb|ACA67502.1| DNA-directed DNA polymerase [Yersinia pseudotuberculosis YPIII]
          Length = 693

 Score =  425 bits (1093), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 256/698 (36%), Positives = 386/698 (55%), Gaps = 36/698 (5%)

Query: 4   LFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHDPVMPQVLKEALEN 63
           L++D ET S   + + G   YA +  ++L A+  DD PV + +      +P  L  AL +
Sbjct: 5   LWLDLETYSETPI-RNGTHAYAANAEIMLIAWAIDDGPVSVHEFTEPKNLPVPLCTALRD 63

Query: 64  TDVTIVAHNSYFERTVLKACF-NLDIP------IHRWICTLVLARSNGLPSALKAVGEAL 116
            +  + AHNS F+RTVL+    +   P      + RW  T+V A ++GLP +L  + + L
Sbjct: 64  GETLVYAHNSQFDRTVLRTHLKSYKWPNVAARDVTRWRDTMVKALAHGLPGSLSDLCDIL 123

Query: 117 KLSSQKMEE--GKELIARFCKGETHECLYDR-NKPNHREAWRLFGEYCKGDVTVTREIFK 173
            ++  K ++  GK LI  FCK         R  K  H E W+ F +Y   D+   REI K
Sbjct: 124 GVAQDKAKDKAGKALIQLFCKPRAKNSAIRRATKQTHPEEWKRFIDYAGLDIEAMREIDK 183

Query: 174 RLEPL---SSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLV 230
           +L P+    S E  LW+ DQ INDRG  +D  LA      V++E+ +L    + LT   V
Sbjct: 184 KL-PVWNYQSNELALWHFDQRINDRGVQMDTVLAEAAVSAVEIEQKRLAVRTQDLTDNEV 242

Query: 231 SSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLK 290
            ++   + L   +    G+ L D+  +T QR +S +  L  +  ++   R++AS ++  K
Sbjct: 243 QAATQRDVLLKHIVEAFGVTLPDMQASTIQRRVS-DPDLPIELRELLAIRLQASTTSTSK 301

Query: 291 LNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSI 350
             TL++ ++ DGRLRGTLQF GASRTGRW+G +F PQNLPRP    E +D  I  L    
Sbjct: 302 YKTLLKGVSKDGRLRGTLQFCGASRTGRWAGRLFQPQNLPRPVLGQETIDTGIEALKAGC 361

Query: 351 TS--DPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFE----- 403
                 + +++IS  +R C++A EGKKLVV+DL+ IE R L W++GE+WKL+AF      
Sbjct: 362 ADLLFDNVMELISSALRGCIVAPEGKKLVVSDLSNIEGRALVWLSGEEWKLQAFRDYDAG 421

Query: 404 TGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFA 463
           TG DLY+  YAR+FN++P  V K QR IGKVMEL LG+ GG  AF   A   GL+L+  A
Sbjct: 422 TGHDLYMLAYARAFNISPDNVDKIQRQIGKVMELGLGFGGGVAAFLTFALVYGLDLDGLA 481

Query: 464 HLVKTNSAPEEWEDAENFCRWMQENHPEHAI-EDLFIGTACERVKKAWRQKHSRVSELWN 522
                N       +A+++ +   +    + + E +FI  AC+ +K+ WR  H +    W 
Sbjct: 482 KAALPNVPASIQREAQSWYKASVKQKRTYGLSEQVFI--ACDSLKRMWRNAHPKTVSFWY 539

Query: 523 ELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNNR---SY 579
           E+     + I   +     ++     + +++D + L + LPSGR++ Y  +  +    SY
Sbjct: 540 EIEDTVRRAIAAPRQTFTCRK-----LKIRRDGSWLRIQLPSGRAVCYPGIRIDEGKISY 594

Query: 580 L--NTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETP 637
           +  N+ +R+  R  TYGGKLTEN+ QA +RD++A  M     +GY+I LTVHDE++ E P
Sbjct: 595 MGINSYSRKWQRLKTYGGKLTENVTQAAARDVMANNMPLIETSGYEITLTVHDEVLTEAP 654

Query: 638 DTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           DT++F +  L  L+ +NP WA  LPL A G+E+  YRK
Sbjct: 655 DTEQFTSDKLSELLATNPEWALDLPLSAGGFEAYHYRK 692


>gi|332160957|ref|YP_004297534.1| putative DNA polymerase from bacteriophage origin [Yersinia
           enterocolitica subsp. palearctica 105.5R(r)]
 gi|325665187|gb|ADZ41831.1| Putative DNA polymerase from bacteriophage origin [Yersinia
           enterocolitica subsp. palearctica 105.5R(r)]
          Length = 669

 Score =  422 bits (1084), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 259/685 (37%), Positives = 373/685 (54%), Gaps = 57/685 (8%)

Query: 31  ILFAFGFDDHPVELWDCVHDPVMPQVLKEALENTDVTIVAHNSYFERTVLKACFNLDIP- 89
           ++  +  +D PV  WD      MP+ LK  L++  + I A NS+F+RT+++     D+P 
Sbjct: 1   MIITYALNDDPVSEWDITSGAKMPEDLKAYLQDPSIEIYAQNSHFDRTMMRH----DMPS 56

Query: 90  -----IHRWICTLVLARSNGLPSALKAVGEALKLSSQKME--EGKELIARFCKGETHECL 142
                I RW  T+V A ++GLP  L  + E L ++  K +  EGK LI  FCK       
Sbjct: 57  VIAGGIERWRDTMVKALAHGLPGGLGVLCEILGITQDKAKDKEGKALIQLFCKPRAKNST 116

Query: 143 YDR-NKPNHREAWRLFGEYCKGDVTVTREIFKRLEPL---SSKEQELWYLDQTINDRGYC 198
             R     H E W+ F +Y   D+   R I K+L P+     KE  LW+ DQ INDRG  
Sbjct: 117 IHRATSKTHPEEWKRFLKYAGNDIEAMRAIDKKL-PVWNYQGKELALWHFDQLINDRGVQ 175

Query: 199 VDVALAHTLNQIVDVERTKLDQELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTETT 258
           +D  LA      V  E+  L +  ++LT   V ++   + L   +    G+ L D+ ++T
Sbjct: 176 MDTVLAEAAVTAVVDEQKLLAKRTQNLTDNEVQAATQRDALLRHIVESFGVDLPDMQKST 235

Query: 259 CQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGR 318
            +R ++ + +L     ++   R++AS ++  K  TL++ ++ DGRLRGTLQF GASRTGR
Sbjct: 236 LERRIA-DPELPSVLRELLAIRLQASTTSTSKYKTLLKGVSKDGRLRGTLQFCGASRTGR 294

Query: 319 WSGCVFPPQNLPRPSRSHEELDQIITHLPTSITS--DPDPLQIISDCVRSCVIASEGKKL 376
           W+G +F PQNLPRP    E +D  I  L          + +++IS  +R C++A +GKKL
Sbjct: 295 WAGRLFQPQNLPRPVLDQETIDTGIEALKAGCADLLFDNVMELISSALRGCIVAPKGKKL 354

Query: 377 VVADLAGIEARVLAWMAGEQWKLKAF----------ETGE------DLYVTTYARSFNVA 420
           VV+DL+ IE RVLAW+AGE+WKL+AF          E GE      DLY   YAR+FN++
Sbjct: 355 VVSDLSNIEGRVLAWLAGEEWKLEAFRDYDTIIGYDEGGEALREGPDLYKLAYARAFNIS 414

Query: 421 PAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVKTNSAPEEWEDAEN 480
           P  VTK QR IGKVMEL LG+ GG  AF   A   GL+L+  A+    N       +A++
Sbjct: 415 PDDVTKLQRQIGKVMELGLGFGGGVAAFLTFALVYGLDLDELANAALPNVPTSIQREAQS 474

Query: 481 FCRWMQENHPEHAI----EDLFIGTACERVKKAWRQKHSRVSELWNELHQAFEQTIENGK 536
              W Q +  +       E +FI  AC+ +K+ WR  H      W+E+     + I N K
Sbjct: 475 ---WYQASVKQKRTFGLSEQVFI--ACDSLKRMWRNAHPETVSFWSEIENTVRRAIINPK 529

Query: 537 -AIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDV---GNNRSYL--NTTTRQLTRE 590
              + RK +      +++D + L + LPSGRS+ Y  +   G+  SY+  NT +R+  R 
Sbjct: 530 QTFVCRKLK------IRRDGSWLRIQLPSGRSVCYPGIRIEGDKISYMGVNTYSRKWQRL 583

Query: 591 YTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETPDTDEFNASMLYHL 650
            TYGGKL EN  QA +RD++A  M      GY+I LTVHDE++ E PDTD F +  L  L
Sbjct: 584 KTYGGKLAENATQAAARDVMANNMPLIEARGYEITLTVHDEVLTEAPDTDAFTSDKLSEL 643

Query: 651 MTSNPSWAKGLPLKAEGYESKRYRK 675
           + +NP WA  LPL A G+E+  YRK
Sbjct: 644 LATNPEWALDLPLSAGGFEAYHYRK 668


>gi|15837285|ref|NP_297973.1| phage-related DNA polymerase [Xylella fastidiosa 9a5c]
 gi|9105565|gb|AAF83493.1|AE003912_5 phage-related DNA polymerase [Xylella fastidiosa 9a5c]
          Length = 726

 Score =  420 bits (1080), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 276/727 (37%), Positives = 377/727 (51%), Gaps = 67/727 (9%)

Query: 4   LFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHDPVMPQVLKEALEN 63
           L+ D ET SP+ +   G+  YAE   ++LFA+   + PV++WDC     +P  L  AL +
Sbjct: 11  LWGDLETYSPVPMAH-GVHAYAEHAELLLFAYALGEGPVQVWDCTATATLPDDLSAALHD 69

Query: 64  TDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKLSSQ-- 121
             V +  HNS+F+RTVL+ C  +DIP+ RW  ++  A ++ LP AL  + E L++  +  
Sbjct: 70  PAVLLYFHNSHFDRTVLRHC-GIDIPLERWRDSMAQALAHSLPGALGTLCELLRVPVEHA 128

Query: 122 KMEEGKELIARFCKGETHECLYDR-NKPNHREAWRLFGEYCKGDVTVTREIFKRLEP--L 178
           K ++GK L+A FCK     C   R  +  H   W  F EY + DV   R++ KRL     
Sbjct: 129 KDKDGKRLVALFCKPRPAHCTLRRATRDTHPTDWAQFVEYAQRDVAAMRDVVKRLPSHNY 188

Query: 179 SSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSSSRCLEK 238
           +  E  LW+LDQTINDRG  +D  L     + V+  +  L Q  E+LT G V ++   + 
Sbjct: 189 AGAELALWFLDQTINDRGVLIDTDLVQAAIRAVERAKQTLAQRTEALTGGAVQAATQRDA 248

Query: 239 LKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLNTLVEAM 298
           L   L    G+ L D+ + T  R +  +  L     ++ + R +AS ++  K   L+   
Sbjct: 249 LLQHLNTAHGVALPDMQQHTVARCVD-DPALPETVRELLSIRRQASSTSTAKYQALLHCT 307

Query: 299 NSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTS---ITSDPD 355
           + DGRLRGTLQF GASRTGRW+G +F P NLPRP+ S E +   I  +      +  D D
Sbjct: 308 SPDGRLRGTLQFNGASRTGRWAGRLFQPHNLPRPTLSQEVIAVGIDAMKAGCVDLVFD-D 366

Query: 356 PLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFET----------- 404
            + + S  +RSC+IA + KKLVVADL+ IE RVLAW+AGE  KL AF             
Sbjct: 367 VMALTSSALRSCLIAPKNKKLVVADLSNIEGRVLAWLAGETPKLHAFREFDTCQGVDGTW 426

Query: 405 -----------------------------GEDLYVTTYARSFNVAPAQVTKDQRAIGKVM 435
                                        G+D+Y   YA SF +AP  V+K+QR IGKV 
Sbjct: 427 HTGAAITHGALRGAPIALQRNADHAPIRRGDDIYKRAYAHSFGIAPQAVSKEQRQIGKVQ 486

Query: 436 ELALGYQGGAKAFQKMASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENH-PEHAI 494
           ELALGY GG  AF   A+   ++L   A   +    P   + A     W + NH P   +
Sbjct: 487 ELALGYGGGVGAFAAFAAMYHIDLEAMA--AQAALPPLLLQQATELLEWTKANHRPTFDL 544

Query: 495 EDLFIGTACERVKKAWRQKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKD 554
            D     AC+  K+AWR  H  ++  W  L  A    I + +            + ++  
Sbjct: 545 SDR-AWLACDVFKRAWRNAHPAIAAFWQALQFAVTDAIHHPETA-----HTCCGITVQYR 598

Query: 555 KNNLILMLPSGRSLVYR----DVGNNRSYLNT--TTRQLTREYTYGGKLTENIVQAVSRD 608
           +  L L LPSGR L Y     D     SY+ T   TR+ TR  TYGGKL ENI QAVSRD
Sbjct: 599 RAWLRLRLPSGRVLYYAAPRVDEHGALSYMGTHPITRKWTRLTTYGGKLVENITQAVSRD 658

Query: 609 ILAEGMMNATKAGYDIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGY 668
           +LA  M     AGY IVLTVHDEI+ E  D   FNA+ L  LM + P WA+GLPL AEG+
Sbjct: 659 VLAACMPAIEAAGYSIVLTVHDEIITEADDHPCFNAAHLAALMATPPPWAEGLPLAAEGF 718

Query: 669 ESKRYRK 675
           ++ RYRK
Sbjct: 719 DTYRYRK 725


>gi|71898927|ref|ZP_00681094.1| DNA-directed DNA polymerase [Xylella fastidiosa Ann-1]
 gi|71731339|gb|EAO33403.1| DNA-directed DNA polymerase [Xylella fastidiosa Ann-1]
          Length = 726

 Score =  420 bits (1079), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 285/728 (39%), Positives = 381/728 (52%), Gaps = 69/728 (9%)

Query: 4   LFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHDPVMPQVLKEALEN 63
           L+ D ET SP+ +   G+  YAE   ++LFA+   D PV++WDC     MP+ L  AL N
Sbjct: 11  LWGDLETYSPVPIAH-GVHAYAEQAQLLLFAYALGDGPVQVWDCTATATMPEELSAALHN 69

Query: 64  TDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKLSSQ-- 121
             V +  HNS+F+RTVL+ C  ++IP+ RW  ++  A ++ LP AL  + E L++  +  
Sbjct: 70  PAVLLYFHNSHFDRTVLRHC-GINIPLERWRDSMAQALAHALPGALGTLCELLRVPVEQA 128

Query: 122 KMEEGKELIARFCKGETHECLYDR-NKPNHREAWRLFGEYCKGDVTVTREIFKRLEP--L 178
           K ++GK L+A FCK     C   R  +  H   W  F +Y + DV   R++ KRL     
Sbjct: 129 KAKDGKRLVALFCKPRPTHCTLRRATRDTHPTEWAQFVDYARRDVAAMRDVVKRLPSHNY 188

Query: 179 SSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSSSRCLEK 238
           +  E  LW+LDQTINDRG  VD  LA      V+  +  L +    LT G+V ++   + 
Sbjct: 189 TGAELALWFLDQTINDRGVLVDTDLAQAAIGAVERAKQALAERTSDLTAGVVQAATQRDA 248

Query: 239 LKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAI-QVFNNRMRASRSAVLKLNTLVEA 297
           L   L  E G+ L D+ + T +R L  +  L P+ + ++ + R +AS ++  K   L+  
Sbjct: 249 LLHHLSTEHGVALPDMQQHTVERCL--DDPLLPETVRELLSIRRQASTTSTAKYQALLNC 306

Query: 298 MNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTS---ITSDP 354
            + DGRLRGTLQF GASRTGRW+G +F P NLPRP+ S E +   I  +      +  D 
Sbjct: 307 TSGDGRLRGTLQFNGASRTGRWAGRLFQPHNLPRPTLSQEAITVGIDAMKAGCVDLVFD- 365

Query: 355 DPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAF------------ 402
           D + + S  +RSC+IA   KKLVVADL+ IE RVLAW+AGE  KL AF            
Sbjct: 366 DVMALTSSALRSCLIAPTHKKLVVADLSNIEGRVLAWLAGETPKLHAFGDFDTCQGVDGT 425

Query: 403 ----------------------------ETGEDLYVTTYARSFNVAPAQVTKDQRAIGKV 434
                                         G+D+Y   YA SF +AP  VTK QR IGKV
Sbjct: 426 WHSGEAITHGALRGAPITLQWNAEHAPIRKGDDIYKRAYAHSFGIAPQAVTKQQRQIGKV 485

Query: 435 MELALGYQGGAKAFQKMASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENH-PEHA 493
            ELALGY GG  AF   A+   ++L   A   +    P   ++A     W + NH P   
Sbjct: 486 QELALGYGGGVGAFAAFAAMYHIDLEAMA--AQAALPPLLLQEATELLEWTKANHRPTFG 543

Query: 494 IEDLFIGTACERVKKAWRQKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKK 553
           + D     AC+  K+AWR  H  ++  W  L  A    I  G    A     + + Y   
Sbjct: 544 LSDR-AWLACDVFKRAWRNAHPAIAAFWQALQCAVTDAI--GHPETAHTCCGITVQY--- 597

Query: 554 DKNNLILMLPSGRSLVYR----DVGNNRSYLNT--TTRQLTREYTYGGKLTENIVQAVSR 607
            +  L L LPSGR L Y     D     SY+ T   TR+ TR  TYGGKL ENI QAVSR
Sbjct: 598 SRAWLRLRLPSGRVLYYAAPRVDEHGALSYMGTHPITRKWTRITTYGGKLVENITQAVSR 657

Query: 608 DILAEGMMNATKAGYDIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEG 667
           D+LA  M     AGY IVLTVHDEI+ E  D   FNA+ L  LM + P WA+GLPL AEG
Sbjct: 658 DVLAACMPAIEAAGYAIVLTVHDEIITEADDNAAFNAAHLAALMATPPPWAQGLPLAAEG 717

Query: 668 YESKRYRK 675
           +E+ RYRK
Sbjct: 718 FETHRYRK 725


>gi|28199026|ref|NP_779340.1| phage-related DNA polymerase [Xylella fastidiosa Temecula1]
 gi|28199602|ref|NP_779916.1| phage-related DNA polymerase [Xylella fastidiosa Temecula1]
 gi|182681748|ref|YP_001829908.1| DNA-directed DNA polymerase [Xylella fastidiosa M23]
 gi|182682343|ref|YP_001830503.1| DNA-directed DNA polymerase [Xylella fastidiosa M23]
 gi|28057124|gb|AAO28989.1| phage-related DNA polymerase [Xylella fastidiosa Temecula1]
 gi|28057717|gb|AAO29565.1| phage-related DNA polymerase [Xylella fastidiosa Temecula1]
 gi|182631858|gb|ACB92634.1| DNA-directed DNA polymerase [Xylella fastidiosa M23]
 gi|182632453|gb|ACB93229.1| DNA-directed DNA polymerase [Xylella fastidiosa M23]
 gi|307578624|gb|ADN62593.1| DNA-directed DNA polymerase [Xylella fastidiosa subsp. fastidiosa
           GB514]
 gi|307580177|gb|ADN64146.1| DNA-directed DNA polymerase [Xylella fastidiosa subsp. fastidiosa
           GB514]
          Length = 726

 Score =  419 bits (1078), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 285/728 (39%), Positives = 380/728 (52%), Gaps = 69/728 (9%)

Query: 4   LFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHDPVMPQVLKEALEN 63
           L+ D ET SP+ +   G+  YAE   ++LFA+   + PV++WDC     MP+ L  AL N
Sbjct: 11  LWGDLETYSPVPIAH-GVHAYAEQAQLLLFAYALGEGPVQVWDCTATATMPEELSAALHN 69

Query: 64  TDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKLSSQ-- 121
             V +  HNS+F+RTVL+ C  + IP+ RW  ++  A ++ LP AL  + E L++  +  
Sbjct: 70  PAVLLYFHNSHFDRTVLRHC-GISIPLERWRDSMAQALAHALPGALGTLCELLRVPVEQA 128

Query: 122 KMEEGKELIARFCKGETHECLYDR-NKPNHREAWRLFGEYCKGDVTVTREIFKRLEP--L 178
           K ++GK L+A FCK     C   R  +  H   W  F EY + DVT  R++ KRL     
Sbjct: 129 KAKDGKRLVALFCKPRPTHCTLRRATRDTHPTEWAQFVEYARRDVTAMRDVVKRLPSHNY 188

Query: 179 SSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSSSRCLEK 238
           +  E  LW+LDQTINDRG  VD  LA      V+  +  L +    LT G+V ++   + 
Sbjct: 189 TGAELALWFLDQTINDRGVLVDTDLAQAAIGAVERAKQALAERTSDLTAGVVQAATQRDA 248

Query: 239 LKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAI-QVFNNRMRASRSAVLKLNTLVEA 297
           L   L    G+ L D+ + T +R L  +  L P+ + ++ + R +AS ++  K   L+  
Sbjct: 249 LLHHLSTAHGVALPDMQQHTVERCL--DDPLLPETVRELLSIRRQASTTSTAKYQALLNC 306

Query: 298 MNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTS---ITSDP 354
            + DGRLRGTLQF GASRTGRW+G +F P NLPRP+ S E +   I  +      +  D 
Sbjct: 307 TSRDGRLRGTLQFNGASRTGRWAGRLFQPHNLPRPTLSQEAITVGIDAMKAGCVDLVFD- 365

Query: 355 DPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAF------------ 402
           D + + S  +RSC+IA   KKLVVADL+ IE RVLAW+AGE  KL AF            
Sbjct: 366 DVMALTSSALRSCLIAPTHKKLVVADLSNIEGRVLAWLAGETPKLHAFGEFDTCQGVDGT 425

Query: 403 ----------------------------ETGEDLYVTTYARSFNVAPAQVTKDQRAIGKV 434
                                         G+D+Y   YA SF +AP  VTK QR IGKV
Sbjct: 426 WHSGEAITHGALRGAPIALQWNAEHAPIRKGDDIYKRAYAHSFGIAPQAVTKQQRQIGKV 485

Query: 435 MELALGYQGGAKAFQKMASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENH-PEHA 493
            ELALGY GG  AF   A+   ++L   A   +    P   ++A     W + NH P   
Sbjct: 486 QELALGYGGGVGAFAAFAAMYHIDLEAMA--AQAALPPLLLQEATELLEWTKANHRPTFG 543

Query: 494 IEDLFIGTACERVKKAWRQKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKK 553
           + D     AC+  K+AWR  H  ++  W  L  A    I  G    A     + + Y   
Sbjct: 544 LSDR-AWLACDVFKRAWRNAHPAIAAFWQALQCAVTDAI--GHPETAHTCCGITVQY--- 597

Query: 554 DKNNLILMLPSGRSLVYR----DVGNNRSYLNT--TTRQLTREYTYGGKLTENIVQAVSR 607
            +  L L LPSGR L Y     D     SY+ T   TR+ TR  TYGGKL ENI QAVSR
Sbjct: 598 SRAWLRLRLPSGRVLYYAAPRVDEHGALSYMGTHPVTRKWTRITTYGGKLVENITQAVSR 657

Query: 608 DILAEGMMNATKAGYDIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEG 667
           D+LA  M     AGY IVLTVHDEI+ E  D   FNA+ L  LM + P WA+GLPL AEG
Sbjct: 658 DVLAACMPAIEAAGYSIVLTVHDEIITEADDNAAFNAAHLAALMATPPPWAQGLPLAAEG 717

Query: 668 YESKRYRK 675
           +E+ RYRK
Sbjct: 718 FETHRYRK 725


>gi|273810426|ref|YP_003344897.1| DNA polymerase A [Xylella phage Xfas53]
 gi|257097801|gb|ACV41107.1| DNA polymerase A [Xylella phage Xfas53]
          Length = 726

 Score =  418 bits (1075), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 285/728 (39%), Positives = 379/728 (52%), Gaps = 69/728 (9%)

Query: 4   LFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHDPVMPQVLKEALEN 63
           L+ D ET SP+ +   G+  YAE   ++LFA+     PV++WDC     MP+ L  AL N
Sbjct: 11  LWGDLETYSPVPIAH-GVHAYAEQAQLLLFAYALGGGPVQVWDCTATATMPEELSAALHN 69

Query: 64  TDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKLSSQ-- 121
             V +  HNS+F+RTVL+ C  + IP+ RW  ++  A ++ LP AL  + E L++  +  
Sbjct: 70  PAVLLYFHNSHFDRTVLRHC-GISIPLERWRDSMAQALAHALPGALGTLCELLRVPVEQA 128

Query: 122 KMEEGKELIARFCKGETHECLYDR-NKPNHREAWRLFGEYCKGDVTVTREIFKRLEP--L 178
           K ++GK L+A FCK     C   R  +  H   W  F EY + DVT  R++ KRL     
Sbjct: 129 KAKDGKRLVALFCKPRPTHCTLRRATRDTHPTEWAQFVEYARRDVTAMRDVVKRLPSHNY 188

Query: 179 SSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSSSRCLEK 238
           +  E  LW+LDQTINDRG  VD  LA      V+  +  L +    LT G+V ++   + 
Sbjct: 189 TGAELALWFLDQTINDRGVLVDTDLAQAAIGAVERAKQALAERTSDLTAGVVQAATQRDA 248

Query: 239 LKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAI-QVFNNRMRASRSAVLKLNTLVEA 297
           L   L    G+ L D+ + T +R L  +  L P+ + ++ + R +AS ++  K   L+  
Sbjct: 249 LLHHLSTAHGVALPDMQQHTVERCL--DDPLLPETVRELLSIRRQASTTSTAKYQALLNC 306

Query: 298 MNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTS---ITSDP 354
            + DGRLRGTLQF GASRTGRW+G +F P NLPRP+ S E +   I  +      +  D 
Sbjct: 307 TSRDGRLRGTLQFNGASRTGRWAGRLFQPHNLPRPTLSQEAITVGIDAMKAGCVDLVFD- 365

Query: 355 DPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAF------------ 402
           D + + S  +RSC+IA   KKLVVADL+ IE RVLAW+AGE  KL AF            
Sbjct: 366 DVMALTSSALRSCLIAPTHKKLVVADLSNIEGRVLAWLAGETPKLHAFGEFDTCQGVDGT 425

Query: 403 ----------------------------ETGEDLYVTTYARSFNVAPAQVTKDQRAIGKV 434
                                         G+D+Y   YA SF +AP  VTK QR IGKV
Sbjct: 426 WHSGEAITHGALRGAPIALQWNAEHAPIRKGDDIYKRAYAHSFGIAPQAVTKQQRQIGKV 485

Query: 435 MELALGYQGGAKAFQKMASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENH-PEHA 493
            ELALGY GG  AF   A+   ++L   A   +    P   ++A     W + NH P   
Sbjct: 486 QELALGYGGGVGAFAAFAAMYHIDLEAMA--AQAALPPLLLQEATELLEWTKANHRPTFG 543

Query: 494 IEDLFIGTACERVKKAWRQKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKK 553
           + D     AC+  K+AWR  H  ++  W  L  A    I  G    A     + + Y   
Sbjct: 544 LSDR-AWLACDVFKRAWRNAHPAIAAFWQALQCAVTDAI--GHPETAHTCCGITVQY--- 597

Query: 554 DKNNLILMLPSGRSLVYR----DVGNNRSYLNT--TTRQLTREYTYGGKLTENIVQAVSR 607
            +  L L LPSGR L Y     D     SY+ T   TR+ TR  TYGGKL ENI QAVSR
Sbjct: 598 SRAWLRLRLPSGRVLYYAAPRVDEHGALSYMGTHPVTRKWTRITTYGGKLVENITQAVSR 657

Query: 608 DILAEGMMNATKAGYDIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEG 667
           D+LA  M     AGY IVLTVHDEI+ E  D   FNA+ L  LM + P WA+GLPL AEG
Sbjct: 658 DVLAACMPAIEAAGYSIVLTVHDEIITEADDNAAFNAAHLAALMATPPPWAQGLPLAAEG 717

Query: 668 YESKRYRK 675
           +E+ RYRK
Sbjct: 718 FETHRYRK 725


>gi|15839115|ref|NP_299803.1| phage-related DNA polymerase [Xylella fastidiosa 9a5c]
 gi|9107731|gb|AAF85323.1|AE004059_13 phage-related DNA polymerase [Xylella fastidiosa 9a5c]
          Length = 726

 Score =  418 bits (1075), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 276/727 (37%), Positives = 377/727 (51%), Gaps = 67/727 (9%)

Query: 4   LFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHDPVMPQVLKEALEN 63
           L+ D ET SP+ +   G+  YAE   ++LFA+   + PV++WDC     +P  L  AL +
Sbjct: 11  LWGDLETYSPVPIAH-GVHAYAEHAELLLFAYALGEGPVQVWDCTATATLPDDLSAALHD 69

Query: 64  TDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKLSSQ-- 121
             V +  HNS+F+RTVL+ C  +DIP+ RW  ++  A ++ LP AL  + E L++  +  
Sbjct: 70  PGVLLYFHNSHFDRTVLRHC-GIDIPLERWRDSMAQALAHSLPGALGTLCELLRVPVEHA 128

Query: 122 KMEEGKELIARFCKGETHECLYDR-NKPNHREAWRLFGEYCKGDVTVTREIFKRLEP--L 178
           K ++GK L+A FCK     C   R  +  H   W  F EY + DV   R++ KRL     
Sbjct: 129 KDKDGKRLVALFCKPRPAHCTLRRATRDTHPTDWAQFVEYAQRDVAAMRDVVKRLPSHNY 188

Query: 179 SSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSSSRCLEK 238
           +  E  LW+LDQTINDRG  +D  L     + V+  +  L Q  E+LT G V ++   + 
Sbjct: 189 AGAELALWFLDQTINDRGVLIDTDLVQAAIRAVERAKQTLAQRTEALTGGAVQAATQRDA 248

Query: 239 LKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLNTLVEAM 298
           L   L    G+ L D+ + T  R +  +  L     ++ + R +AS ++  K   L+   
Sbjct: 249 LLQHLNTAHGVALPDMQQHTVARCVD-DPALPETVRELLSIRRQASSTSTAKYQALLHCT 307

Query: 299 NSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLP---TSITSDPD 355
           + DGRLRGTLQF GASRTGRW+G +F P NLPRP+ S E +   I  +      +  D D
Sbjct: 308 SPDGRLRGTLQFNGASRTGRWAGRLFQPHNLPRPTLSQEVIAVGIDAMKADCVDLVFD-D 366

Query: 356 PLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFET----------- 404
            + + S  +RSC+IA   KKLVVADL+ IE RVLAW+AGE  KL AF             
Sbjct: 367 VMALTSSALRSCLIAPTHKKLVVADLSNIEGRVLAWLAGETPKLHAFREFDTCQGVDGCW 426

Query: 405 -----------------------------GEDLYVTTYARSFNVAPAQVTKDQRAIGKVM 435
                                        G+D+Y   YA SF +AP  V+K+QR IGKV 
Sbjct: 427 HTGAAITHGALRAAPLALQRNADHAPIRRGDDIYKRAYAHSFGIAPQAVSKEQRQIGKVQ 486

Query: 436 ELALGYQGGAKAFQKMASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENH-PEHAI 494
           ELALGY GG  AF   A+   ++L   A   +    P   ++A     W + NH P   +
Sbjct: 487 ELALGYGGGVGAFAAFAALYHIDLEAMA--AQAVFPPLLLQEATELLEWTKANHRPTFDL 544

Query: 495 EDLFIGTACERVKKAWRQKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKD 554
            D     AC+  K+AWR  H  ++  W  L  A    I + +            + ++  
Sbjct: 545 SDR-AWLACDVFKRAWRNAHPAIAAFWQALQFAVTDAIHHPETT-----HTCCGITVQYR 598

Query: 555 KNNLILMLPSGRSLVYR----DVGNNRSYLNT--TTRQLTREYTYGGKLTENIVQAVSRD 608
           +  L L LPSGR L Y     D     SY+ T   TR+ TR  TYGGKL ENI QAVSRD
Sbjct: 599 RAWLRLRLPSGRVLYYAAPRVDEHGALSYMGTHPITRKWTRLTTYGGKLVENITQAVSRD 658

Query: 609 ILAEGMMNATKAGYDIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGY 668
           +LA  M     AGY IVLTVHDEI+ E  D   FNA+ L  LM + P WA+GLPL AEG+
Sbjct: 659 VLAACMPAIEAAGYSIVLTVHDEIITEADDHPCFNAAHLAALMATPPPWAEGLPLAAEGF 718

Query: 669 ESKRYRK 675
           ++ RYRK
Sbjct: 719 DTYRYRK 725


>gi|71901326|ref|ZP_00683422.1| DNA-directed DNA polymerase [Xylella fastidiosa Ann-1]
 gi|71728910|gb|EAO31045.1| DNA-directed DNA polymerase [Xylella fastidiosa Ann-1]
          Length = 726

 Score =  414 bits (1065), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 284/728 (39%), Positives = 380/728 (52%), Gaps = 69/728 (9%)

Query: 4   LFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHDPVMPQVLKEALEN 63
           L+ D ET SP+ +   G+  YAE    +LFA+   D PV++WDC     MP+ L  AL N
Sbjct: 11  LWGDLETYSPVPIAH-GVHAYAEQAQRLLFAYALGDGPVQVWDCTATATMPEELSAALHN 69

Query: 64  TDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKLSSQ-- 121
             V +  HNS+F+RTVL+ C  ++IP+ RW  ++  A ++ LP AL  + E L++  +  
Sbjct: 70  PAVLLYFHNSHFDRTVLRHC-GINIPLERWRDSMAQALAHSLPGALGTLCELLRVPVEQA 128

Query: 122 KMEEGKELIARFCKGETHECLYDR-NKPNHREAWRLFGEYCKGDVTVTREIFKRLEP--L 178
           K ++GK L+A FCK     C   R  +  H   W  F +Y + DV   R++ KRL     
Sbjct: 129 KAKDGKRLVALFCKPRPTHCTLRRATRDTHPTEWAQFVDYARRDVAAMRDVVKRLPSHNY 188

Query: 179 SSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSSSRCLEK 238
           +  E  LW+LDQTINDRG  VD  LA      V+  +  L +    LT G+V ++   + 
Sbjct: 189 TGAELALWFLDQTINDRGVLVDTDLAQAAIGAVERAKQALAERTSDLTAGVVQAATQRDA 248

Query: 239 LKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAI-QVFNNRMRASRSAVLKLNTLVEA 297
           L   L    G+ L D+ + T +R L  +  L P+ + ++ + R +AS ++  K   L+  
Sbjct: 249 LLHHLSTAHGVALPDMQQHTVERCL--DDPLLPETVRELLSIRRQASTTSTAKYQALLNC 306

Query: 298 MNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTS---ITSDP 354
            + DGRLRGTLQF GASRTGRW+G +F P NLPRP+ S   +   I  +      +  D 
Sbjct: 307 TSGDGRLRGTLQFNGASRTGRWAGRLFQPHNLPRPTLSQPVIAVGIDAMKAGCVDLVFD- 365

Query: 355 DPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAF------------ 402
           D + + S  +RSC+IA   KKLVVADL+ IE RVLAW+AGE  KL+AF            
Sbjct: 366 DVMALTSSALRSCLIAPTHKKLVVADLSNIEGRVLAWLAGETPKLQAFGDFDTCQGVDGT 425

Query: 403 ----------------------------ETGEDLYVTTYARSFNVAPAQVTKDQRAIGKV 434
                                         GED+Y   YA SF +AP  VTK QR IGKV
Sbjct: 426 WHSGEAITHGALRGAPITLQWNAEHEPIRKGEDIYKRAYAHSFGIAPQAVTKQQRQIGKV 485

Query: 435 MELALGYQGGAKAFQKMASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENH-PEHA 493
            ELALGY GG  AF   A+   ++L   A   +    P   ++A    +W + NH P   
Sbjct: 486 QELALGYGGGVGAFAAFAAMYHIDLEAMAE--QAALPPLLLQEAVEALQWTKANHRPTFG 543

Query: 494 IEDLFIGTACERVKKAWRQKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKK 553
           + D     AC+  K+AWR  H  ++  W  L  A    I  G    A     + + Y   
Sbjct: 544 LSDR-AWLACDVFKRAWRNAHPAIAAFWQALQCAVTDAI--GHPETAHTCCGITVQY--- 597

Query: 554 DKNNLILMLPSGRSLVYR----DVGNNRSYLNT--TTRQLTREYTYGGKLTENIVQAVSR 607
            +  L L LPSGR L Y     D     SY+ T   TR+ TR  TYGGKL ENI QAVSR
Sbjct: 598 SRAWLRLRLPSGRVLYYAAPRVDEHGALSYMGTHPITRKWTRITTYGGKLVENITQAVSR 657

Query: 608 DILAEGMMNATKAGYDIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEG 667
           D+LA  M     AGY IVLTVHDEI+ E  D   FNA+ L  LM + P WA+GLPL AEG
Sbjct: 658 DVLAACMPAIEAAGYSIVLTVHDEIITEADDNAAFNAAHLAALMATPPPWAQGLPLAAEG 717

Query: 668 YESKRYRK 675
           +E+ RYRK
Sbjct: 718 FETHRYRK 725


>gi|71276267|ref|ZP_00652545.1| DNA-directed DNA polymerase [Xylella fastidiosa Dixon]
 gi|71900322|ref|ZP_00682457.1| DNA-directed DNA polymerase [Xylella fastidiosa Ann-1]
 gi|71162875|gb|EAO12599.1| DNA-directed DNA polymerase [Xylella fastidiosa Dixon]
 gi|71729897|gb|EAO31993.1| DNA-directed DNA polymerase [Xylella fastidiosa Ann-1]
          Length = 726

 Score =  414 bits (1064), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 280/728 (38%), Positives = 381/728 (52%), Gaps = 69/728 (9%)

Query: 4   LFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHDPVMPQVLKEALEN 63
           L+ D ET SP+ +   G+  YAE   ++LFA+   + PV++WDC     MP+ L  AL N
Sbjct: 11  LWGDLETYSPVPIAH-GVHAYAEQAELLLFAYAIGNGPVQVWDCTATATMPEELSAALHN 69

Query: 64  TDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKLSSQ-- 121
             V +  HNS+F+RTVL+ C  +DIP+ RW  ++  A ++ LP AL  + E L++  +  
Sbjct: 70  PAVLLYFHNSHFDRTVLRHC-GIDIPLERWRDSMAQALAHSLPGALGTLCELLRVPVEQA 128

Query: 122 KMEEGKELIARFCKGETHECLYDR-NKPNHREAWRLFGEYCKGDVTVTREIFKRLEP--L 178
           K ++GK L+A FCK     C   R  +  H   W  F EY + DV   R++ KRL     
Sbjct: 129 KAKDGKRLVALFCKPRPAHCTLRRATRDTHPTEWAQFVEYARRDVAAMRDVVKRLPSHNY 188

Query: 179 SSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSSSRCLEK 238
           +  E  LW+LDQTINDRG  VD  LA      V+  +  L +    LT G+V ++   + 
Sbjct: 189 TGAELALWFLDQTINDRGVMVDTDLAQAAIGAVERAKQALAERTSDLTAGVVQAATQRDA 248

Query: 239 LKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAI-QVFNNRMRASRSAVLKLNTLVEA 297
           L   L  E G+ L D+ + T +R L  +  L P+ + ++ + R +AS ++  K   L+  
Sbjct: 249 LLHHLSTEHGVALPDMQQHTVERCL--DDPLLPETVRELLSIRRQASTTSTAKYQALLNC 306

Query: 298 MNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTS---ITSDP 354
            + DGRLRGTLQF GASRTGRW+G +F P NLPRP+ S   +   I  +      +  D 
Sbjct: 307 TSGDGRLRGTLQFNGASRTGRWAGRLFQPHNLPRPTLSQPVIAVGIDAMKAGCVDLVFD- 365

Query: 355 DPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAF------------ 402
           D + + S  +RSC+IA   KKLVVADL+ IE RVLAW+AGE  KL AF            
Sbjct: 366 DVMALTSSALRSCLIAPTHKKLVVADLSNIEGRVLAWLAGETPKLHAFRDFDTCQGVDGT 425

Query: 403 ----------------------------ETGEDLYVTTYARSFNVAPAQVTKDQRAIGKV 434
                                         G+D+Y   YA SF +AP  VTK+QR IGKV
Sbjct: 426 WHSGEAITHGALRGAPITLQRNAEHEPIRQGDDIYKRAYAHSFGIAPQAVTKEQRQIGKV 485

Query: 435 MELALGYQGGAKAFQKMASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENH-PEHA 493
            ELALGY GG  AF   A+   ++L   A   +    P   ++A    +W + N  P   
Sbjct: 486 QELALGYGGGVGAFAAFAAMYHIDLEAMAE--QAALPPLLLQEAVEALQWTKANQRPTFG 543

Query: 494 IEDLFIGTACERVKKAWRQKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKK 553
           + D     AC+  K+AWR  H  ++  W  L  A    I + +            + M+ 
Sbjct: 544 LSDR-AWLACDVFKRAWRNAHPAIAAFWKALQFAATDAIRHPETA-----HTCCGITMQY 597

Query: 554 DKNNLILMLPSGRSLVYR----DVGNNRSYLNT--TTRQLTREYTYGGKLTENIVQAVSR 607
            +  L + LPSGR L Y     D     SY+ T   TR+ TR  TYGGKL ENI QAVSR
Sbjct: 598 SRAWLRMHLPSGRVLYYAAPRVDEHGALSYMGTHPMTRKWTRITTYGGKLVENITQAVSR 657

Query: 608 DILAEGMMNATKAGYDIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEG 667
           D+LA  M     AGY IVLTVHDEI+ E  D   FNA+ L  LM + P WA+GLPL AEG
Sbjct: 658 DVLAACMPAIEAAGYQIVLTVHDEIITEADDNAAFNAAHLAALMATPPPWAQGLPLAAEG 717

Query: 668 YESKRYRK 675
           +++ RYRK
Sbjct: 718 FQTHRYRK 725


>gi|170730324|ref|YP_001775757.1| phage-related DNA polymerase [Xylella fastidiosa M12]
 gi|167965117|gb|ACA12127.1| phage-related DNA polymerase [Xylella fastidiosa M12]
          Length = 726

 Score =  413 bits (1062), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 284/728 (39%), Positives = 381/728 (52%), Gaps = 69/728 (9%)

Query: 4   LFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHDPVMPQVLKEALEN 63
           L+ D ET SP+ +   G+  YAE   ++LFA+   + PV++WDC     MP+ L  AL N
Sbjct: 11  LWGDLETYSPVPIAH-GVHAYAEQAELLLFAYAIGNGPVQVWDCTATATMPEELSAALHN 69

Query: 64  TDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKLSSQ-- 121
             V +  HNS+F+RTVL+ C  +DIP+ RW  ++  A ++ LP AL  + E L++  +  
Sbjct: 70  PAVLLYFHNSHFDRTVLRHC-GIDIPLERWRDSMAQALAHSLPGALGTLCELLRVPVEQA 128

Query: 122 KMEEGKELIARFCKGETHECLYDR-NKPNHREAWRLFGEYCKGDVTVTREIFKRLEP--L 178
           K ++GK L+A FCK     C   R  +  H   W  F EY + DV   R++ KRL     
Sbjct: 129 KAKDGKRLVALFCKPRPTHCTLRRATRDTHPTDWAQFVEYARRDVAAMRDVVKRLPSHNY 188

Query: 179 SSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSSSRCLEK 238
           S  E  LW+LDQTINDRG  VD  LA      V+  +  L    E+LT G V ++   + 
Sbjct: 189 SGAELALWFLDQTINDRGVLVDTDLAQAAIGAVERAKCTLAHRTEALTGGAVQAATQRDA 248

Query: 239 LKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAI-QVFNNRMRASRSAVLKLNTLVEA 297
           L   L  E G+ L D+ + T +R L  +  L P+ + ++ + R +AS ++  K   L+  
Sbjct: 249 LLHHLSTEHGVALPDMQQHTVERCL--DDPLLPETVRELLSIRRQASTTSTAKYQALLNC 306

Query: 298 MNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTS---ITSDP 354
            + DGRLRGTLQF GASRTGRW+G +F P NLPRP+ S   +   I  +      +  D 
Sbjct: 307 TSRDGRLRGTLQFNGASRTGRWAGRLFQPHNLPRPTLSQPVIAVGIDAMKAGCVDVVFD- 365

Query: 355 DPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAF------------ 402
           D + + S  +RSC+IA   KKLVVADL+ IE RVLAW+AGE  KL AF            
Sbjct: 366 DVMALTSSALRSCLIAPTHKKLVVADLSNIEGRVLAWLAGETPKLHAFGDFDTCQGVDGT 425

Query: 403 ----------------------------ETGEDLYVTTYARSFNVAPAQVTKDQRAIGKV 434
                                         G+D+Y   YA SF +AP  VTK+QR IGKV
Sbjct: 426 WHSGEAITHGALRGAPITLQRNAEHEPIRQGDDIYKRAYAHSFGIAPQAVTKEQRQIGKV 485

Query: 435 MELALGYQGGAKAFQKMASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENH-PEHA 493
            ELALGY GG  AF   A+   ++L   A   +    P   ++A    +W + N  P   
Sbjct: 486 QELALGYGGGVGAFAAFAAMYHIDLEAMAE--QAALPPLLLQEAVEALQWTKANQRPTFG 543

Query: 494 IEDLFIGTACERVKKAWRQKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKK 553
           + D     AC+  K+AWR  H  ++  W  L   F  T   G    A     + + Y   
Sbjct: 544 LSDR-AWLACDVFKRAWRNAHPAIAAFWQALQ--FAATDAIGHPETAHTCCGITVQY--- 597

Query: 554 DKNNLILMLPSGRSLVYR----DVGNNRSYLNT--TTRQLTREYTYGGKLTENIVQAVSR 607
            +  L L LPSGR L Y     D     SY+ T   TR+ TR  TYGGKL ENI QAVSR
Sbjct: 598 SRAWLRLRLPSGRVLYYAAPRVDEHGALSYMGTHPITRKWTRITTYGGKLVENITQAVSR 657

Query: 608 DILAEGMMNATKAGYDIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEG 667
           D+LA  M     AGY IVLTVHDE++ E  D   FNA+ L  LM + P WA+GLPL AEG
Sbjct: 658 DVLAACMPAIEAAGYAIVLTVHDEMITEADDNAAFNAAHLAALMATPPPWAQGLPLAAEG 717

Query: 668 YESKRYRK 675
           +++ RYRK
Sbjct: 718 FQTHRYRK 725


>gi|71899884|ref|ZP_00682032.1| DNA-directed DNA polymerase [Xylella fastidiosa Ann-1]
 gi|71730324|gb|EAO32407.1| DNA-directed DNA polymerase [Xylella fastidiosa Ann-1]
          Length = 726

 Score =  411 bits (1056), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 282/728 (38%), Positives = 379/728 (52%), Gaps = 69/728 (9%)

Query: 4   LFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHDPVMPQVLKEALEN 63
           L+ D ET SP+ +   G+  YAE   ++LFA+   D PV++WDC     MP+ L  AL N
Sbjct: 11  LWGDLETYSPVPIAH-GVHAYAEQAQLLLFAYALGDGPVQVWDCTATATMPEELSAALHN 69

Query: 64  TDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKLSSQ-- 121
             V +  HNS+F+RTVL+ C  ++IP+ RW  ++  A ++ LP AL  + E L++  +  
Sbjct: 70  PAVLLYFHNSHFDRTVLRHC-GINIPLERWRDSMAQALAHSLPGALGTLCELLRVPVEQA 128

Query: 122 KMEEGKELIARFCKGETHECLYDR-NKPNHREAWRLFGEYCKGDVTVTREIFKRLEP--L 178
           K ++GK L+A FCK     C   R  +  H   W  F +Y + DVT  R++ KRL     
Sbjct: 129 KAKDGKRLVALFCKPRPTHCTLRRATRDTHPTEWAQFVDYARRDVTAMRDVVKRLPSHNY 188

Query: 179 SSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSSSRCLEK 238
           +  E  LW+LDQTINDRG  VD  LA      V+  +  L +    LT G+V ++   + 
Sbjct: 189 TGAELALWFLDQTINDRGVLVDTDLAQAAIGAVERAKQALAERTSDLTAGVVQAATQRDA 248

Query: 239 LKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAI-QVFNNRMRASRSAVLKLNTLVEA 297
           L   L  E G+ L D+ + T +R L  +  L P+ + ++ + R +AS ++  K   L+  
Sbjct: 249 LLHHLSTEHGVALPDMQQHTVERCL--DDPLLPETVRELLSIRRQASTTSTAKYQALLNC 306

Query: 298 MNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTS---ITSDP 354
            + DGRLRGTLQF GASRTGRW+G +  P NLPRP+ S   +   I  +      +  D 
Sbjct: 307 TSGDGRLRGTLQFNGASRTGRWAGRLLQPHNLPRPTLSQPVIAVGIDAMKAGCVDLVFD- 365

Query: 355 DPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAF------------ 402
           D + + S  +RSC+IA   KKLVVADL+ IE RVLAW+AGE  KL AF            
Sbjct: 366 DVMALTSSALRSCLIAPTHKKLVVADLSNIEGRVLAWLAGETPKLHAFGDFDTCQGVDGT 425

Query: 403 ----------------------------ETGEDLYVTTYARSFNVAPAQVTKDQRAIGKV 434
                                         G+D+Y   YA SF +AP  VTK QR IGKV
Sbjct: 426 WHSGEAITHGALRGAPITLQWNAEHEPIRKGDDIYKRAYAHSFGIAPQAVTKQQRQIGKV 485

Query: 435 MELALGYQGGAKAFQKMASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENH-PEHA 493
            ELALGY GG  AF   A+   ++L   A   +    P   + A    +W + N  P   
Sbjct: 486 QELALGYGGGVGAFAAFAAMYHIDLEAMAE--QAALPPLLLQQAMEALQWTKANQRPTFG 543

Query: 494 IEDLFIGTACERVKKAWRQKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKK 553
           + D     AC+  K+AWR  H  ++  W  L  A    I  G    A     + + Y   
Sbjct: 544 LSDR-AWLACDVFKRAWRNAHPAIAAFWQALQCAVTDAI--GHPETAHTCCGITVQY--- 597

Query: 554 DKNNLILMLPSGRSLVYR----DVGNNRSYLNT--TTRQLTREYTYGGKLTENIVQAVSR 607
            +  L + LPSGR L Y     D     SY+ T   TR+ TR  TYGGKL ENI QAVSR
Sbjct: 598 SRAWLRMRLPSGRVLYYAAPRVDEHGALSYMGTHPITRKWTRITTYGGKLVENITQAVSR 657

Query: 608 DILAEGMMNATKAGYDIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEG 667
           D+LA  M     AGY IVLTVHDEI+ E  D   FNA+ L  LM + P WA+GLPL AEG
Sbjct: 658 DVLAACMPAIEAAGYAIVLTVHDEIITEADDNAAFNAAHLAALMATPPPWAQGLPLAAEG 717

Query: 668 YESKRYRK 675
           +E+ RYRK
Sbjct: 718 FETHRYRK 725


>gi|71901491|ref|ZP_00683578.1| DNA-directed DNA polymerase [Xylella fastidiosa Ann-1]
 gi|71728747|gb|EAO30891.1| DNA-directed DNA polymerase [Xylella fastidiosa Ann-1]
          Length = 712

 Score =  387 bits (995), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 272/715 (38%), Positives = 369/715 (51%), Gaps = 69/715 (9%)

Query: 4   LFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHDPVMPQVLKEALEN 63
           L+ D ET SP+ +   G+  YAE   ++LFA+   D PV++WDC     MP+ L  AL N
Sbjct: 11  LWGDLETYSPVPIAH-GVHAYAEQAQLLLFAYALGDGPVQVWDCTATATMPEELSAALHN 69

Query: 64  TDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKLSSQ-- 121
             V +  HNS+F+RTVL+ C  ++IP+ RW  ++  A ++ LP AL  + E L++  +  
Sbjct: 70  PAVLLYFHNSHFDRTVLRHC-GINIPLERWRDSMAQALAHALPGALGTLCELLRVPVEQA 128

Query: 122 KMEEGKELIARFCKGETHECLYDR-NKPNHREAWRLFGEYCKGDVTVTREIFKRLEP--L 178
           K ++GK L+A FCK     C   R  +  H   W  F +Y + DVT  R++ KRL     
Sbjct: 129 KAKDGKRLVALFCKPRPTHCTLRRATRDTHPTEWAQFVDYARRDVTAMRDVVKRLPSHNY 188

Query: 179 SSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSSSRCLEK 238
           +  E  LW+LDQTINDRG  VD  LA      V+  +  L +    LT G+V ++   + 
Sbjct: 189 TGAELALWFLDQTINDRGVLVDTDLAQAAIGAVERAKQALAERTSDLTAGVVQAATQRDA 248

Query: 239 LKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAI-QVFNNRMRASRSAVLKLNTLVEA 297
           L   L  E G+ L D+ + T +R L  +  L P+ + ++ + R +AS ++  K   L+  
Sbjct: 249 LLHHLSTEHGVVLPDMQQHTVERCL--DDPLLPETVRELLSIRRQASTTSTAKYQALLNC 306

Query: 298 MNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTS---ITSDP 354
            + DGRLRGTLQF GASRTGRW+G +F P NLPRP+ S   +   I  +      +  D 
Sbjct: 307 TSRDGRLRGTLQFNGASRTGRWAGRLFQPHNLPRPTLSQPVIAVGIDAMKAGCVDVVFD- 365

Query: 355 DPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAF------------ 402
           D + + S  +RSC+IA   KKLVVADL+ IE RVLAW+AGE  KL+AF            
Sbjct: 366 DVMALTSSALRSCLIAPTHKKLVVADLSNIEGRVLAWLAGETPKLQAFGDFDTCQGVDGT 425

Query: 403 ----------------------------ETGEDLYVTTYARSFNVAPAQVTKDQRAIGKV 434
                                         G+D+Y   YA SF +AP  VTK+QR IGKV
Sbjct: 426 WHSGEAITHGALRGAPIALQWNAEHAPIRKGDDIYKRAYAHSFGIAPQAVTKEQRQIGKV 485

Query: 435 MELALGYQGGAKAFQKMASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENH-PEHA 493
            ELALGY GG  AF   A+   ++L   A   +    P   + A    +W + NH P   
Sbjct: 486 QELALGYGGGVGAFAAFAAMYHIDLEAMAE--QAALPPLLLQQAVEALQWTKANHRPTFG 543

Query: 494 IEDLFIGTACERVKKAWRQKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKK 553
           + D     AC+  K+AWR  H  ++  W  L  A    I  G    A     + + Y   
Sbjct: 544 LSDR-AWLACDVFKRAWRNAHPAIAAFWQALQCAVTDAI--GHPETAHTCCGITVQY--- 597

Query: 554 DKNNLILMLPSGRSLVYR----DVGNNRSYLNT--TTRQLTREYTYGGKLTENIVQAVSR 607
            +  L + LPSGR L Y     D     SY+ T   TR+ TR  TYGGKL ENI QAVSR
Sbjct: 598 SRAWLRMRLPSGRVLYYAAPRVDEHGALSYMGTHPITRKWTRITTYGGKLVENITQAVSR 657

Query: 608 DILAEGMMNATKAGYDIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLP 662
           D+LA  M     AGY IVLTVHDEI+ E  D   FNA+ L  LM + P   +G P
Sbjct: 658 DVLAACMPAIEAAGYAIVLTVHDEIITEADDNAAFNAAHLAALMATPPPGHRGCP 712


>gi|309702940|emb|CBJ02271.1| putative phage DNA polymerase [Escherichia coli ETEC H10407]
          Length = 598

 Score =  383 bits (983), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 236/600 (39%), Positives = 336/600 (56%), Gaps = 37/600 (6%)

Query: 100 ARS-NGLPSALKAVGEALKLSSQKME--EGKELIARFCKGETHECLYDR-NKPNHREAWR 155
           ARS  G   AL  + E L +   K +  EGK LI  FCK         R     H E WR
Sbjct: 11  ARSPGGSGGALGELCEVLGVPQDKAKDKEGKALIQLFCKPRPKNSKLRRATSKTHPEEWR 70

Query: 156 LFGEYCKGDVTVTREIFKRLEPLSSKEQEL--WYLDQTINDRGYCVDVALAHTLNQIVDV 213
            F  Y   D+   RE++KRL   + +  EL  W+ DQ INDRG C+DV LA      VD 
Sbjct: 71  RFVAYAGLDIEAMREVYKRLPKWNYQGTELALWHRDQQINDRGVCMDVELARAAIDAVDQ 130

Query: 214 ERTKLDQELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQA 273
           E+ +L +  + +T G V ++   + L   +    G+ L D+  +T +R ++ +  L    
Sbjct: 131 EQKRLAKRTQEMTDGEVQAATQRDALIKHIVESYGVELPDMQRSTLERRIA-DPDLPSAV 189

Query: 274 IQVFNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPS 333
            ++   R++AS ++  K   L++ ++ DGRLRGTLQF GASRTGRW+G +F PQNLPRPS
Sbjct: 190 KELLAIRLQASTTSTSKYKALMKGVSHDGRLRGTLQFCGASRTGRWAGRLFQPQNLPRPS 249

Query: 334 RSHEELDQIITHLPTSITS--DPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAW 391
              E++D+ I  L          + +++ S  +R C+IA  GKKLVV+DL+ IE R+LAW
Sbjct: 250 LKQEQIDEGIEALKAGCADLLFDNIMELTSSALRGCIIAPTGKKLVVSDLSNIEGRMLAW 309

Query: 392 MAGEQWKLKAFE-----TGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAK 446
           +AGE+WKL AF      TG DLY   YA++F++AP  V K  R IGKVMEL LGY GG  
Sbjct: 310 LAGEEWKLNAFREYDAGTGPDLYKLAYAKAFDIAPDDVDKHMRQIGKVMELGLGYGGGVS 369

Query: 447 AFQKMASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAI----EDLFIGTA 502
           AF   A   GL+L+  A+    N   +   +A++   W  E+    +     E +FI  A
Sbjct: 370 AFITFALVYGLDLDGLANAALPNIPRDVIREAKS---WYDESVKRKSTYGLSERVFI--A 424

Query: 503 CERVKKAWRQKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMK--KDKNNLIL 560
           C+ +K+ WR+ H    + W EL    E T+   +  IA  ++ +   Y+K  +D   L +
Sbjct: 425 CDSLKRLWRRAHPATCDFWYEL----ECTV---RTAIATPQKTLYCGYLKIRRDGAWLRI 477

Query: 561 MLPSGRSLVYRDV---GNNRSYL--NTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMM 615
            LPSGR++ Y        N +Y+  N+ +R+  R  TYGGKL EN+ QA +RD+LA  M 
Sbjct: 478 QLPSGRAVCYPSPVIEQGNITYMGVNSYSRKWQRLKTYGGKLVENVTQAAARDVLAGNMP 537

Query: 616 NATKAGYDIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
               AGY IVLTVHDE++ E+PDT++FN   L  L+++NP WA  +PL A G+E+  YRK
Sbjct: 538 LIEDAGYSIVLTVHDEVITESPDTEDFNDKALSALLSTNPEWAPDIPLNAGGFEAYHYRK 597


>gi|160898852|ref|YP_001564434.1| DNA-directed DNA polymerase [Delftia acidovorans SPH-1]
 gi|160364436|gb|ABX36049.1| DNA-directed DNA polymerase [Delftia acidovorans SPH-1]
          Length = 704

 Score =  379 bits (974), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 251/716 (35%), Positives = 364/716 (50%), Gaps = 57/716 (7%)

Query: 2   ATLFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHDPVMPQVLKEAL 61
           A L++D ET S  DL + G  +YAE    +LFA+   D P  +WDC  +  M   L  A+
Sbjct: 3   APLWLDRETWSERDLKEVGTARYAEVAEDLLFAYAIGDGPARVWDCTAEE-MHDELYHAM 61

Query: 62  ENTDVTIVAHNSYFERTVLKACFNLDIPI---HRWICTLVLARSNGLPSALKAVGEALKL 118
           ++ D    AHN++F+RT+        +P     RW C++ +A S+ LP  L  +   LK+
Sbjct: 62  DDADSEAWAHNAFFDRTIHNGPAQAHLPRIADERWRCSMAMALSHALPGGLADLCRVLKV 121

Query: 119 SSQ--KMEEGKELIARFCKGETHECLYDR-NKPNHREAWRLFGEYCKGDVTVTREIFKRL 175
            +   K+ +GK+L+  F + +       R  +  H   W  F +Y   D+T  RE  +R+
Sbjct: 122 PADMAKLADGKKLVRLFTQPQPDNRKVRRATRLTHPAEWERFKQYAANDITAMRECVRRM 181

Query: 176 EPLSSKEQEL--WYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSSS 233
              +     +  W+LDQ IN RG+ VD AL     +    E+ ++      L+ G  +  
Sbjct: 182 PAWNWDASAIAEWHLDQRINQRGFQVDQALTRAGARAAVEEKARIATRFAQLSGGQFTPG 241

Query: 234 RCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLNT 293
           +  EK + +L    G  L++    T Q V+  +  L     ++    + +++++  K   
Sbjct: 242 Q-REKFRVYLGQRLGYELDNTQAGTFQ-VMLRDPGLPADVREMIELAIASNKTSTAKYAA 299

Query: 294 LVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLP-RPSRSHEELDQIITHLPTSITS 352
           L  A++ DGR RG LQF GASRT RW+G +F PQNLP R   S E ++  I HL     +
Sbjct: 300 LDPAVSPDGRFRGGLQFAGASRTRRWAGRLFQPQNLPSRGLPSAEVIEDYIEHLKMGTHA 359

Query: 353 -DPDPLQII-SDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFE-----TG 405
              D L ++ +  +R CV+A+ GKKLVVADL+ IE RVLAW+A E+WKLKAF      TG
Sbjct: 360 LFFDNLMLLGAAALRGCVVAAPGKKLVVADLSNIEGRVLAWIAREEWKLKAFREYDAGTG 419

Query: 406 EDLYVTTYARSFNVAPAQVTKDQR-AIGKVMELALGYQGGAKAFQKMASTTGLNL----N 460
            DLY  T        P  V K  R A GKV +LA GYQGG   +Q  A + GL +    +
Sbjct: 420 PDLYNITAVSIIGGDPWNVEKKNRNAFGKVPDLASGYQGGVAGYQTFARSYGLKMADFWD 479

Query: 461 TFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIG----TACERVKKAWRQKHSR 516
           T   +V      + WE   N   W    HP+  +E L I      A E  K AWR +H  
Sbjct: 480 TIQQMVPAQHVAKAWE---NLASW---GHPQ--LESLEIDEIEWVASETCKLAWRARHPA 531

Query: 517 VSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMK----KDKNNLILMLPSGRSLVYRD 572
            S+ W  L  A +  I N  ++        P + ++    + +  L++ LPSGR L Y +
Sbjct: 532 TSKFWYALGGAAKDAIRNPGSVFTAG----PFIKLRTVSHRGQKWLVVRLPSGRFLTYFE 587

Query: 573 ---VGNNR----------SYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATK 619
              VG  R          S    TTRQ  R +T+GGK+T N  Q ++RDILA  M  A  
Sbjct: 588 PHIVGQGRDETIAYWGEASEEGKTTRQWVRVFTHGGKMTGNCCQTIARDILAPSMAVAEN 647

Query: 620 AGYDIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
            GY  VL+VHDE + E PDTD+F A+ L  ++ +NP+WA  LPL A G+E+ RY+K
Sbjct: 648 RGYLPVLSVHDEALTEVPDTDDFTAAGLVEILATNPAWAPDLPLAAAGFEAYRYKK 703


>gi|282534222|gb|ADA82330.1| putative DNA polymerase [Escherichia phage K1H]
          Length = 726

 Score =  379 bits (973), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 260/730 (35%), Positives = 363/730 (49%), Gaps = 59/730 (8%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAEDVC--VILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M+ LF+DFET S  DL K G   YAE     V++  + FDD PV++WDC +   MP  L 
Sbjct: 1   MSYLFLDFETFSEADLKKVGSYAYAEHPTTEVLICTYAFDDEPVQVWDCTNGSDMPGDLH 60

Query: 59  EALE-----NTDVTIVAHN-SYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAV 112
            AL      N+ + +V HN S F+R ++K C+  DIP+   I T++ A  + LP +L A+
Sbjct: 61  RALRRLVKPNSRIKMVWHNGSMFDRLIMKHCWGFDIPVSNTIDTMIWAFRHALPGSLDAL 120

Query: 113 GEALKLSSQ--KMEEGKELIARFCKGETHECLYDR-NKPNHREAWRLFGEYCKGDVTVTR 169
            E L +S+   K + GK LI RF K         R     H + W LF +Y   D+T  R
Sbjct: 121 CEVLGVSADNAKDKRGKALIQRFSKPTPKNYKIRRYTAETHPDEWALFIKYAVSDITAMR 180

Query: 170 EIFKRLEPLSSKEQE--LWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTY 227
           E+F +L    + E E  +  LDQ INDRG+ VDVALA    + V+  + +L +E +    
Sbjct: 181 EVFHKLPRWGNSEFEDRVLELDQLINDRGFKVDVALAEAAIEAVEKHKAQLQEEAQRKYG 240

Query: 228 GLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSA 287
           G ++    L  L+    L     + +  ++T   +L+ +      A  +   R+ A+ +A
Sbjct: 241 GSLTGKDFLPILRE---LAPAHRIHNAQKSTLNDLLADDDLPD-DARTIIEMRLGAASTA 296

Query: 288 VLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLP 347
             K N L+   +SD R RG +Q+ GA RT R++G  F PQNL R     +ELD+ I+ L 
Sbjct: 297 STKYNPLLLGRSSDDRRRGCIQYGGAKRTLRFAGKGFQPQNLARGYYHDDELDKGISALL 356

Query: 348 TSITSDP-DPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGE 406
                   D  ++ +  VRSC+I   G K VVAD + +E R LAW+AGE+  L  F  G 
Sbjct: 357 KGRAHRRFDVAKLTASTVRSCIIPEAGHKFVVADYSNVEGRGLAWLAGEETALDTFRAGL 416

Query: 407 DLYVTTYARSFNVAPAQVTK---DQRAIGKVMELALGYQGGAKAFQKMASTTGLNL---- 459
           D+Y  T  + F + P  + K   D R IGK  EL LGY GG  AF + A   GL+L    
Sbjct: 417 DIYCVTAGKMFGMEPDYIKKERKDLRQIGKACELGLGYAGGVGAFVQFAKNLGLDLVDMT 476

Query: 460 ----NTFA-HLVKTNSAPEEW---EDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWR 511
                TF  H+    +   EW   ++A+   R  + +     I D  +   C+ +K+ WR
Sbjct: 477 KTMDGTFPDHIWAATARGYEWARIQEAKRPPRPGENDDRPSYILDKKVWRTCDAIKRMWR 536

Query: 512 QKHSRVSELWNELHQAFEQTIEN-GKAIIARKRRDVPLVYMKKDKNN-------LILMLP 563
           + H      W ++  A    I N GK   A  R       ++ D N        L + LP
Sbjct: 537 ESHPETVAFWRDIEDAAMAAIRNPGKEFTAGPRGVKFSRNVETDNNGNKVAGWWLRMTLP 596

Query: 564 SGRSLVYRDVGNNRSYL------------------NTTTRQLTREYTYGGKLTENIVQAV 605
           SGR + Y  VG + S                    N  TRQ   +YTY GKL EN  QA+
Sbjct: 597 SGRVMSYPGVGLSVSKETDEDGKVSTNVRIKYQGENQLTRQWGFQYTYSGKLVENCTQAL 656

Query: 606 SRDILAEGMMNATKAGYDIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKA 665
            RD+LA  ++N    GY IVL VHDEI+CETPD  E+N + L  LM   P WA+G PL A
Sbjct: 657 CRDLLANALLNVEANGYPIVLHVHDEIICETPDLPEYNVAELERLMCELPEWAEGFPLVA 716

Query: 666 EGYESKRYRK 675
           EG E KRY K
Sbjct: 717 EGAEMKRYAK 726


>gi|282533171|gb|ADA82280.1| putative DNA polymerase [Escherichia phage K1G]
          Length = 726

 Score =  377 bits (969), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 260/730 (35%), Positives = 363/730 (49%), Gaps = 59/730 (8%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAEDVC--VILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M+ LF+DFET S  DL K G   YAE     V++  + FDD PV++WDC +   MP  L 
Sbjct: 1   MSYLFLDFETFSEADLKKVGSYAYAEHPTTEVLICTYAFDDEPVQVWDCTNGSDMPGDLH 60

Query: 59  EALE-----NTDVTIVAHN-SYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAV 112
            AL      N+ + +V HN S F+R ++K C+  DIP+   I T++ A  + LP +L A+
Sbjct: 61  RALRRLVKPNSRIKMVWHNGSMFDRLIMKHCWGFDIPVSNTIDTMIWAFRHALPGSLDAL 120

Query: 113 GEALKLSSQ--KMEEGKELIARFCKGETHECLYDR-NKPNHREAWRLFGEYCKGDVTVTR 169
            E L +S+   K + GK LI RF K         R     H + W LF +Y   D+T  R
Sbjct: 121 CEVLGVSADNAKDKRGKALIQRFSKPTPKNYKIRRYTAETHPDEWALFIKYAVSDITAMR 180

Query: 170 EIFKRLEPLSSKEQE--LWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTY 227
           E+F +L    + E E  +  LDQ INDRG+ VDVALA    + V+  + +L +E +    
Sbjct: 181 EVFHKLPRWGNSEFEDRVLELDQLINDRGFKVDVALAEAAIEAVEKHKAQLQEEAQRKYG 240

Query: 228 GLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSA 287
           G ++    L  L+    L     + +  ++T   +L+ +      A  +   R+ A+ +A
Sbjct: 241 GSLTGKDFLPILRE---LAPAHRIHNAQKSTLNDLLADDDLPD-DARTIIEMRLGAASTA 296

Query: 288 VLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLP 347
             K N L+   +SD R RG +Q+ GA RT R++G  F PQNL R     +ELD+ I+ L 
Sbjct: 297 STKYNPLLLGRSSDDRRRGCIQYGGAKRTLRFAGKGFQPQNLARGYYHDDELDKGISALL 356

Query: 348 TSITSDP-DPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGE 406
                   D  ++ +  VRSC+I   G K VVAD + +E R LAW+AGE+  L  F  G 
Sbjct: 357 KGRAHRRFDVAKLTASTVRSCIIPEAGHKFVVADYSNVEGRGLAWLAGEETALDTFRAGL 416

Query: 407 DLYVTTYARSFNVAPAQVTK---DQRAIGKVMELALGYQGGAKAFQKMASTTGLNL---- 459
           D+Y  T  + F + P  + K   D R IGK  EL LGY GG  AF + A   GL+L    
Sbjct: 417 DIYCVTAGKMFGMEPDYIKKERKDLRQIGKACELGLGYAGGVGAFVQFAKNLGLDLVDMA 476

Query: 460 ----NTFAHLVKTNSA-PEEW---EDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWR 511
                TF   +   +A   EW   ++A+   R  + +     I D  +   C+ +K+ WR
Sbjct: 477 KTMDGTFPDYIWAATARGYEWARIQEAKRPPRPGENDDRPSYILDKKVWRTCDAIKRMWR 536

Query: 512 QKHSRVSELWNELHQAFEQTIEN-GKAIIARKRRDVPLVYMKKDKNN-------LILMLP 563
           + H      W ++  A    I N GK   A  R       ++ D N        L + LP
Sbjct: 537 ESHPETVAFWRDIEDAAMAAIRNPGKEFTAGPRGVKFSRNVETDNNGNKVAGWWLRMTLP 596

Query: 564 SGRSLVYRDVGNNRSYL------------------NTTTRQLTREYTYGGKLTENIVQAV 605
           SGR + Y  VG + S                    N  TRQ   +YTY GKL EN  QA+
Sbjct: 597 SGRVMSYPGVGLSVSKETDEDGKVSTNVRIKYQGENQLTRQWGFQYTYSGKLVENCTQAL 656

Query: 606 SRDILAEGMMNATKAGYDIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKA 665
            RD+LA  ++N    GY IVL VHDEI+CETPD  E+N + L  LM   P WA+G PL A
Sbjct: 657 CRDLLANALLNVEANGYPIVLHVHDEIICETPDLPEYNVAELERLMCELPEWAEGFPLVA 716

Query: 666 EGYESKRYRK 675
           EG E KRY K
Sbjct: 717 EGAEMKRYAK 726


>gi|282535272|gb|ADA82478.1| putative DNA polymerase [Escherichia phage K1ind3]
 gi|282547373|gb|ADA82429.1| putative DNA polymerase [Escherichia phage K1ind2]
          Length = 726

 Score =  375 bits (963), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 258/730 (35%), Positives = 361/730 (49%), Gaps = 59/730 (8%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAEDVC--VILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M+ LF+DFET S  DL K G   YAE     V++  + FDD  V++WDC     MP  L 
Sbjct: 1   MSYLFLDFETFSEADLKKVGSYAYAEHPTTEVLICTYAFDDEHVQVWDCTDGSDMPGDLH 60

Query: 59  EALE-----NTDVTIVAHN-SYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAV 112
            AL      N+ + +V HN S F+R ++K C+  DIP+   I T++ A  + LP +L A+
Sbjct: 61  RALRRLVKPNSRIKMVWHNGSMFDRLIMKHCWGFDIPVSNTIDTMIWAFRHALPGSLDAL 120

Query: 113 GEALKLSSQ--KMEEGKELIARFCKGETHECLYDR-NKPNHREAWRLFGEYCKGDVTVTR 169
            E L +S+   K + GK LI RF K         R     H + W LF +Y   D+T  R
Sbjct: 121 CEVLGVSADNAKDKRGKALIQRFSKPTPKNYKIRRYTAETHPDEWALFIKYAVSDITAMR 180

Query: 170 EIFKRLEPLSSKEQE--LWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTY 227
           E+F +L    + E E  +  LDQ INDRG+ VDVALA    + V+  + +L +E +    
Sbjct: 181 EVFHKLPRWGNSEFEDRVLELDQLINDRGFKVDVALAEAAIEAVEKHKAQLQEEAQRKYG 240

Query: 228 GLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSA 287
           G ++    L  L+    L     + +  ++T   +L+ +      A  +   R+ A+ +A
Sbjct: 241 GSLTGKDFLPILRE---LAPAHRIHNAQKSTLNDLLADDDLPD-DARTIIEMRLGAASTA 296

Query: 288 VLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLP 347
             K N L+   +SD R RG +Q+ GA RT R++G  F PQNL R     +ELD+ I+ L 
Sbjct: 297 STKYNPLLLGRSSDDRRRGCIQYGGAKRTLRFAGKGFQPQNLARGYYHDDELDKGISALL 356

Query: 348 TSITSDP-DPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGE 406
                   D  ++ +  VRSC+I   G K VVAD + +E R LAW+AGE+  L  F  G 
Sbjct: 357 KGRAHRRFDVAKLTASTVRSCIIPEAGHKFVVADYSNVEGRGLAWLAGEETALDTFRAGL 416

Query: 407 DLYVTTYARSFNVAPAQVTK---DQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFA 463
           D+Y  T  + F + P  + K   D R IGK  EL LGY GG  AF + A   GL+L   A
Sbjct: 417 DIYCVTAGKMFGMEPDYIKKERKDLRQIGKACELGLGYAGGVGAFVQFAKNLGLDLVDMA 476

Query: 464 ---------HLVKTNSAPEEW---EDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWR 511
                    H+    +   EW   ++A+   R  +++     I D  +   C+ +K+ WR
Sbjct: 477 KTMDGTFPDHIWAATARGYEWARIQEAKRPPRPGEKDDRPSYILDKKVWRTCDAIKRMWR 536

Query: 512 QKHSRVSELWNELHQAFEQTIEN-GKAIIARKRRDVPLVYMKKDKNN-------LILMLP 563
           + H      W ++  A    I N GK   A  R       ++ D N        L + LP
Sbjct: 537 ESHPETVAFWRDIEDAAMAAIRNPGKEFTAGPRGVKFSRNVETDNNGNKVAGWWLRMTLP 596

Query: 564 SGRSLVYRDVGNNRSYL------------------NTTTRQLTREYTYGGKLTENIVQAV 605
           SGR + Y  VG + S                    N  TRQ   +YTY GKL EN  QA+
Sbjct: 597 SGRVMSYPGVGLSVSKETDEDGKVSTNVRIKYQGENQLTRQWGFQYTYSGKLVENCTQAL 656

Query: 606 SRDILAEGMMNATKAGYDIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKA 665
            RD+LA  ++N    GY IVL VHDEI+CETPD  E+N + L  LM   P WA+G PL A
Sbjct: 657 CRDLLANALLNVEANGYPIVLHVHDEIICETPDLPEYNVAELERLMCELPEWAEGFPLVA 716

Query: 666 EGYESKRYRK 675
           EG E KRY K
Sbjct: 717 EGAEMKRYAK 726


>gi|212499741|ref|YP_002308549.1| DNA polymerase [Bacteriophage APSE-2]
 gi|238898732|ref|YP_002924413.1| APSE-2 prophage; DNA polymerase [Candidatus Hamiltonella defensa
           5AT (Acyrthosiphon pisum)]
 gi|211731710|gb|ACJ10198.1| DNA polymerase [Bacteriophage APSE-2]
 gi|229466491|gb|ACQ68265.1| APSE-2 prophage; DNA polymerase [Candidatus Hamiltonella defensa
           5AT (Acyrthosiphon pisum)]
          Length = 993

 Score =  375 bits (963), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 228/614 (37%), Positives = 340/614 (55%), Gaps = 32/614 (5%)

Query: 4   LFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHDPVMPQVLKEALEN 63
           LF D ET S I +  CG  +YAE+  ++LFA+ ++  PV++WD   D  MP  LK   ++
Sbjct: 5   LFCDLETYSDIPIN-CGTHRYAENAEILLFAYAYNHAPVKVWDVTQDKTMPADLKAYFDD 63

Query: 64  TDVTIVAHNS-YFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKLSSQK 122
           +++  V HN   F+  +LK   N+D+P+ R   TLV A ++GLP AL  + +   ++S K
Sbjct: 64  SEILTVWHNGGMFDTVILKRVLNIDLPLSRVHDTLVQALAHGLPGALGLLCDIFNVNSDK 123

Query: 123 ME--EGKELIARFCKGETHECLYDRNKP-NHREAWRLFGEYCKGDVTVTREIFKRLEP-- 177
            +  EGK LI+  CK         R     H E W+ F +Y   D+   REI++ L    
Sbjct: 124 AKDKEGKALISLLCKPRPKNSKIQRATALTHAEEWQRFKDYAGSDILAMREIYQHLPNWN 183

Query: 178 LSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSSSRCLE 237
           ++  E ELW LDQ IN RG C+DV LA +    V+ E+ +L    + LT   V ++   +
Sbjct: 184 MNVDETELWQLDQKINRRGMCMDVELAKSALTAVENEQKRLSTVTQQLTDNAVQNATQRD 243

Query: 238 KLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLNTLVEA 297
            L   +    G+ L D+  +T QR ++ +  + P   ++ + R+++  ++  K   L+++
Sbjct: 244 ALLQHIASAFGITLPDMQASTLQRRIN-DPDIPPDLRELLSVRLQSCTTSTSKYKALLKS 302

Query: 298 MNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTS---ITSDP 354
           +++DGRLRGT QF GASRTGRW+G VF P NLPRP+     +D  I  L      +  D 
Sbjct: 303 VSADGRLRGTKQFCGASRTGRWAGRVFQPDNLPRPTLDPNTIDNGIEALKAGCAELICD- 361

Query: 355 DPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFE-----TGEDLY 409
           D +Q+ S  +R C+IA  GKKLV++DL+ IE R+LAW+AGE WK+KAF       G+DLY
Sbjct: 362 DIMQLTSSALRGCIIAPPGKKLVISDLSNIEGRMLAWLAGENWKVKAFSEFDNGKGDDLY 421

Query: 410 VTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVKTN 469
              YAR+FN+ P  VTKDQR IGKVMEL LGY GG  AF   A   GL+L+  A     +
Sbjct: 422 KLAYARAFNLLPEDVTKDQRQIGKVMELGLGYGGGVAAFLTFALAYGLDLDELAEAALPH 481

Query: 470 SAPEEWEDAENFCRWMQENHPEHAI-EDLFIGTACERVKKAWRQKHSRVSELWNELHQAF 528
             P    +A ++ +   E    + + E +F+   C+ +K+ WR  H +    W ++  A 
Sbjct: 482 IPPGVKREATSWYQKSVETDKTYGLSEKIFVN--CDSLKRMWRNAHPQTVSFWYDIEDAV 539

Query: 529 EQTIEN-GKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVY---RDVGNNRSYLNTT- 583
           +Q I++ G A   RK      + +++DK  L + LPSGRSL Y   R      +Y+ T  
Sbjct: 540 KQAIQSPGIAFKCRK------LSVRRDKGWLRICLPSGRSLCYPSARIENGQITYMGTNP 593

Query: 584 -TRQLTREYTYGGK 596
            +R+  R  TYGGK
Sbjct: 594 YSRKWERLKTYGGK 607



 Score = 92.0 bits (227), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 54/77 (70%)

Query: 599 ENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWA 658
           ENI QA +RD+LA  M    KAGY+IVLTVHDEI+ E PDT +F+A  L  L++ N  WA
Sbjct: 916 ENICQAAARDVLAYNMPPIEKAGYEIVLTVHDEIISEAPDTPQFSAEGLSKLLSFNSDWA 975

Query: 659 KGLPLKAEGYESKRYRK 675
             LPL A G+E+ RYRK
Sbjct: 976 WDLPLSANGFETYRYRK 992


>gi|9633592|ref|NP_051006.1| P45 [Acyrthosiphon pisum bacteriophage APSE-1]
 gi|9910664|sp|Q9T1Q3|DPOL_BPAPS RecName: Full=Probable DNA polymerase; AltName: Full=P45
 gi|6118040|gb|AAF03988.1|AF157835_45 P45 [Endosymbiont phage APSE-1]
          Length = 993

 Score =  374 bits (961), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 231/617 (37%), Positives = 341/617 (55%), Gaps = 38/617 (6%)

Query: 4   LFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHDPVMPQVLKEALEN 63
           LF D ET S I +  CG  +YAE+  ++LFA+ ++  PV++WD   D  MP  LK  L++
Sbjct: 5   LFCDLETYSDIPIN-CGTHRYAENAEILLFAYAYNHAPVKVWDVTQDKTMPADLKAYLDD 63

Query: 64  TDVTIVAHNS-YFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKLSSQK 122
           +++  V HN   F+  +LK   N+D+P+ R   TLV A ++GLP AL  + +   ++S K
Sbjct: 64  SEILTVWHNGGMFDTVILKRVLNIDLPLSRVHDTLVQALAHGLPGALGLLCDIFNVNSDK 123

Query: 123 ME--EGKELIARFCKGETHECLYDRNKP-NHREAWRLFGEYCKGDVTVTREIFKRLEP-- 177
            +  EGK LI+  CK         R     H E W+ F +Y   D+   REI++ L    
Sbjct: 124 AKDKEGKALISLLCKPRPKNSKIQRATALTHAEEWQRFKDYAGSDILAMREIYQHLPNWN 183

Query: 178 LSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSSSRCLE 237
           ++  E ELW LDQ IN RG C+DV LA +    V+ E+ +L    + LT   V ++   +
Sbjct: 184 MNVHETELWQLDQKINRRGMCMDVELAKSALTAVENEQKRLSTVTQQLTDNAVQNATQRD 243

Query: 238 KLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLNTLVEA 297
            L   +    G+ L D+  +T QR ++ +  + P   ++ + R+++  ++  K   L+++
Sbjct: 244 ALLQHIASAFGITLPDMQASTLQRRIN-DPDIPPALRELLSVRLQSCTTSTSKYKALLKS 302

Query: 298 MNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTS---ITSDP 354
           +++DGRLRGT QF GASRTGRW+G VF P NLPRP+     +D  I  L      +  D 
Sbjct: 303 VSADGRLRGTKQFCGASRTGRWAGRVFQPDNLPRPTLDPNTIDNGIEALKAGCAELICD- 361

Query: 355 DPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFE-----TGEDLY 409
           D +Q+ S  +R C+IA  GKKLV++DL+ IE R+LAW+AGE WK+ AF       G+DLY
Sbjct: 362 DIMQLTSSALRGCIIAPPGKKLVISDLSNIEGRMLAWLAGENWKVNAFSEFDNGKGDDLY 421

Query: 410 VTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVKTN 469
              YAR+FN+ P  VTK+QR IGKVMEL LGY GG  AF   A   GL+L+  A     N
Sbjct: 422 KLAYARAFNLLPEDVTKEQRQIGKVMELGLGYGGGVAAFLTFALAYGLDLDELAEAALPN 481

Query: 470 SAPEEWEDAENFCRWMQ---ENHPEHAI-EDLFIGTACERVKKAWRQKHSRVSELWNELH 525
             P    +A    RW Q   E    + + E +F+   C+ +K+ WR  H +    W ++ 
Sbjct: 482 IPPGVKREA---MRWYQKSVETDKTYGLSEKIFV--TCDSLKRMWRNAHPQTVSFWYDIE 536

Query: 526 QAFEQTIEN-GKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVY---RDVGNNRSYLN 581
            A +Q I++ G A   RK      + +++DK+ L + LPSGRSL Y   R      +Y+ 
Sbjct: 537 DAVKQAIQSPGIAFKCRK------LSVRRDKSWLRICLPSGRSLCYPSARIENGQITYMG 590

Query: 582 TT--TRQLTREYTYGGK 596
           T   +R+  R  TYGGK
Sbjct: 591 TNPYSRKWERLKTYGGK 607



 Score = 92.0 bits (227), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 54/77 (70%)

Query: 599 ENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWA 658
           ENI QA +RD+LA  M    KAGY+IVLTVHDEI+ E PDT +F+A  L  L++ N  WA
Sbjct: 916 ENICQAAARDVLAYNMPPIEKAGYEIVLTVHDEIISEAPDTPQFSAEGLSKLLSFNSDWA 975

Query: 659 KGLPLKAEGYESKRYRK 675
             LPL A G+E+ RYRK
Sbjct: 976 WDLPLSANGFETYRYRK 992


>gi|318064432|gb|ADV36447.1| DNA polymerase I [Edwardsiella phage eiAU]
 gi|318064540|gb|ADV36499.1| DNA polymerase I [Edwardsiella phage eiDWF]
 gi|318064644|gb|ADV36551.1| DNA polymerase I [Edwardsiella phage eiMSLS]
          Length = 735

 Score =  369 bits (948), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 256/737 (34%), Positives = 359/737 (48%), Gaps = 71/737 (9%)

Query: 4   LFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDC----------VHDP 51
           LF+DFET S  DL K G   YAE     ++L ++ FDD P ++WD           + + 
Sbjct: 5   LFLDFETFSEADLKKVGAYAYAEHDSTEILLASYAFDDGPAKVWDATCASGESDIDLDNN 64

Query: 52  VMPQVLKEALENTD---VTIVAHNS-YFERTVLKACFNLDIPIHRWICTLVLARSNGLPS 107
             P  L   L       V +V HN   F+R +++ C  LDIP      T+V A  + LP 
Sbjct: 65  SAPDDLLRGLRRAKRGRVKLVMHNGLMFDRLIIRECLGLDIPPEHIHDTMVQAFRHALPG 124

Query: 108 ALKAVGEALKLSSQ--KMEEGKELIARFCKGETHEC---LYDRNKPNHREAWRLFGEYCK 162
           +L  + E L + +   K + GK LI RFCK          YDRN   H + W+ F  Y +
Sbjct: 125 SLDKLCEVLNVDADLAKDKAGKALIKRFCKPTPKNYKIRRYDRN--THPDEWKQFKHYAR 182

Query: 163 GDVTVTREIFKRLEPLS--SKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQ 220
            D+T  REI+ ++       KE E+  LDQ INDRG+ VD  LA      V   R +L +
Sbjct: 183 NDITAMREIYYKMPSWGEIDKENEILALDQRINDRGFYVDTDLAKAATAAVAAARAELQE 242

Query: 221 ELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNR 280
             ++   G ++ +  L  L+    L    H+ +  ++T   +L        +A QV   R
Sbjct: 243 AAQATYGGGLTGADFLPLLRD---LAPAHHIPNAQKSTLGDLLDDADLPD-EARQVIEMR 298

Query: 281 MRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELD 340
           + A+ +A  K   L+  M++DGR RG LQ+ GA RT RW+G  F PQNL R     + L 
Sbjct: 299 LGAASTASTKYAPLLNGMSADGRRRGCLQYGGAKRTLRWAGKGFQPQNLARGYFKEKPLA 358

Query: 341 QIITHLPTSITSDP-DPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKL 399
           + I  L         D +++ +  VR C+I + GKKLVVAD + +E R LAW+AGE   L
Sbjct: 359 RGIEALKRGTAEYAFDVMKLAASTVRGCIIPAPGKKLVVADYSNVEGRGLAWLAGEDSAL 418

Query: 400 KAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNL 459
             F  G D+Y  T  + F ++P  V   +R IGK  EL LGY GG  AF   +   GL+L
Sbjct: 419 DTFRAGLDIYKVTAGKMFGISPDDVDGYRRQIGKACELGLGYGGGVAAFLTFSKNLGLDL 478

Query: 460 NTFAHLVKTNSAPEEWEDAENFCRWMQ----ENHPEHAIEDLFIGTA--------CERVK 507
              A  +        W  A     +M+    +  P    +D              C+ +K
Sbjct: 479 EEMAVTMAGTFPDYHWRAALRAYEFMKLQEVKRKPLPGKKDDRTTVVLSKKAWLTCDCIK 538

Query: 508 KAWRQKHSRVSELWNELHQAFEQTIENGKAII---ARKRRDVP--------LVYMKKDKN 556
           + WR+ H R  + W +L +A    I+N  A     A+ R+D          L    K  N
Sbjct: 539 RMWRESHPRTVQFWYDLEEACLMAIDNPGASYWAGAKVRQDGKRAIRIERTLTRSGKPGN 598

Query: 557 NLILMLPSGRSLVYRDVG-------------NNRSYL-----NTTTRQLTREYTYGGKLT 598
            L + LPSGR L Y  +G               R  +     N  TRQ   ++TYGGKL 
Sbjct: 599 WLKIELPSGRILSYPGIGVSMEKTNEDDPGEKARPRIKYRGENQLTRQWGWQHTYGGKLA 658

Query: 599 ENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWA 658
           EN+ QA+ RDILA  M+    AGY+I+L+VHDE++ ETPDT E+N + L  LM   P+WA
Sbjct: 659 ENVTQALCRDILAWCMLPVDNAGYEIILSVHDELITETPDTAEYNVAELERLMCDLPAWA 718

Query: 659 KGLPLKAEGYESKRYRK 675
           KG PLKAEG+E  RY+K
Sbjct: 719 KGFPLKAEGWEGYRYKK 735


>gi|75906029|gb|ABA29378.1| DNA polymerase [Bacteriophage APSE-2]
          Length = 579

 Score =  368 bits (945), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 218/583 (37%), Positives = 326/583 (55%), Gaps = 27/583 (4%)

Query: 4   LFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHDPVMPQVLKEALEN 63
           LF D ET S I +  CG  +YAE+  ++LFA+ ++  PV++WD   D  MP  LK   ++
Sbjct: 5   LFCDLETYSDIPIN-CGTHRYAENAEILLFAYAYNHAPVKVWDVTQDKTMPADLKAYFDD 63

Query: 64  TDVTIVAHNS-YFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKLSSQK 122
           +++  V HN   F+  +LK   N+D+P+ R   TLV A ++GLP AL  + +   ++S K
Sbjct: 64  SEILTVWHNGGMFDTVILKRVLNIDLPLSRVHDTLVQALAHGLPGALGLLCDIFNVNSDK 123

Query: 123 ME--EGKELIARFCKGETHECLYDRNKP-NHREAWRLFGEYCKGDVTVTREIFKRLEP-- 177
            +  EGK LI+  CK         R     H E W+ F +Y   D+   REI++ L    
Sbjct: 124 AKDKEGKALISLLCKPRPKNSKIQRATALTHAEEWQRFKDYAGSDILAMREIYQHLPNWN 183

Query: 178 LSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSSSRCLE 237
           ++  E ELW LDQ IN RG C+DV LA +    V+ E+ +L    + LT   V ++   +
Sbjct: 184 MNVDETELWQLDQKINRRGMCMDVELAKSALTAVENEQKRLSTVTQQLTDNAVQNATQRD 243

Query: 238 KLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLNTLVEA 297
            L   +    G+ L D+  +T QR ++ +  + P   ++ + R+++  ++  K   L+++
Sbjct: 244 ALLQHIASAFGITLPDMQASTLQRRIN-DPDIPPDLRELLSVRLQSCTTSTSKYKALLKS 302

Query: 298 MNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTS---ITSDP 354
           +++DGRLRGT QF GASRTGRW+G VF P NLPRP+     +D  I  L      +  D 
Sbjct: 303 VSADGRLRGTKQFCGASRTGRWAGRVFQPDNLPRPTLDPNTIDNGIEALKAGCAELICD- 361

Query: 355 DPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFE-----TGEDLY 409
           D +Q+ S  +R C+IA  GKKLV++DL+ IE R+LAW+AGE WK+KAF       G+DLY
Sbjct: 362 DIMQLTSSALRGCIIAPPGKKLVISDLSNIEGRMLAWLAGENWKVKAFSEFDNGKGDDLY 421

Query: 410 VTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVKTN 469
              YAR+FN+ P  VTKDQR IGKVMEL LGY GG  AF   A   GL+L+  A     +
Sbjct: 422 KLAYARAFNLLPEDVTKDQRQIGKVMELGLGYGGGVAAFLTFALAYGLDLDELAEAALPH 481

Query: 470 SAPEEWEDAENFCRWMQENHPEHAI-EDLFIGTACERVKKAWRQKHSRVSELWNELHQAF 528
             P    +A ++ +   E    + + E +F+   C+ +K+ WR  H +    W ++  A 
Sbjct: 482 IPPGVKREATSWYQKSVEKDKTYGLSEKIFV--TCDSLKRMWRNAHPQTVSFWYDIEDAV 539

Query: 529 EQTIEN-GKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVY 570
           +Q I++ G A   RK      + +++DK  L + LPSGRSL Y
Sbjct: 540 KQAIQSPGIAFKCRK------LSVRRDKGWLRICLPSGRSLCY 576


>gi|225220079|ref|YP_002720046.1| DNA polymerase I [Enterobacteria phage SSL-2009a]
 gi|224986020|gb|ACN74584.1| DNA polymerase I [Enterobacteria phage SSL-2009a]
          Length = 763

 Score =  364 bits (934), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 252/761 (33%), Positives = 364/761 (47%), Gaps = 93/761 (12%)

Query: 4   LFIDFETRSPIDLTKCGICKYAEDVC--VILFAFGFDDHPVELWDCVHDPVMPQVLKEAL 61
           LF+D ET S +DL K G   YAE     +++  +  D+  V+ WDC   P MP+ L++AL
Sbjct: 7   LFLDTETFSGVDLKKVGAYAYAEHPTTEIMICTYAIDEGRVQTWDCTESPTMPRELRKAL 66

Query: 62  ENTD----VTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALK 117
                     ++A+   F+R V++  + +D+P+ +   T+++A  + LP +L    + L 
Sbjct: 67  RRVSRKKAKIVMANGLLFDRLVIREKWGIDLPVCQIEDTMIMAFRHALPGSLDMQCQVLG 126

Query: 118 LSSQ--KMEEGKELIARFCKGETHECLYDR-NKPNHREAWRLFGEYCKGDVTVTREIFKR 174
           + ++  K + GK LI RFCK         R  +  H E W  F  Y   D+   RE++ R
Sbjct: 127 VDAEHAKDKAGKALIKRFCKPTPKTYKIRRYTRETHPEEWAKFLRYAALDIIAMREVYWR 186

Query: 175 LEPLSS--KEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSS 232
           +    +  KE E+  +DQ INDRG+ VDV LA    + V   + +L +E      G ++ 
Sbjct: 187 IPDWGNTPKEDEILLIDQLINDRGFYVDVDLARAAIKAVQAHKEELKEEAWERFGGKLTG 246

Query: 233 SRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLN 292
           +  L  L+    L     + +  ++T   +L  +     +   +   R+ AS +A  K N
Sbjct: 247 NDFLPALRD---LAPAFTIHNAQKSTLNDLLE-DPDFPDEGKVLIEMRLGASSTASTKYN 302

Query: 293 TLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPS------------------- 333
            LV  +++DGR RG LQ+ GA RT RW+G  F PQNL R                     
Sbjct: 303 PLVNGLSADGRRRGCLQYGGAKRTLRWAGKGFQPQNLARGEYSDDHEGKIKRREGESDVA 362

Query: 334 ---RSHEELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLA 390
              RSH   + I + L  +     D  ++ +  VR C+I ++GKK VVAD + +E R LA
Sbjct: 363 FWVRSHMLTNGINSLLRGTAHWAYDISKLTASTVRGCIIPAKGKKFVVADYSNVEGRGLA 422

Query: 391 WMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVT---KDQRAIGKVMELALGYQGGAKA 447
           W+AGE+  L  F+ G D+Y  T  + F + P  +    KD R IGK  EL LGY GG  A
Sbjct: 423 WIAGEKTALMVFKAGRDIYCETAGKMFGLDPEYIKANRKDLRQIGKACELGLGYGGGVAA 482

Query: 448 FQKMASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENH----PEHAIED------- 496
           F + A   GL+L   A ++K       W  A+    + + N     P+   +D       
Sbjct: 483 FLQFAKNLGLDLYAMAEVMKGTFPDHIWAAAKRGYEYARINEAKRPPKPGKKDERPTYIL 542

Query: 497 -LFIGTACERVKKAWRQKHSRVSELWNELHQAFEQTIEN-GKA----------------I 538
              +   C+ +K+ WR+ H +    W EL  A    I N GKA                I
Sbjct: 543 PKNVWLTCDAIKRMWRESHPKTVAFWAELEDAVLCAIRNPGKAYWAGANVRPDGKKALKI 602

Query: 539 IARKRRDVPLVYMKKDKNN-----LILMLPSGRSLVY------------RDVGNNRSYL- 580
           +  K +  P    ++D  N     L + LPSGR + Y             D G  R+   
Sbjct: 603 VRTKAKHDPTFDEERDDPNAAGWWLKIELPSGRIMSYPGIALSVTTEIDEDTGKKRTSTR 662

Query: 581 ------NTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVC 634
                 N TTRQ   +YTYGGKLTENIVQA+ RDILA  M     AGY+IVL+VHDE++ 
Sbjct: 663 IKYQGENQTTRQWGFQYTYGGKLTENIVQALCRDILAWSMPGVEAAGYEIVLSVHDELIT 722

Query: 635 ETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           E PDTD++    L  LM   P WAKG PL AEG    RYRK
Sbjct: 723 EVPDTDDYTTEELCALMCDLPVWAKGFPLAAEGDIMYRYRK 763


>gi|48697222|ref|YP_024952.1| putative DNA polymerase protein [Burkholderia phage BcepC6B]
 gi|47779028|gb|AAT38391.1| putative DNA polymerase protein [Burkholderia phage BcepC6B]
          Length = 681

 Score =  360 bits (923), Expect = 5e-97,   Method: Compositional matrix adjust.
 Identities = 240/698 (34%), Positives = 358/698 (51%), Gaps = 71/698 (10%)

Query: 31  ILFAFGFDDHPVELWDCVHDPVMPQVLKEALENTDVTIVAHNSYFERTVLKAC---FNLD 87
           +++ +  DD PV  WD      MP  L EA++  D     +   F+R VLK         
Sbjct: 1   MIWTWAIDDGPVGTWDVTTGAPMPVELDEAIDAADEYWWQNGGMFDRVVLKHAAPEIYAR 60

Query: 88  IPIHRWICTLVLARSNGLPSALKAVGEALKLSSQ--KMEEGKELIARFCKGE-THECLYD 144
           +P H+W  T+V A ++GLP  L  + E   + +   K +EG +LI  FCK    +  L  
Sbjct: 61  MPEHKWRDTMVQAYAHGLPGKLALLCEIFNIPTDQAKDKEGAQLIQLFCKPRPANSGLRR 120

Query: 145 RNKPNHREAWRLFGEYCKGDVTVTREIFKRLE----PLSSKEQELWYLDQTINDRGYCVD 200
             +  H E W  F  Y   D+T  R + K +     P +  E  LW+ DQ IN RG  +D
Sbjct: 121 ATRETHPEQWAKFLTYAGADITAERAVHKAMPRWNYPNNVTELALWHQDQRINMRGMQMD 180

Query: 201 VALAHTLNQIVDVERTKLDQELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQ 260
           V LA    + +D  + +L      LT G V+ +   +KL   L  E  + L D+ ++T +
Sbjct: 181 VELAEAAVRAIDRAQKELAARTVELTDGEVAKATQRDKLLAHLLAEYEVDLPDMKKSTLE 240

Query: 261 RVLSSNKKLTPQAI-QVFNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRW 319
           R +  N    P A+ ++   R+ A+ ++  K  TL+  +++DGRLRG +QF GA RTGR 
Sbjct: 241 RRI--NDPDLPDALRELLAIRLEATMTSSSKYKTLLRGVSADGRLRGLMQFCGAQRTGRV 298

Query: 320 SGCVFPPQNLPRPSRSHEELDQIITHLPTSITSDPDP----------------------- 356
           +  +F P N+PRP     ++  ++  L  +  SD D                        
Sbjct: 299 AHRLFQPGNMPRP-----DVGLMVGELGVAKFSDGDAERYTELGIGALKTGCADLVFENV 353

Query: 357 LQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFE-----TGEDLYVT 411
           + + ++ VR  ++A +GK+L V+DL+ IE R  AW+AGE+WKL+AF       G DLY  
Sbjct: 354 IGLTANVVRGTIVAPDGKRLYVSDLSNIEGRDAAWLAGEKWKLQAFRDFDAGIGADLYKL 413

Query: 412 TYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNT-----FAHLV 466
            YAR+F VA   V K  R +GKVMELAL Y+GG  AF     T  ++L++     FA L 
Sbjct: 414 AYARAFGVAVEAVDKYMRQLGKVMELALAYEGGVGAFVTFTMTYKMDLDSIRAAVFAALD 473

Query: 467 KTNSAPEEWEDAENFCRWMQENHPEHAI-EDLFIGTACERVKKAWRQKHSRVSELWNELH 525
             +  PE   +A     W  +      + +D+FI  AC+ +K+ WR+ H + S  W EL 
Sbjct: 474 TVD--PEIVREARGMWEWAVKKRRTLGLPQDVFI--ACDILKRLWRRAHPQTSSYWPELR 529

Query: 526 QAFEQTIEN-GKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVY-----RDVGNNRSY 579
            A    I + GK + AR+      V +++D   L + LPS R L Y      D G   SY
Sbjct: 530 DAAILAISSPGKTVHARR------VILRRDGEWLRVQLPSKRQLCYLAPRVSDDGEI-SY 582

Query: 580 L--NTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETP 637
           +  N  TR+  R  TYGGK+ EN+ QAV+RD+L         AGYDIVL++HDE++ E P
Sbjct: 583 MGVNQYTRKWQRTKTYGGKIFENLCQAVARDVLFYNAPAVEAAGYDIVLSIHDELITEAP 642

Query: 638 DTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           D D+++A  L  L+ + P+WA+G+PL A G+ + RY+K
Sbjct: 643 DADDYSADELSSLIATAPAWAEGMPLAAAGFSAYRYKK 680


>gi|282547321|gb|ADA82378.1| putative DNA polymerase [Escherichia phage K1ind1]
          Length = 698

 Score =  357 bits (917), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 244/695 (35%), Positives = 344/695 (49%), Gaps = 57/695 (8%)

Query: 34  AFGFDDHPVELWDCVHDPVMPQVLKEALE-----NTDVTIVAHN-SYFERTVLKACFNLD 87
           A+ FDD PV++WDC +   MP  L  AL      N+ + +V HN S F+R ++K C+  D
Sbjct: 8   AYAFDDEPVQVWDCTNGSDMPGDLHRALRRLVKPNSRIKMVWHNGSMFDRLIMKHCWGFD 67

Query: 88  IPIHRWICTLVLARSNGLPSALKAVGEALKLSSQ--KMEEGKELIARFCKGETHECLYDR 145
           IP+   I T++ A  + LP +L A+ E L +S+   K + GK LI RF K         R
Sbjct: 68  IPVSNTIDTMIWAFRHALPGSLDALCEVLGVSADNAKDKRGKALIQRFSKPTPKNYKIRR 127

Query: 146 -NKPNHREAWRLFGEYCKGDVTVTREIFKRLEPLSSKEQE--LWYLDQTINDRGYCVDVA 202
                H + W LF +Y   D+T  RE+F +L    + E E  +  LDQ INDRG+ VDVA
Sbjct: 128 YTAETHPDEWALFIKYAVSDITAMREVFHKLPRWGNSEFEDRVLELDQLINDRGFKVDVA 187

Query: 203 LAHTLNQIVDVERTKLDQELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRV 262
           LA    + V+  + +L +E +    G ++    L  L+    L     + +  ++T   +
Sbjct: 188 LAEAAIEAVEKHKAQLQEEAQRKYGGSLTGKDFLPILRE---LAPAHRIHNAQKSTLNDL 244

Query: 263 LSSNKKLTPQAIQVFNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGC 322
           L+ +      A  +   R+ A+ +A  K N L+   +SD R RG +Q+ GA RT R++G 
Sbjct: 245 LADDDLPD-DASAIIEMRLGAASTASTKYNPLLLGRSSDDRRRGCIQYGGAKRTLRFAGK 303

Query: 323 VFPPQNLPRPSRSHEELDQIITHLPTSITSDP-DPLQIISDCVRSCVIASEGKKLVVADL 381
            F PQNL R     +ELD+ I+ L         D  ++ +  VRSC+I   G K VVAD 
Sbjct: 304 GFQPQNLARGYYHDDELDKGISALLKGRAHRRFDVAKLTASTVRSCIIPETGHKFVVADY 363

Query: 382 AGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTK---DQRAIGKVMELA 438
           + +E R LAW+AGE+  L  F  G D+Y  T  + F + P  + K   D R IGK  EL 
Sbjct: 364 SNVEGRGLAWLAGEETALDTFRAGLDIYCVTAGKMFGMEPDYIKKERKDLRQIGKACELG 423

Query: 439 LGYQGGAKAFQKMASTTGLNLNTFA---------HLVKTNSAPEEW---EDAENFCRWMQ 486
           LGY GG  AF + A   GL+L   A         H+    +   EW   ++A+   R  +
Sbjct: 424 LGYAGGVGAFVQFAKNLGLDLVDMAKTMDGTFPDHIWAATARGYEWARIQEAKRPPRPGE 483

Query: 487 ENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELHQAFEQTIEN-GKAIIARKRRD 545
           ++     I D  +   C+ +K+ WR+ H      W ++  A    I N GK   A  R  
Sbjct: 484 KDDRPSYILDKKVWRTCDAIKRMWRESHPETVAFWRDIEDAAMAAIRNPGKEFTAGPRGV 543

Query: 546 VPLVYMKKDKNN-------LILMLPSGRSLVYRDVGNNRSYL------------------ 580
                ++ D N        L + LPSGR + Y  VG + S                    
Sbjct: 544 KFSRNVETDNNGNKVAGWWLRMTLPSGRVMSYPGVGLSVSKETDEDGKVSTNVRIKYQGE 603

Query: 581 NTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETPDTD 640
           N  TRQ   +YTY GKL EN  QA+ RD+LA  ++N    GY IVL VHDEI+CETPD  
Sbjct: 604 NQLTRQWGFQYTYSGKLVENCTQALCRDLLANALLNVEANGYPIVLHVHDEIICETPDLP 663

Query: 641 EFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           E+N + L  LM   P WA+G PL AEG E KRY K
Sbjct: 664 EYNVAELERLMCELPEWAEGFPLVAEGAEMKRYAK 698


>gi|211731861|gb|ACJ10159.1| DNA polymerase [Bacteriophage APSE-3]
          Length = 502

 Score =  357 bits (917), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 210/512 (41%), Positives = 296/512 (57%), Gaps = 31/512 (6%)

Query: 182 EQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSSSRCLEKLKT 241
           E ELW LDQ IN RG C+DV LA +    V+ E+ +L    + LT   V ++   + L  
Sbjct: 3   ETELWQLDQKINRRGMCMDVELAKSALTAVENEQNRLSTVTQQLTDNAVQNATQRDALLQ 62

Query: 242 WLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLNTLVEAMNSD 301
            +    G+ L D+  +T QR ++ +  + P   ++ + R+++  ++  K   L++++++D
Sbjct: 63  HIASAFGITLPDMQASTLQRRIN-DPDIPPDLRELLSVRLQSCTTSTSKYKALLKSVSAD 121

Query: 302 GRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTS---ITSDPDPLQ 358
           GRLRGT QF GASRTGRW+G VF P NLPRP+     +D  I  L      +  D D +Q
Sbjct: 122 GRLRGTKQFCGASRTGRWAGRVFQPDNLPRPTLDPNTIDNGIEALKAGCAELICD-DIMQ 180

Query: 359 IISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFE-----TGEDLYVTTY 413
           + S  +R C+IA  GKKLV++DL+ IE R+LAW+AGE WK+ AF       G+DLY   Y
Sbjct: 181 LTSSALRGCIIAPPGKKLVISDLSNIEGRMLAWLAGENWKVNAFSEFDNGKGDDLYKLAY 240

Query: 414 ARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVKTNSAPE 473
           AR+FN+ P  VTK+QR IGKVMEL LGY GG  AF   A   GL+L+  A     N  P 
Sbjct: 241 ARAFNLLPEDVTKEQRQIGKVMELGLGYGGGVAAFLTFALAYGLDLDELAEAALPNILPG 300

Query: 474 EWEDAENFCRWMQ---ENHPEHAI-EDLFIGTACERVKKAWRQKHSRVSELWNELHQAFE 529
              +A    RW Q   E    + + E +F+   C+ +K+ WR  H +    W ++  A +
Sbjct: 301 VKREA---MRWYQKSVETDKTYGLSEKIFV--TCDALKRMWRNAHPQTVSFWYDIEDAVK 355

Query: 530 QTIEN-GKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVY---RDVGNNRSYLNTT-- 583
           Q I++ G A   RK      + +++DK  L + LPSGRSL Y   R      +Y+ T   
Sbjct: 356 QAIQSPGIAFKCRK------LSVRRDKGWLRICLPSGRSLCYPSARTENGQITYMGTNPY 409

Query: 584 TRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETPDTDEFN 643
           +R+  R  TYGGK+ ENI Q+ +RD+LA  M    KAGY+IVLTVHDEI+ E PDT +F+
Sbjct: 410 SRKWERLKTYGGKIIENICQSTARDVLAYNMPPIEKAGYEIVLTVHDEIISEAPDTPQFS 469

Query: 644 ASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           A  L  L++ N  WA  LPL A G+E+ RYRK
Sbjct: 470 AEGLSKLLSFNSDWAWDLPLSANGFETYRYRK 501


>gi|295096879|emb|CBK85969.1| DNA polymerase I-3'-5' exonuclease and polymerase domains
           [Enterobacter cloacae subsp. cloacae NCTC 9394]
          Length = 591

 Score =  356 bits (913), Expect = 8e-96,   Method: Compositional matrix adjust.
 Identities = 216/546 (39%), Positives = 304/546 (55%), Gaps = 24/546 (4%)

Query: 4   LFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHDPVMPQVLKEALEN 63
           L+ D ET   I +T  G   YAE V V+LFA+   D PV +WD      +P  L++A+ +
Sbjct: 5   LWGDLETYCEIPITN-GTHAYAEGVEVMLFAWAIGDEPVSVWDLTAGEPIPGRLQKAIAD 63

Query: 64  TDVTIVAHNSYFERTVLK-ACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKLSSQK 122
            D  +  HNS+F+RTVL+ A   L   + RW  T+V A ++GLP AL A+ E L +   K
Sbjct: 64  PDTLLYFHNSHFDRTVLRHAIPRLAPDVTRWRDTMVQALAHGLPGALGALCEVLGVPQDK 123

Query: 123 ME--EGKELIARFCKGETHECLYDR-NKPNHREAWRLFGEYCKGDVTVTREIFKRLEPLS 179
            +  EGK LI  FCK         R     H E WR F  Y   D+   RE+ KRL   +
Sbjct: 124 AKDKEGKALIQLFCKPRPKNSKLRRATSKTHPEEWRRFVAYAGLDIEAMREVHKRLPKWN 183

Query: 180 SKEQEL--WYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSSSRCLE 237
            K  EL  W+ DQ INDRG C+DV LA    + VD E+ +L +  + +T G V ++   +
Sbjct: 184 YKGTELALWHRDQQINDRGVCMDVQLAQAAIEAVDQEQKRLAKRTQVMTDGEVQAATQRD 243

Query: 238 KLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLNTLVEA 297
            L   +    G+ L D+  +T +R ++ +  L     ++   R++AS ++  K  +L++ 
Sbjct: 244 ALIKHIVESYGVELPDMQRSTLERRMA-DPDLPSAVKELLAIRLQASTTSTSKYKSLMKG 302

Query: 298 MNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITS--DPD 355
           ++SDGRLRGTLQF GASRTGRW+G +F PQNLPRPS   +++D+ I  L          +
Sbjct: 303 VSSDGRLRGTLQFCGASRTGRWAGRLFQPQNLPRPSLEQDQIDEGIEALKAGCADLLFDN 362

Query: 356 PLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFE-----TGEDLYV 410
            +++ S  +R C++A EGKKLVV+DL+ IE R LAW+AGEQWKL AF      TG DLY 
Sbjct: 363 IMELTSSALRGCIMAPEGKKLVVSDLSNIEGRKLAWLAGEQWKLHAFREYDEGTGPDLYK 422

Query: 411 TTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVKTNS 470
             YAR+FN++P  V K QR IGKVMEL LG+ GG  AF   A   GL+L+  A+    N 
Sbjct: 423 LAYARAFNISPDDVDKYQRQIGKVMELGLGFGGGVAAFLTFALVYGLDLDELANAALPNI 482

Query: 471 APEEWEDAENFCRWMQENHPEHAI----EDLFIGTACERVKKAWRQKHSRVSELWNELHQ 526
             +   +A+N   W  E+    A     E +FI  AC+ +K+ WR+ H    + W EL +
Sbjct: 483 PRDVIREAKN---WYDESVKRKATYGLSERVFI--ACDSLKRLWRRAHPATCDFWYELER 537

Query: 527 AFEQTI 532
                I
Sbjct: 538 TVRAAI 543


>gi|226949733|ref|YP_002804824.1| DNA polymerase [Clostridium botulinum A2 str. Kyoto]
 gi|226841086|gb|ACO83752.1| DNA polymerase [Clostridium botulinum A2 str. Kyoto]
          Length = 655

 Score =  355 bits (912), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 250/718 (34%), Positives = 352/718 (49%), Gaps = 107/718 (14%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M TL ID ET S ID+   G  KY E  D  ++LFA+ F+D PV++ D      +PQ + 
Sbjct: 1   MTTLAIDVETYSSIDIKTSGAYKYCEAPDFEILLFAYAFNDEPVQIVDFTQHEALPQRVI 60

Query: 59  EALENTDVTIVAHNSYFERTVLK-ACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALK 117
           +AL + DV   A N+ FER+ +K    +L  P  +W CT++ A + GLPS+L  VG+ALK
Sbjct: 61  DALYDPDVIKTAFNANFERSAIKFGVSSLPCPPGQWECTMIKALTLGLPSSLDMVGKALK 120

Query: 118 L--SSQKMEEGKELIARFCKGETHECLYD---RNKPNH-REAWRLFGEYCKGDVTVTREI 171
           L    QKM+EGK LI  FCK        D   RN P H  E W  F EYCK DV V REI
Sbjct: 121 LEEDKQKMKEGKALIQYFCKPCKPTKTNDKRTRNLPKHDMEKWETFKEYCKRDVEVEREI 180

Query: 172 FKRLEPLSSK--EQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGL 229
              L    +K  EQ+LW LDQ INDRG   D+ L   + Q ++ + T   + L      L
Sbjct: 181 RNLLNRYETKAEEQKLWQLDQHINDRGIDTDLIL---IKQAIECD-TNYTERLTKAAIKL 236

Query: 230 --VSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLT-PQAIQVFNNRMRASRS 286
             + +     ++K W+    G  ++ LT+T+   ++   K L   + I++   R   +++
Sbjct: 237 TGLENPNSPTQIKKWIGERLGREVKSLTKTSIPGLIEEAKDLNKSEVIKMLELRQLMAKT 296

Query: 287 AVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPR---PSRSH------- 336
           ++ K +T+  A   DGR+RG LQF GA+RTGRW+G +   QNLP+   P   +       
Sbjct: 297 SIKKYDTMQNARCKDGRVRGLLQFYGANRTGRWAGRLVQVQNLPQNHLPDLDNARNFVRE 356

Query: 337 ---EELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMA 393
              EE++ +   +P ++          S  +R+  I  EG + +V+D + IEARV+AW A
Sbjct: 357 GKFEEVEFLFDSVPDTL----------SQLIRTAFIPREGNRFIVSDFSAIEARVIAWFA 406

Query: 394 GEQWKLKAFETGEDLYVTTYARSFNVAPAQVTK--DQRAIGKVMELALGYQGGAKAFQKM 451
           GEQW+L  F T   +Y  + ++ F V    + K  + R  GK+ ELALGY G   A   M
Sbjct: 407 GEQWRLDVFSTHGKIYEASASQMFKVPIESIKKGSELRQKGKIAELALGYGGSVGALSSM 466

Query: 452 ASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWR 511
                +                                PE  +  L          K+WR
Sbjct: 467 DRKKSI--------------------------------PEEELPGLV---------KSWR 485

Query: 512 QKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKK---DKNNLILMLPSGRSL 568
             +  +++ W ++ +A ++ I        R+R  V L Y  K   D   L + LPSGR L
Sbjct: 486 NANPNITKFWWDVDKAAKKAI--------RERTTVNLQYGLKFIYDPGVLFIQLPSGRKL 537

Query: 569 VY---------RDVGNNRSY--LNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNA 617
            Y            G+  +Y  +  T++Q  R  TYG KL ENIVQA SRD L E M   
Sbjct: 538 SYIRPKIEPHETFSGDKITYEGMEQTSKQWKRIDTYGPKLVENIVQATSRDCLREAMFRV 597

Query: 618 TKAGYDIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
            K GYDIV+ VHDE+V + P  D      +  LM     WA GLPLKA+GYE   Y K
Sbjct: 598 NKEGYDIVMHVHDEVVLDIP-KDRATVKEINELMGQPIKWAPGLPLKADGYECNYYMK 654


>gi|205375254|ref|ZP_03228044.1| DNA-directed DNA polymerase [Bacillus coahuilensis m4-4]
          Length = 649

 Score =  352 bits (902), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 242/706 (34%), Positives = 356/706 (50%), Gaps = 89/706 (12%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M TL ID ET S +DL KCG+  Y+E  D  ++LFA+  DD  VE+ D      +P  + 
Sbjct: 1   MKTLIIDIETYSKVDLVKCGVYAYSESADFEILLFAYAVDDEEVEIVDLASGEKIPANIL 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKL 118
           +A+ +  V   A+N+ FERT L   F + +P  +W CT V A   GLP  L  V + LKL
Sbjct: 61  KAMIDPTVIKTAYNANFERTCLAKHFQIPMPPEQWRCTSVHALMLGLPGYLDGVAKCLKL 120

Query: 119 SSQKMEEGKELIARF---CKGETHECLYDRNKPNHREA-WRLFGEYCKGDVTVTREIFKR 174
             QKM+EGK LI  F   CK         RN P H  A W  F +YCK DV V REI K+
Sbjct: 121 QGQKMKEGKALIRYFSIPCKPTKVNGGRTRNLPKHDPARWDTFKDYCKQDVEVEREIRKK 180

Query: 175 LE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQEL-ESLTYGLVS 231
           LE  PL + EQELW LDQ IND G  +D  L   +N  +  ++   D+ + E++    + 
Sbjct: 181 LEVFPLPTMEQELWELDQKINDEGVVIDTNL---VNHAIKADKAFQDELIEEAVRLTGLE 237

Query: 232 SSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKL 291
           +     +LK WL L+ GL ++ L +   + ++S  +   P+  ++   R   S+++V K 
Sbjct: 238 NPNSPAQLKGWL-LKQGLEVDSLAKKNVEALMSEVE--NPEVKRLLELRRAMSKTSVKKY 294

Query: 292 NTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITH------ 345
             +  ++ SD R+RG LQF GASRTGRW+G +    NLPR S    ++ + +        
Sbjct: 295 EAMERSVGSDQRVRGLLQFYGASRTGRWAGRLVQIHNLPRNSLKDLQVARELLESGKYEA 354

Query: 346 LPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETG 405
           L     S  D   ++S  +R+  I S+G + VVAD + IEARV+AW+AGE+W++  F++ 
Sbjct: 355 LEVLFESVSD---VLSQLIRTAFIPSKGHRFVVADFSAIEARVIAWLAGERWRMDVFQSH 411

Query: 406 EDLYVTTYARSFNVAPAQVTKDQ--RAIGKVMELALGYQGGAKAFQKMAS-TTGLNLNTF 462
             +Y  + A+ F V    + K    R  GK+ ELALGY G   A  +M +   GL  +  
Sbjct: 412 GKIYEASAAQMFKVPIETIDKGSPLRQKGKIAELALGYGGSKGALMQMGALEMGLTEDEL 471

Query: 463 AHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWN 522
             LV                                          AWR+ + ++ +LW 
Sbjct: 472 PELV-----------------------------------------SAWREANPKIVKLWW 490

Query: 523 ELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVY---------RDV 573
            +  A  + ++  KA++ + +  +   Y    K  L + LPSGRSL Y         R  
Sbjct: 491 GIEAAAIKAVKE-KAVV-KMQHGLTFHYT---KGILFITLPSGRSLAYVRPKIGIDERFG 545

Query: 574 GNNRSYLNT--TTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDE 631
               +Y  T   ++Q  R  TYGGKLTENI+QA++RD LA  M+   +AGY I   VHDE
Sbjct: 546 KEQLTYEGTEQGSKQWGRIPTYGGKLTENIIQAIARDCLAVSMLRLDEAGYRINFHVHDE 605

Query: 632 IVCETPDTDEFNASM--LYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           ++ + P       SM  + ++M  +  WA GLPL A+ +E+  Y+K
Sbjct: 606 VILDVPIA---TGSMEEVENIMGQSIDWAPGLPLGADSFETFYYKK 648


>gi|332800352|ref|YP_004461851.1| DNA-directed DNA polymerase [Tepidanaerobacter sp. Re1]
 gi|332698087|gb|AEE92544.1| DNA-directed DNA polymerase [Tepidanaerobacter sp. Re1]
          Length = 652

 Score =  351 bits (901), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 242/705 (34%), Positives = 350/705 (49%), Gaps = 84/705 (11%)

Query: 1   MATLFIDFETRSPIDLTKCGICKY--AEDVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M  L ID ET S +DLTKCG+  Y  AED  ++LF + F++ PVE+ D      +P  + 
Sbjct: 1   MTILSIDIETYSSVDLTKCGVYAYTQAEDFEILLFGYAFNNDPVEVIDLASGEQIPDEVT 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKL 118
            A+ ++ V   A N+ FERT L    N  +P   W C+   A + GLP  L  V + L L
Sbjct: 61  NAITDSAVIKTAFNANFERTCLAKYLNKPMPPEEWRCSQAHALTLGLPLNLAGVAKCLGL 120

Query: 119 SSQKMEEGKELIARF---CKGETHECLYDRNKPNH-REAWRLFGEYCKGDVTVTREIFKR 174
           + QKM EGK LI  F   CK         RN P+H RE W  F  YCK DV V R I KR
Sbjct: 121 ADQKMSEGKALIRYFSIPCKPTKANGGRTRNLPHHDREKWETFKAYCKQDVVVERSIRKR 180

Query: 175 LE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSS 232
           LE  P++ KE +LW LDQ IND G  VD  L         + + +L  E   LT GL  +
Sbjct: 181 LENYPMTDKELKLWSLDQKINDYGVRVDRQLVENAICCDGIHQKELMAEAIDLT-GL-EN 238

Query: 233 SRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLN 292
                +LKTWL     + ++ L++   + +L  NK   P   +V   R   S+++V K  
Sbjct: 239 PNSPAQLKTWLKGNHNIQVDSLSKANVEELL--NKINHPTVTRVLELRQDMSKTSVRKYE 296

Query: 293 TLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQII------THL 346
            +  AM  DGR+RG LQ+ GA+RTGRW+G +   QNLPR +    +L + +        L
Sbjct: 297 AMDRAMGGDGRIRGLLQYYGANRTGRWAGRLVQVQNLPRNNMKDLDLARKLLLAGDYESL 356

Query: 347 PTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGE 406
                S PD   ++S  +R+  + S G + +++D + IEARV+AW+AGE+W +  F+   
Sbjct: 357 ELLFDSVPD---VLSQLIRTAFVPSPGHRFIISDFSAIEARVIAWLAGEKWVVDTFKGHG 413

Query: 407 DLYVTTYARSFNVAPAQVTKDQ-----RAIGKVMELALGYQGGAKAFQKMASTTGLNLNT 461
            +Y  T ++ F V    + K       R  GKV  LA GYQG   A + M +   LN+  
Sbjct: 414 KIYEMTASKMFGVPMELIVKGNPEYELRQKGKVAVLACGYQGSVGALKAMGA---LNMG- 469

Query: 462 FAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELW 521
               +K +  P                                 +  AWR+ +  + +LW
Sbjct: 470 ----LKEDELPA--------------------------------IVAAWRESNPNIVKLW 493

Query: 522 NELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVY------RDVGN 575
            ++  A  + +++  +I  +      L +  K    L + LPSGR+L Y       D   
Sbjct: 494 WDVEDAAIRAVKDRTSITMQ----YGLKFYYK-SGVLFIRLPSGRNLAYVKPRIELDTRF 548

Query: 576 NRSYLNTTTRQLTREY----TYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDE 631
           N+  L      L  ++    TYGGKLTENI+QA++RD LAE ++   KAGY I   VHDE
Sbjct: 549 NKDKLTYEGIMLGNKWARIDTYGGKLTENIIQAIARDCLAESLLRLDKAGYKIAFHVHDE 608

Query: 632 IVCETPDTDEFNA-SMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           +V + P    F +   +  +M+ + +WAKGLPL+AEG+E+  Y K
Sbjct: 609 VVLDVPQG--FGSLKEVEEIMSQDINWAKGLPLRAEGFETNYYMK 651


>gi|254975142|ref|ZP_05271614.1| DNA polymerase [Clostridium difficile QCD-66c26]
 gi|255314269|ref|ZP_05355852.1| DNA polymerase [Clostridium difficile QCD-76w55]
 gi|255516949|ref|ZP_05384625.1| DNA polymerase [Clostridium difficile QCD-97b34]
 gi|255650051|ref|ZP_05396953.1| DNA polymerase [Clostridium difficile QCD-37x79]
 gi|260686788|ref|YP_003217921.1| dna-directed dna polymerase i [Clostridium difficile R20291]
 gi|306519586|ref|ZP_07405933.1| dna-directed dna polymerase i [Clostridium difficile QCD-32g58]
 gi|260212804|emb|CBE03971.1| dna-directed dna polymerase i [Clostridium difficile R20291]
          Length = 652

 Score =  350 bits (899), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 246/719 (34%), Positives = 359/719 (49%), Gaps = 112/719 (15%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M TL ID ET S +D+ K G+ +Y +  +  ++LFA+ FD+  V++ D V+D  +P+ + 
Sbjct: 1   MRTLSIDIETYSDLDIKKVGVYRYVDSANFEILLFAYAFDNEEVKVIDLVNDEELPKEVI 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKL 118
           EAL +  V   A N+ FERT +    N+++  + W CT++ A + GLP +L +V +ALK 
Sbjct: 61  EALNDNKVIKSAFNANFERTAISKFLNINLKPNEWSCTMIKALTLGLPGSLDSVSKALKF 120

Query: 119 S--SQKMEEGKELIARFC---------KGETHECLYDRNKPNH-REAWRLFGEYCKGDVT 166
           +   QKM+EGK LI  FC         KG T      RN P H  E W  F EYCK DV 
Sbjct: 121 NEDKQKMKEGKALIQYFCKPCKATKVNKGRT------RNLPIHDMEKWNKFKEYCKQDVV 174

Query: 167 VTREIFKRLEPLSSKEQE--LWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELES 224
           V REI  +L    + E+E  LWYLDQ IND G  VD  L     +       KL +E   
Sbjct: 175 VEREIRNKLSKYKTTEREIKLWYLDQRINDTGIKVDTELIENAIECDKRYTEKLTKEAIK 234

Query: 225 LTYGLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRAS 284
           +T GL ++     +LK WL  + G  +  LT+ +   +L          +++   R   S
Sbjct: 235 IT-GL-NNPNSPAQLKKWLSDKVGFEITSLTKESIPEILKQVD--DENVVRILELRKLMS 290

Query: 285 RSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSH-EELD--- 340
           ++++ K   +  A  +D R+RG LQF GA+RTGRW+G +   QNLP   ++H E+LD   
Sbjct: 291 KTSIKKYEAMKLAKGNDNRVRGLLQFYGANRTGRWAGRLVQVQNLP---QNHIEDLDLAR 347

Query: 341 --------QIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWM 392
                    +I  L  S+   PD   ++S  +R+  I SEG + +V+D + IEARV+AW 
Sbjct: 348 NLLKEGDFDLIELLYDSV---PD---VLSQLIRTAFIPSEGHRFIVSDFSAIEARVIAWF 401

Query: 393 AGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQ--RAIGKVMELALGYQGGAKAFQK 450
           AGE+W+L  F +   +Y  + +  F V    + K    R  GK+ ELALGY G   A   
Sbjct: 402 AGEKWRLDVFNSHGKIYEASASHMFKVPIESIKKGDPLRQKGKISELALGYGGSIGALTS 461

Query: 451 MAST-TGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKA 509
           M +   GL+      LV T                                         
Sbjct: 462 MGAIKMGLDEEELQPLVTT----------------------------------------- 480

Query: 510 WRQKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLV 569
           WR  +  +++ W ++ +A ++ I++    I + +  +  +Y   +   L + LPSGR L 
Sbjct: 481 WRNANPNITKFWWDVDKAAKKAIKD--RTIVKLQHGIKFIY---NPGVLFIELPSGRRLS 535

Query: 570 YRD---------VGNNRSY--LNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNAT 618
           Y            G+  +Y  +  T++Q  R  TYG KL ENIVQA +RD L E M N T
Sbjct: 536 YLRPKIEPHTTFSGDKITYEGMEQTSKQWKRIDTYGPKLVENIVQATARDCLREAMFNVT 595

Query: 619 KAGYDIVLTVHDEIVCETPDTDEFNASM--LYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
            AGY IV+ VHDE+V    D D+   S+  +  +M    SWAKGLPLKA+GYE   Y+K
Sbjct: 596 DAGYSIVMHVHDELVI---DVDKKGGSLEEVNSIMGKEISWAKGLPLKADGYECDYYKK 651


>gi|153938384|ref|YP_001391676.1| DNA-directed DNA polymerase I [Clostridium botulinum F str.
           Langeland]
 gi|152934280|gb|ABS39778.1| DNA-directed DNA polymerase I [Clostridium botulinum F str.
           Langeland]
          Length = 658

 Score =  346 bits (888), Expect = 6e-93,   Method: Compositional matrix adjust.
 Identities = 247/711 (34%), Positives = 347/711 (48%), Gaps = 98/711 (13%)

Query: 3   TLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLKEA 60
           TL ID ET S +D+   G  KY E  D  ++LFA+ F+D PV++ D  +   +P  +  A
Sbjct: 7   TLSIDVETYSSMDIKTSGAYKYCESPDFEILLFAYAFNDEPVQIVDLANGEKLPSNVFYA 66

Query: 61  LENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKL-- 118
           L + ++   A N+ FER  +K  +    P  +W CT+V A + GLPS+L  VG+ALK   
Sbjct: 67  LTDPNIIKTAFNANFERNSIKNQYPALCPPEQWECTMVKALTLGLPSSLDMVGKALKFEE 126

Query: 119 SSQKMEEGKELIARF---CKGETHECLYDRNKPNH-REAWRLFGEYCKGDVTVTREIFKR 174
             QKM+EGK LI  F   CK         RN P H  E W  F EYCK DV V REI   
Sbjct: 127 DKQKMKEGKALIQYFCKPCKPTKTNGKRTRNLPEHDMEKWETFKEYCKRDVEVEREIRNL 186

Query: 175 LEPLSSK--EQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGL--V 230
           L    +K  EQ+LW LDQ INDRG   D+ L   + Q ++ + T   + L      L  +
Sbjct: 187 LNRYETKVEEQKLWQLDQHINDRGIGTDLIL---IKQAIECD-TNYTERLTKAAIELTGL 242

Query: 231 SSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLT-PQAIQVFNNRMRASRSAVL 289
            +     ++K W+    G  ++ LT+T+   ++     L   + I++   R   +++++ 
Sbjct: 243 ENPNSPTQIKKWIGERLGREVKSLTKTSIPGLIEEATSLNKSEVIKMLELRQLMAKTSIK 302

Query: 290 KLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSH-EELDQI------ 342
           K +T+  A   DGR+RG LQF GA+RTGRW+G +   QNLP   ++H  +LD        
Sbjct: 303 KYDTMQNARCKDGRVRGLLQFYGANRTGRWAGRLVQVQNLP---QNHLPDLDNARNFVRE 359

Query: 343 --ITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLK 400
                +     S PD L   S  +R+  I  EG + +V+D + IEARV+AW AGEQW+L 
Sbjct: 360 GKFQEVEFLFDSVPDTL---SQLIRTAFIPREGNRFIVSDFSAIEARVIAWFAGEQWRLD 416

Query: 401 AFETGEDLYVTTYARSFNVAPAQVTK--DQRAIGKVMELALGYQGGAKAFQKMASTTGLN 458
            F T   +Y  + ++ F VA   + K  + R  GK+ ELALGY G   A   M     + 
Sbjct: 417 VFSTHGKIYEASASQMFKVAIESIKKGSELRQKGKIAELALGYGGSVGALSSMDRKKSI- 475

Query: 459 LNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVS 518
                                          PE  +  L          K+WR  +  ++
Sbjct: 476 -------------------------------PEEELPGLV---------KSWRNANPNIT 495

Query: 519 ELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKK---DKNNLILMLPSGRSLVY----- 570
           + W ++ +A ++ I        R+R  V L Y  K   D   L + LPSGR L Y     
Sbjct: 496 KFWWDVDKAAKKVI--------RERTTVNLQYGLKFIYDPGVLFIQLPSGRKLSYIRPKI 547

Query: 571 ----RDVGNNRSY--LNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDI 624
                  G+  +Y  +  T++Q  R  TYG KL ENIVQA SRD L E M    KAGYDI
Sbjct: 548 EPHETFSGDKITYEGMEQTSKQWKRIDTYGPKLVENIVQATSRDCLREAMFRVDKAGYDI 607

Query: 625 VLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           V+ VHDE+V + P  D      +  LM     WA GLPLKA+GYE   Y+K
Sbjct: 608 VMHVHDEVVLDIP-KDRATVKEINELMGQPIEWAPGLPLKADGYECNYYQK 657


>gi|303239094|ref|ZP_07325624.1| DNA-directed DNA polymerase [Acetivibrio cellulolyticus CD2]
 gi|302593432|gb|EFL63150.1| DNA-directed DNA polymerase [Acetivibrio cellulolyticus CD2]
          Length = 649

 Score =  345 bits (886), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 238/709 (33%), Positives = 354/709 (49%), Gaps = 95/709 (13%)

Query: 1   MATLFIDFETRSPIDLTKCGICKY--AEDVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M TL ID ET S +DLT CG+  Y  A D  ++LF + +DD PVEL D      +P  + 
Sbjct: 1   MRTLAIDIETFSSVDLTSCGVYTYTAAPDFQILLFGYAWDDDPVELIDLACGERLPDAIV 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKL 118
            A+E+ +V   A N+ FER  L    N  +    W CT + A   GLP  L  VG ALKL
Sbjct: 61  NAIESPEVIKTAFNAGFERICLSKHLNKHLKADSWRCTAIQAAMLGLPLHLDGVGTALKL 120

Query: 119 SSQKMEEGKELIARF---CKGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTREIFKR 174
             QK   GK+LI  F   CK         RN P+H  E W+ F +YC  DV V RE+ ++
Sbjct: 121 KVQKDRAGKDLIRYFSIPCKSTKSNGGRTRNLPHHAPEKWQKFKDYCVRDVEVEREVRRK 180

Query: 175 LE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVE---RTKLDQELESLTYGL 229
           +E  P+  KE +LW LDQ IND G  VD+AL   +NQ V  +    ++L+ E ++LT   
Sbjct: 181 IERYPIPEKELKLWLLDQKINDTGVLVDMAL---VNQAVKCDTQYSSRLEVEAKTLTK-- 235

Query: 230 VSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVL 289
           + +   + +LK WL  E GL +E L++   Q +L+       +  ++   R   ++S++ 
Sbjct: 236 LDNPNSVAQLKEWL-KEQGLEVESLSKQAVQNLLTDADG---EIERLLTLRQEMAKSSIA 291

Query: 290 KLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHL--- 346
           K   +  ++  D R+RG  QF GA+RTGRW+G +F  QNLP+      E+ +++      
Sbjct: 292 KYAAVQRSVCPDSRVRGLFQFYGANRTGRWAGRIFQIQNLPQNHMKDLEIARMLVKQGRF 351

Query: 347 -PTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETG 405
               +  +  P+ ++S+ +R+ +I  +G + +VAD + IEARVLAW+A E W L  F+  
Sbjct: 352 KELELLYESVPI-VLSELIRTVLIPEQGCRFIVADFSAIEARVLAWLANEAWVLDTFKGH 410

Query: 406 EDLYVTTYARSFNVAPAQVTK-----DQRAIGKVMELALGYQGGAKAFQKM-ASTTGLNL 459
             +Y  T +R F V   ++ K     + RA GKV  LA GYQGG  A + M A   GL+ 
Sbjct: 411 GKIYEQTASRMFGVPVEKIAKGNPEYELRAKGKVAVLACGYQGGVNALKAMGADKMGLS- 469

Query: 460 NTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSE 519
                                                    T  + + +AWR  + R+  
Sbjct: 470 ----------------------------------------DTELDDIVRAWRSANQRIVR 489

Query: 520 LWNELHQAFEQTIENGKAIIARKRRD---VPLVYMKKDKNNLILMLPSGRSLVY------ 570
            W ++ +A         A++A + R+   V ++  K +   L + LPSGR L Y      
Sbjct: 490 FWYDVEKA---------AVLAVREREPQRVGILRFKVENGILFITLPSGRRLAYIRPKIE 540

Query: 571 RDVGNNRSYLN----TTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVL 626
           +D+  ++  L        +Q  R+ TYGG+L ENIVQ  +RD LAE M+     GY IV 
Sbjct: 541 KDLRFDKDGLTYEGLGINKQWWRQKTYGGRLVENIVQGAARDCLAEAMLRVDAKGYKIVG 600

Query: 627 TVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
            VHDEI+ E     + +   L  +M     WA GLPL+A+G+E+  Y+K
Sbjct: 601 HVHDEIITEM-RKGQGSLEELCGIMGQEIPWALGLPLRADGFETMFYKK 648


>gi|227496457|ref|ZP_03926741.1| DNA-directed DNA polymerase [Actinomyces urogenitalis DSM 15434]
 gi|226834039|gb|EEH66422.1| DNA-directed DNA polymerase [Actinomyces urogenitalis DSM 15434]
          Length = 651

 Score =  344 bits (883), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 246/700 (35%), Positives = 338/700 (48%), Gaps = 83/700 (11%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAEDVC--VILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M TL ID ET S   L   G+ +YA D    ++LFA+  D   V++ D      +P  + 
Sbjct: 9   MRTLSIDIETFSKASLPSVGVYRYAADESFEILLFAYAVDGGEVQIVDLARGEQIPGDVL 68

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKL 118
           +ALE+  V   A N+ FER  L A     +    W C++V A   G+P  L  V +AL L
Sbjct: 69  DALEDPGVVKSAFNAAFERVCLSAHLGHRLDPEGWRCSMVWASFAGVPLDLAGVAKALHL 128

Query: 119 SSQKMEEGKELIARF---CKGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTREIFKR 174
            ++KM EGK LI  F    K        +RN P H  + W  F  YCK DV V   I KR
Sbjct: 129 ETEKMGEGKNLIRYFSLPAKPTKANGGRERNLPEHAPDDWETFKAYCKRDVEVELAITKR 188

Query: 175 LE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSS 232
           L   P+ ++E + ++ DQ INDRG  +D  LA       +  R    + +  LT   V +
Sbjct: 189 LHAMPMPAREWDNYWDDQRINDRGVRIDADLATAAVDADNTGRASALERMRELTR--VDN 246

Query: 233 SRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLN 292
              + +L  WL  + GL ++ L +      L     L     +V   R   ++S+V K  
Sbjct: 247 PASVTQLLAWLRSQ-GLQIDSLAKADVAAALEG--ALEGDVAEVLALRQEMAKSSVKKYE 303

Query: 293 TLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEEL--DQIITH----L 346
            ++     DGR  G LQF+GA RTGRW+G +   QNLPR S S  E   D + T     L
Sbjct: 304 RMLACRCPDGRAHGLLQFMGAGRTGRWAGRLVQVQNLPRQSISDLEAAADLVRTGHADML 363

Query: 347 PTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGE 406
            T   S P   Q++S+ +R+  +A  G + +VAD + IEAR +AW+AGEQW L  FE G 
Sbjct: 364 ETLWGSAP---QVLSELIRAAFVAEPGSRFLVADYSAIEARTIAWLAGEQWVLDLFEAGG 420

Query: 407 DLYVTTYARSF-NVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTT-GLNLNTFAH 464
           D+Y  T  R F  V        QRA  KV  LA GYQGG  A + M     GL+ +  A 
Sbjct: 421 DIYCETGTRMFRQVVEKHSPLRQRA--KVAVLACGYQGGVGALKTMGGEKLGLSEDEMAD 478

Query: 465 LVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNEL 524
           +V                                          AWR  + ++++LW ++
Sbjct: 479 IV-----------------------------------------AAWRAANPKIAQLWWDI 497

Query: 525 HQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRD--VGNNRSYLNT 582
           + A    I++G A      R V  + +  DK  LI+ LPSGR LVY    +G NR    +
Sbjct: 498 NAAAIAVIKDGGA------RAVGRIRLAHDKGALIITLPSGRPLVYPSPRIGENRFGGES 551

Query: 583 TT-------RQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCE 635
            T       R+  R  TYGGKLTENIVQA +RDILA  +    ++GY +V+ +HDE+V E
Sbjct: 552 ITHMGVGVNRKWGRIETYGGKLTENIVQATARDILAHAIARLERSGYPVVMHIHDEVVTE 611

Query: 636 TPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
            P+    +   L  LM+  P WA GLPL AEG+ES  YRK
Sbjct: 612 VPE-GRGSVEELCALMSQAPPWADGLPLAAEGFESTYYRK 650


>gi|255092532|ref|ZP_05322010.1| DNA polymerase [Clostridium difficile CIP 107932]
 gi|260683192|ref|YP_003214477.1| dna-directed dna polymerase i [Clostridium difficile CD196]
 gi|260209355|emb|CBA62784.1| dna-directed dna polymerase i [Clostridium difficile CD196]
          Length = 652

 Score =  343 bits (879), Expect = 7e-92,   Method: Compositional matrix adjust.
 Identities = 241/718 (33%), Positives = 360/718 (50%), Gaps = 110/718 (15%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M TL ID ET S +D+ K G+ +Y +  +  ++LFA+ FD+  V++ D V+D  +P+ + 
Sbjct: 1   MRTLSIDIETYSDLDIKKVGVYRYVDSANFEILLFAYAFDNEEVKVIDLVNDEELPKEVI 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKL 118
           EAL +  V   A N+ FERT +    N+++  + W CT++ A + GLP +L +V +ALK 
Sbjct: 61  EALNDNKVIKSAFNANFERTAISKFLNINLKPNEWSCTMIKALTLGLPGSLDSVSKALKF 120

Query: 119 S--SQKMEEGKELIARFC---------KGETHECLYDRNKPNH-REAWRLFGEYCKGDVT 166
           +   QKM+EGK LI  FC         KG T      RN P H  E W  F EYCK DV 
Sbjct: 121 NEDKQKMKEGKALIQYFCKPCKATKVNKGRT------RNLPIHDMEKWNKFKEYCKQDVV 174

Query: 167 VTREIFKRLEPLSSKEQE--LWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELES 224
           V REI  +L    + E+E  LWYLDQ IND G  VD  L     +       KL +E   
Sbjct: 175 VEREIRNKLSKYKTTEREIKLWYLDQRINDTGIKVDTELIENAIECDKRYTEKLTKEAIK 234

Query: 225 LTYGLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRAS 284
           +T GL ++     +LK WL  + G  +  LT+ +   +L          +++   R   S
Sbjct: 235 IT-GL-NNPNSPAQLKKWLSDKVGFEITSLTKESIPEILKQVD--DENVVRILELRKLMS 290

Query: 285 RSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSH-EELD--- 340
           ++++ K   +  A  +D R+RG LQF GA+RTGRW+G +   QNLP   ++H E+LD   
Sbjct: 291 KTSIKKYEAMKLAKGNDNRVRGLLQFYGANRTGRWAGRLVQVQNLP---QNHIEDLDLAR 347

Query: 341 --------QIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWM 392
                    +I  L  S+   PD   ++S  +R+  I SEG + +V+D + IEARV+AW+
Sbjct: 348 NLLKEGDFDLIELLYDSV---PD---VLSQLIRTAFIPSEGHRFIVSDFSAIEARVIAWL 401

Query: 393 AGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTK--DQRAIGKVMELALGYQGGAKAFQK 450
           AGE+W+L  F +   +Y  + ++ F +    + K  + R  GK+ EL+ GY G   A   
Sbjct: 402 AGEKWRLDVFNSHGKIYEASASQMFKIPIENIKKGSELRQKGKLAELSNGYGGSVGALIS 461

Query: 451 MASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAW 510
           M +            +K     EE                             + +  AW
Sbjct: 462 MGA------------IKMGLKEEE----------------------------LQPIVTAW 481

Query: 511 RQKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVY 570
           R  +  +++ W ++ +A ++ I++    I   +  +  +Y   +   L + LPS R L Y
Sbjct: 482 RNANPNITKFWWDVDKAAKKAIKD--RTIVEIQHGIKFIY---NPGVLFIELPSSRRLSY 536

Query: 571 RD---------VGNNRSY--LNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATK 619
                       G+  +Y  +  T++Q  R  TYG KL ENIVQA +RD L E M N T 
Sbjct: 537 LRPKIEPHTTFSGDKITYEGMEQTSKQWKRIDTYGPKLVENIVQATARDCLREAMFNVTD 596

Query: 620 AGYDIVLTVHDEIVCETPDTDEFNASM--LYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           AGY IV+ VHDE+V    D D+   S+  +  +M    SWAKGLPLKA+GYE   Y+K
Sbjct: 597 AGYSIVMHVHDELVI---DVDKKGGSLEEVNSIMGKEISWAKGLPLKADGYECDYYKK 651


>gi|134299054|ref|YP_001112550.1| DNA-directed DNA polymerase [Desulfotomaculum reducens MI-1]
 gi|134051754|gb|ABO49725.1| DNA-directed DNA polymerase [Desulfotomaculum reducens MI-1]
          Length = 650

 Score =  340 bits (872), Expect = 4e-91,   Method: Compositional matrix adjust.
 Identities = 242/709 (34%), Positives = 336/709 (47%), Gaps = 94/709 (13%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M  L ID ET S +DLTK G+  YAE  D  ++LF + FDD PV+L D      +P  + 
Sbjct: 1   MTILGIDIETYSRVDLTKSGVYAYAEAEDFEILLFGYAFDDEPVQLIDLASGEQLPDNVL 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKL 118
            AL + ++   A N+ FERT +   FN  +P  +W CT V A + GLP  L  V + L L
Sbjct: 61  NALTDPEIIKTAFNANFERTCIAKHFNRPMPPEQWRCTHVHALTLGLPGHLGDVAKVLGL 120

Query: 119 SSQKMEEGKELIARF---CKGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTREIFKR 174
             QK   GK LI  F   CK         RN P H  + W  F  YCK DV V R+I K 
Sbjct: 121 KQQKDTAGKALIRYFSMPCKPTKVNGQRTRNLPEHDPDRWAKFKSYCKQDVAVERDIRKT 180

Query: 175 LE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSS 232
           LE  P+   E +LW LDQ IND G  VD  L           + KL  +   LT GL  +
Sbjct: 181 LERFPVIEAEHKLWCLDQRINDGGVLVDSQLVTNAIACDTQYQDKLMAKAAKLT-GL-DN 238

Query: 233 SRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLN 292
            + + +LK WL    GL +E L + +   +L   +  T +  Q+   R   ++++V K  
Sbjct: 239 PKSVSQLKQWLLKTDGLEVESLNKESVPELLKQTESSTVK--QMLELRQEMAKTSVKKYL 296

Query: 293 TLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPS-------------RSHEEL 339
            +  A   DGR+RG LQF GA+RTGRW+G +   QNLPR S               +E L
Sbjct: 297 AMERAKGKDGRVRGLLQFYGANRTGRWAGRLVQVQNLPRNSIKDLDQARQLLKAGDYEML 356

Query: 340 DQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKL 399
           + +   +PT          ++S  +R+  +  EG + +VAD + IEARV+AW+A E+W++
Sbjct: 357 ELLFESVPT----------VLSQLIRTAFVPKEGHRFIVADFSAIEARVIAWLADEKWRM 406

Query: 400 KAFETGEDLYVTTYARSFNVAPAQVTKDQ--RAIGKVMELALGYQGGAKAFQKMASTTGL 457
             F T   +Y  + +  F+V   ++TK    R  GKV ELALGYQGG  A   M +    
Sbjct: 407 DVFRTHGKIYEASASAMFHVPIEEITKGNPLRQKGKVSELALGYQGGPGALIAMGA---- 462

Query: 458 NLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRV 517
                                      ++E   E  +  L          K WRQ    +
Sbjct: 463 ---------------------------LKEGLTEEELPGLV---------KLWRQSSPNI 486

Query: 518 SELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVY---RDVG 574
            + W +   A  + ++    +       +  +Y   +   L + LPSGR L Y   R   
Sbjct: 487 VKFWYDTEAAAIKAVKEKTTV--ELHHGIHFIY---ESGILFIRLPSGRRLAYIKPRIQN 541

Query: 575 NNR------SY--LNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVL 626
           N R      +Y      T+Q  R YTYGGKL ENIVQAV+RD LAE ++    AGY  V+
Sbjct: 542 NPRLDKPALTYEGQEQGTKQWGRLYTYGGKLVENIVQAVARDCLAEALLRLDVAGYKTVM 601

Query: 627 TVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
            VHDE V E P     +      +M     WA GLP++A+G+ES  Y+K
Sbjct: 602 HVHDESVMEMPH-GVGSLEDACRIMEQPIPWAPGLPMRADGFESNYYKK 649


>gi|255306559|ref|ZP_05350730.1| DNA polymerase [Clostridium difficile ATCC 43255]
          Length = 652

 Score =  339 bits (870), Expect = 8e-91,   Method: Compositional matrix adjust.
 Identities = 241/718 (33%), Positives = 358/718 (49%), Gaps = 110/718 (15%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M TL ID ET S +D+ K G+ +Y +  +  ++LFA+ FD+  V++ D V+D  +P+ + 
Sbjct: 1   MRTLSIDIETYSDLDIKKVGVYRYVDSANFEILLFAYAFDNEEVKVIDLVNDEELPKEVI 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKL 118
           EAL +  V   A N+ FERT +    N+++  + W CT++ A + GLP +L +V +ALK 
Sbjct: 61  EALNDNKVIKSAFNANFERTAISKFLNINLKPNEWSCTMIKALTLGLPGSLDSVSKALKF 120

Query: 119 S--SQKMEEGKELIARFC---------KGETHECLYDRNKPNH-REAWRLFGEYCKGDVT 166
           +   QKM+EGK LI  FC         KG T      RN P H  E W  F EYCK DV 
Sbjct: 121 NEDKQKMKEGKALIQYFCKPCKATKVNKGRT------RNLPIHDMEKWNKFKEYCKQDVV 174

Query: 167 VTREIFKRLEPLSSKEQE--LWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELES 224
           V REI  +L    + E+E  LWYLDQ IND G  VD  L     +       KL +E   
Sbjct: 175 VEREIRNKLSKYKTTEREIKLWYLDQRINDTGIKVDTELIENAIECDKRYTEKLTKEAIK 234

Query: 225 LTYGLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRAS 284
           +T GL ++     +LK WL  +    +  LT+ +   +L          ++    R   S
Sbjct: 235 IT-GL-NNPNSPAQLKKWLSDKVSFEITSLTKESIPEILKQVD--DENVVRTLELRKLMS 290

Query: 285 RSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSH-EELD--- 340
           ++++ K   +  A  +D R+RG LQF GA+RTGRW+G +   QNLP   ++H E+LD   
Sbjct: 291 KTSIKKYEAMKLAKGNDNRVRGLLQFYGANRTGRWAGRLVQVQNLP---QNHIEDLDLAR 347

Query: 341 --------QIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWM 392
                    +I  L  S+   PD   ++S  +R+  I SEG + +V+D + IEARV+AW+
Sbjct: 348 NLLKEGDFDLIELLYDSV---PD---VLSQLIRTAFIPSEGHRFIVSDFSAIEARVIAWL 401

Query: 393 AGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTK--DQRAIGKVMELALGYQGGAKAFQK 450
           AGE+W+L  F +   +Y  + ++ F V    + K  + R  GK+ EL+ GY G   A   
Sbjct: 402 AGEKWRLDVFNSHGKIYEASASQMFKVPIESIKKGSELRQKGKLAELSNGYGGSVGALIS 461

Query: 451 MASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAW 510
           M +            +K     EE                             + +  AW
Sbjct: 462 MGA------------IKMGLKEEE----------------------------LQPIVTAW 481

Query: 511 RQKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVY 570
           R  +  +++ W ++ +A ++ I++    I   +  +  +Y   +   L + LPS R L Y
Sbjct: 482 RNANPNITKFWWDVDKAAKKAIKD--RTIVEIQHGIKFIY---NPGVLFIELPSSRRLSY 536

Query: 571 RD---------VGNNRSY--LNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATK 619
                       G+  +Y  +  T++Q  R  TYG KL ENIVQA +RD L E M N T 
Sbjct: 537 LRPKIEPHTTFSGDKITYEGMEQTSKQWKRIDTYGPKLVENIVQATARDCLREAMFNVTD 596

Query: 620 AGYDIVLTVHDEIVCETPDTDEFNASM--LYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           AGY IV+ VHDE+V    D D+   S+  +  +M    SWAKGLPLKA+GYE   Y+K
Sbjct: 597 AGYSIVMHVHDELVI---DVDKKGGSLEEVNSIMGKEISWAKGLPLKADGYECDYYKK 651


>gi|304406771|ref|ZP_07388426.1| DNA-directed DNA polymerase [Paenibacillus curdlanolyticus YK9]
 gi|304344304|gb|EFM10143.1| DNA-directed DNA polymerase [Paenibacillus curdlanolyticus YK9]
          Length = 653

 Score =  338 bits (867), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 241/703 (34%), Positives = 344/703 (48%), Gaps = 79/703 (11%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M TL ID ET S ID+ K G  KYA+  D  +++FA+ +D  PV++ D      +PQ + 
Sbjct: 1   MRTLNIDIETYSSIDIKKAGAYKYAQSPDFQILMFAYSWDGGPVQIVDLAQGEYLPQEIV 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKL 118
           EAL +  V   A+N+ FE   L   F    PI +W CT V     G  + L AVGEAL +
Sbjct: 61  EALADPAVVKHAYNAAFEWYCLNRFFY--SPIEQWRCTQVHGLYCGYTAGLGAVGEALGI 118

Query: 119 --SSQKMEEGKELIARFC---KGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTREIF 172
               +K+  G  LI  FC   K      +  R  P+H  E W+LF EYC GDV    EI 
Sbjct: 119 PQDKRKLGTGGSLIRTFCIPCKPTRTNGMRTRTLPHHEPEKWKLFKEYCVGDVVAEMEIQ 178

Query: 173 KRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLV 230
           +RL   P+  +E +LW+LDQ IN RG   D+ +      + +   ++L  E  SLT GL 
Sbjct: 179 RRLSAFPVPDQEWQLWHLDQRINARGLFCDLQMVEGALAVDEQVTSELRAEAISLT-GL- 236

Query: 231 SSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLK 290
            + + +++L  WL  ETG  +E+L + T  +++  +K    +A +V   R   S+++  K
Sbjct: 237 DNPKSVQQLSKWLAEETGEEVENLQKGTVSKLI--DKLDEGKARRVLEIRQELSKTSTKK 294

Query: 291 LNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEE------LDQIIT 344
              +  A  SD R+RG LQF GA+RTGRW+G +   QNLPR   S  E      +++ + 
Sbjct: 295 YAAMQTAAGSDQRVRGLLQFYGANRTGRWAGRLVQIQNLPRNYLSTLEYARQLVVERKVE 354

Query: 345 HLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFET 404
            L     + PD L   S  +R+  +   GK+L VAD + IEARV+AW+AGEQW+L  F T
Sbjct: 355 MLKFVYGNVPDTL---SQLIRTAFVVPAGKQLGVADFSAIEARVIAWLAGEQWRLDVFAT 411

Query: 405 GEDLYVTTYARSFNVAPAQVTK--DQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTF 462
              +Y  + ++ F V   Q+ K  D R  GKV ELALGYQGG  A   M +         
Sbjct: 412 HGKIYEASASQMFGVPIEQIGKGSDLRQKGKVAELALGYQGGKGALIAMGA--------- 462

Query: 463 AHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWN 522
                 +    E E  E   R                          WR  + R+ +LW 
Sbjct: 463 -----LDQGLTEAELPEIVTR--------------------------WRNANRRIVDLWY 491

Query: 523 ELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVY-------RDVGN 575
            +  A  + +E G+ +  R        +    ++   + LPSGR L Y        D G 
Sbjct: 492 SMEAAAIEVMETGQPVGVRGLIFARESHHATKQDFFTITLPSGRKLFYAKPFLRENDFGK 551

Query: 576 NRSY---LNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEI 632
              +   ++ T+++ T   TYGGKL EN VQA++RD LA  +M     GY IVL VHDE+
Sbjct: 552 PALHYWGMDQTSKKWTVLNTYGGKLVENCVQAIARDCLAVTLMRLDHVGYPIVLHVHDEV 611

Query: 633 VCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
             E    DE +   +  +M     WA GLPLK +G+ +  Y K
Sbjct: 612 GAELSSADELD--RMLEIMAQPIQWAPGLPLKGDGFVTNFYMK 652


>gi|255525749|ref|ZP_05392680.1| DNA-directed DNA polymerase [Clostridium carboxidivorans P7]
 gi|296188034|ref|ZP_06856426.1| DNA-directed DNA polymerase [Clostridium carboxidivorans P7]
 gi|255510572|gb|EET86881.1| DNA-directed DNA polymerase [Clostridium carboxidivorans P7]
 gi|296047160|gb|EFG86602.1| DNA-directed DNA polymerase [Clostridium carboxidivorans P7]
          Length = 646

 Score =  336 bits (861), Expect = 9e-90,   Method: Compositional matrix adjust.
 Identities = 237/707 (33%), Positives = 355/707 (50%), Gaps = 98/707 (13%)

Query: 4   LFIDFETRSPIDLTKCGICKY--AEDVCVILFAFGFDDHPVELWDCVHDPVMPQVLKEAL 61
           L ID ET S +D+TK G+  Y  AED  ++LFA+ ++D  + + D      +PQ + E L
Sbjct: 2   LSIDIETYSSVDITKSGVYAYTEAEDFEILLFAYAYEDKEINIIDLAFGEKLPQGIIEDL 61

Query: 62  ENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKLSSQ 121
            N  +   A N+ FERT L    N  +P  +W C+ V A + G   +L+   ++L L  Q
Sbjct: 62  TNPKLIKTAFNANFERTCLAKYLNKPMPPEQWRCSAVHALALGFGGSLEGAAKSLNLQQQ 121

Query: 122 KMEEGKELIARF---CK-GETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTREIFKRLE 176
           KM+EGK LI  F   CK GE       RN P H  E W++F  YCK DV V R + K+LE
Sbjct: 122 KMKEGKALIRYFSMPCKRGER-----SRNLPQHNIEKWKVFKTYCKQDVEVERAVRKKLE 176

Query: 177 --PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSSSR 234
             P++ KE ELW LDQ IND G  +D  L H+  +     ++K  +E  +LT GL + + 
Sbjct: 177 KYPVTKKEWELWALDQKINDSGVKIDKVLVHSAIECDKTCQSKKTEEAAALT-GLENPNS 235

Query: 235 CLEKLKTWLFLET-GLHLEDLTETTCQRVLSSNKKLTPQAIQ-VFNNRMRASRSAVLKLN 292
            ++ LK W  LET G+  E L++   + +L   K++  + ++ V   R   S+++V K  
Sbjct: 236 QVQ-LKGW--LETKGVKAESLSKEKVRELL---KEVEDEKVKRVLKLRQELSKTSVKKYE 289

Query: 293 TLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITH------L 346
            +  A+  D R+RG L+F GA+RTGRWSG +   QNLPR +  + E  +++        L
Sbjct: 290 AIKRAVCKDERVRGLLKFYGANRTGRWSGKLVQTQNLPRNTMDNLEAARMLLKSGNYEML 349

Query: 347 PTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGE 406
                S P   +++S  +R+  I +   + +V+D + IEARV+AW+AGE+W +  F+   
Sbjct: 350 EVLFYSVP---EVLSQLIRTAFIPAFNSRFIVSDFSAIEARVIAWLAGEKWVIDTFKGSG 406

Query: 407 DLYVTTYARSFNVAPAQVTKDQ-----RAIGKVMELALGYQGGAKAFQKMAST-TGLNLN 460
            +Y    +R F V   ++ K       R  GKV  LA GYQG   A   M +   GL   
Sbjct: 407 KVYEMAASRMFGVPIEKIVKGNMEYSLRQKGKVATLACGYQGSTGALIAMGAVKMGLKEE 466

Query: 461 TFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSEL 520
             + +V                                          AWR+ +S + +L
Sbjct: 467 ELSGIV-----------------------------------------AAWRKSNSNIVKL 485

Query: 521 WNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVY------RDVG 574
           W ++  A  + +   K +    +    L +   ++  L + LPSGRSL Y      +D  
Sbjct: 486 WRKIEDAAIKAVREKKVV----KMQYGLEFFGSEE-FLFIKLPSGRSLSYVRPRIEKDFR 540

Query: 575 NNRSYLN-----TTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVH 629
            N+  L        T+   R  TYGGKLTENIVQA++RD LA  M+   +AGY IV  VH
Sbjct: 541 FNKLKLTYEGIEQGTKAWGRLNTYGGKLTENIVQAIARDCLAYAMLRLDRAGYKIVFHVH 600

Query: 630 DEIVCETPDTDEFNASMLYHLMTSNP-SWAKGLPLKAEGYESKRYRK 675
           DE++ + P+   F +    + +   P  WAKGLPLKA+G+E+  Y+K
Sbjct: 601 DEVILDVPNG--FGSLKEVNEIMGKPIEWAKGLPLKADGFETDYYKK 645


>gi|320530602|ref|ZP_08031654.1| DNA-directed DNA polymerase [Selenomonas artemidis F0399]
 gi|320137129|gb|EFW29059.1| DNA-directed DNA polymerase [Selenomonas artemidis F0399]
          Length = 653

 Score =  335 bits (860), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 240/713 (33%), Positives = 352/713 (49%), Gaps = 104/713 (14%)

Query: 4   LFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHDPVMPQVLKEALEN 63
           L ID ET S +D+   G  +YAE+  ++LFA+ +DD PV++ D   +  +P  +  AL +
Sbjct: 3   LSIDLETYSALDIKTVGGYRYAENAEILLFAYAWDDTPVQIVDLTAEETIPADVLSALTD 62

Query: 64  TDVTIVAHNSYFERTVLKACFNLD------IPIHRWICTLVLARSNGLPSALKAVGEALK 117
            D+   A N+ FERTVL    + +      +    W CT+V A + GLP +L  V + LK
Sbjct: 63  NDIMKCAFNAQFERTVLSHYLHKEGEPFAFLDPAGWSCTMVHALTLGLPGSLAEVSKTLK 122

Query: 118 LS--SQKMEEGKELIARFCK---------GETHECLYDRNKPNHR-EAWRLFGEYCKGDV 165
           L    +KM  G +LI  FCK         G T      RN PN   E W  F  YC  DV
Sbjct: 123 LGEEKEKMSVGTQLITYFCKPCKPTKSNGGRT------RNLPNDAPEKWATFKAYCVRDV 176

Query: 166 TVTREIFKRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELE 223
              RE+ +RL   P+   E+ LW LDQ INDRG  +D  LA          R ++  E  
Sbjct: 177 EAEREVRRRLSGYPVPETERALWALDQRINDRGVRIDEILAQNAIAFDSAFRAEVTAEAS 236

Query: 224 SLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRA 283
           +L+ GL + +   E+LK W++ + G     LT+ T   ++ + K  T + +     +M  
Sbjct: 237 ALS-GLENPNSG-EQLKHWIYEQEGARPLSLTKETIPELIETAKSETVKTM--LQLKMLL 292

Query: 284 SRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQII 343
           S+++V K   +V+A  SDGR  G LQF GA+RTGRW+G +   QNLPR + +  ELD   
Sbjct: 293 SKTSVKKYEAMVQAQCSDGRAHGLLQFYGANRTGRWAGRLVQVQNLPRNTMA--ELDDAR 350

Query: 344 THLPTSITSD-----PDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWK 398
             L    T        +P  ++S  +R+  I + G +  VAD + IEARV+AW+AGE+W+
Sbjct: 351 ALLRCGDTDALEMLFDNPPDVLSQLIRTAFIPAVGMRFTVADFSAIEARVIAWLAGEKWR 410

Query: 399 LKAFETGEDLYVTTYARSFNVAPAQ---VTKDQRAIGKVMELALGYQGGAKAFQKM-AST 454
           +  F  G D+Y  + ++ F+V P +   V    R  GKV ELALGY GG  A ++M A  
Sbjct: 411 MDVFADGGDIYCASASKMFHV-PVEKHGVNGHLRQKGKVAELALGYGGGVSALKRMGADK 469

Query: 455 TGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKH 514
            GL                   DAE                        E +K++WR+  
Sbjct: 470 LGLT------------------DAE-----------------------LEEIKQSWRKAS 488

Query: 515 SRVSELWNELHQAFEQTIENGKAIIARKRRDVPL---VYMKKDKNNLILMLPSGRSLVY- 570
            R+  LW++   A  + +        R+R  V L   + ++     L + LPSGRSL Y 
Sbjct: 489 PRIVRLWSDFESAALEAV--------RERSTVSLQHGIKLECRSGILFIRLPSGRSLAYV 540

Query: 571 -----RDVGNNRSYLNTTTRQL---TREYTYGGKLTENIVQAVSRDILAEGMMNATKAGY 622
                 +   +R  L    R +    ++ TYGG+L EN +QA++RD LA  M     AGY
Sbjct: 541 KPRIEYEESFDREGLTYYGRDVGGWGKQRTYGGRLVENAIQAIARDCLAVAMTRLEAAGY 600

Query: 623 DIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
            IV+ +HDE+V ETP + +  A +   +M+    WA GL L A+GY +  Y+K
Sbjct: 601 PIVMHIHDEVVVETPRSVDCLADVC-EIMSKPVDWAPGLVLTADGYTTNYYKK 652


>gi|297587100|ref|ZP_06945745.1| DNA-directed DNA polymerase [Finegoldia magna ATCC 53516]
 gi|297575081|gb|EFH93800.1| DNA-directed DNA polymerase [Finegoldia magna ATCC 53516]
          Length = 643

 Score =  333 bits (855), Expect = 4e-89,   Method: Compositional matrix adjust.
 Identities = 233/706 (33%), Positives = 351/706 (49%), Gaps = 95/706 (13%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M  L ID ET S +DL K G+ KYAE  D  ++LFA+  +D  V++ D  +  ++P+ + 
Sbjct: 1   MKKLSIDLETYSSVDLGKSGVYKYAESEDFEILLFAYSINDGEVKVIDLANGEIIPEEIL 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKL 118
            AL + +V   A N+ FER  L       +    W CT++ +   GLP +L+ VGE LKL
Sbjct: 61  SALSDENVEKWAFNANFERVCLSRFLGKRLKPQGWYCTMIWSAYLGLPLSLEKVGEVLKL 120

Query: 119 SSQKMEEGKELIARF---CKGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTREIFKR 174
             QKM EGK LI  F   CK      +  RN  +H  E W  F EY + DV     I K+
Sbjct: 121 DKQKMNEGKALIRYFSTPCKPTKTNGMRIRNLSHHDLEKWSTFKEYNQRDVETEMAIKKK 180

Query: 175 LE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTK-LDQELESLTYGLVS 231
           L   P+S  E E +++DQ INDRG  +D  L  +  +   + R + +D+ +E LT GL +
Sbjct: 181 LSAFPMSHSEWENYWIDQNINDRGILIDEVLVDSAIKFDGILREENMDRAIE-LT-GLEN 238

Query: 232 SSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKL 291
            +  L+ LK WL  + GL ++ L +   +  L + +    + +++   R   S+S+V K 
Sbjct: 239 PNSPLQ-LKEWLN-KKGLEIDSLAKKDVESALKNTEGDIKEVLEL---RQELSKSSVRKY 293

Query: 292 NTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSIT 351
           + +      D R RG +QF GA+RTGR+SG +   QNL R   + ++LD     L  S+ 
Sbjct: 294 DAMKNVKGKDNRARGLIQFYGANRTGRYSGRLIQVQNLRR--NNLKDLD-----LARSLV 346

Query: 352 SDPD----------PLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKA 401
            + D          P  I+S  +R+  IA EG + +++D + IEARVLAW+AGEQW L A
Sbjct: 347 KNRDYETMEILYESPSDILSQLIRTAFIAKEGTRFIISDFSAIEARVLAWLAGEQWVLDA 406

Query: 402 FETGEDLYVTTYARSFNVAPAQ--VTKDQRAIGKVMELALGYQGGAKAFQKMAST-TGLN 458
           FE GED+Y  T +R F V   +  V    R  GK+  LA GYQG   A + M     GL+
Sbjct: 407 FENGEDIYCRTASRMFGVPVEKHGVNGHLRQKGKIATLACGYQGALGALKAMGGIEMGLS 466

Query: 459 LNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVS 518
            +    +V +                                         WR+ +  + 
Sbjct: 467 EDELQSIVDS-----------------------------------------WREANPNIV 485

Query: 519 ELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVY--RDVGNN 576
            LW ++    ++ ++       R +     + +  +K  L + LPS R L Y    +G N
Sbjct: 486 SLWWDIDSVVKRVVK------TRTKEKYKSLVISYEKGILFIELPSKRRLAYPKAKIGTN 539

Query: 577 RSYLNTTT-------RQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVH 629
           R    +          +  +  +YGGK  ENIVQA++RDILAE MM   K G++IV+ +H
Sbjct: 540 RFGGESIVYEGIVVGNKWDKIESYGGKFVENIVQAIARDILAEAMMRLEKKGFNIVMHIH 599

Query: 630 DEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           DE+V E   +D  +   +  +M+  PSWA GL L A+G+ES+ Y+K
Sbjct: 600 DEVVIE---SDSSSIEEINQIMSLVPSWAPGLILDADGFESEFYKK 642


>gi|118852|sp|P06225|DPOL_BPSP2 RecName: Full=DNA polymerase
 gi|216151|gb|AAA32600.1| DNA polymerase (gene L; ttg start codon) [Bacillus phage SPO2]
 gi|579197|emb|CAA25691.1| unnamed protein product [Bacillus phage SPO2]
          Length = 648

 Score =  333 bits (855), Expect = 4e-89,   Method: Compositional matrix adjust.
 Identities = 248/706 (35%), Positives = 344/706 (48%), Gaps = 90/706 (12%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M TL ID ET S +DL K G+  Y E  D  ++LFA+ FDD PV++ D      +P  + 
Sbjct: 1   MKTLSIDIETFSSVDLLKAGVYAYTEAPDFEILLFAYAFDDDPVKIIDLAQGDTLPHEVL 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKL 118
            AL ++ V   A+N+ FERT +   FNL +   +W CT V A + GLP  L  V +ALKL
Sbjct: 61  VALTSSKVIKTAYNANFERTCIAKHFNLMLLPAQWRCTAVHATTLGLPGNLDGVAKALKL 120

Query: 119 SSQKMEEGKELIARF---CKGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTREIFKR 174
           S+QK + GK LI  F   CK         RN P H  E W  F  YC  DV V R I  R
Sbjct: 121 SAQKDKAGKALIRYFSVPCKPTKANGQRVRNLPEHDPEKWEKFKVYCIQDVEVERAIKNR 180

Query: 175 L---EPLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVS 231
           +   EPL S E +LW LDQ INDRG  +DV L        +  +  L  E + LT GL +
Sbjct: 181 ISKFEPLES-EHKLWALDQEINDRGVRIDVDLVKHAIACDEQYQAGLIAEAKKLT-GLPN 238

Query: 232 SSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKL 291
            +   + LK WL  E GL +  L +   + ++ +    T    +V   R   ++++V K 
Sbjct: 239 PNSTAQ-LKKWL-EEKGLTISSLAKDKIEELIENTNDETVH--RVLRLRQEMAKTSVKKY 294

Query: 292 NTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSIT 351
             + +A+  D R+RG LQF GASRTGRW+G +   QNLP+     E+LD     L     
Sbjct: 295 LAMEKALCPDNRVRGLLQFYGASRTGRWAGRLVQVQNLPQ--NKIEDLDTARNLLKGGHY 352

Query: 352 SDPDPLQ-----IISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGE 406
              + L      ++S  VR+  I SEG +  V+D + IEARV+AW+AGE+W+L+ F T  
Sbjct: 353 EAIELLYGQVPFVLSQLVRTAFIPSEGNEFYVSDFSAIEARVIAWLAGEEWRLEVFNTHG 412

Query: 407 DLYVTTYARSFNVAPAQVTKDQ--RAIGKVMELALGYQGGAKAFQKMAS-TTGLNLNTFA 463
            +Y  + A+ F V    +TK    R  GKV ELALGYQGG  A  +M +   GL      
Sbjct: 413 KIYEASAAQMFKVPVESITKGSPLRQKGKVAELALGYQGGKGALIQMGALNMGLAEGELP 472

Query: 464 HLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNE 523
            LV                                         KAWR  + ++ + W +
Sbjct: 473 ELV-----------------------------------------KAWRTANKKIVKFWYD 491

Query: 524 LHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYR------DVGNNR 577
           +  A  + ++  K +  + +  +  +Y   +   L + LPSGR L Y       D    +
Sbjct: 492 VEAAAIKAVKERKPV--KLQHGLTFLY---ESGILFVQLPSGRRLAYAKPKLELDERFGK 546

Query: 578 SYLNTTTR----QLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIV 633
             L    +    +  R  TYGGKL ENIVQA +RD LA  +M    AGY  V+ VHDE V
Sbjct: 547 EALTYEGKLESGKWGRLNTYGGKLVENIVQATARDCLAITLMRLDNAGYKTVMHVHDEAV 606

Query: 634 CETP----DTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
            + P    + D+  A     +M    SWAKGLPL A+G+ +  Y+K
Sbjct: 607 LDVPRGKNELDKVEA-----IMGEPISWAKGLPLTADGFVTDYYKK 647


>gi|328913309|gb|AEB64905.1| DNA-dependent DNA polymerase, family A [Bacillus amyloliquefaciens
           LL3]
          Length = 648

 Score =  333 bits (853), Expect = 8e-89,   Method: Compositional matrix adjust.
 Identities = 244/705 (34%), Positives = 343/705 (48%), Gaps = 88/705 (12%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M TL ID ET S +DL KCG+  Y E  D  ++LFA+ FD+ P+++ D      +P  + 
Sbjct: 1   MKTLSIDIETFSSVDLLKCGVYAYTEAPDFEILLFAYAFDEEPIKVIDLAQGEALPHEVI 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKL 118
            AL ++ V   A+N+ FERT +   FN  +P  +W CT V A + GLP  L  V +ALKL
Sbjct: 61  VALTSSKVIKTAYNANFERTCIAKHFNTMLPPTQWRCTAVHATTLGLPGNLDGVAKALKL 120

Query: 119 SSQKMEEGKELIARF---CKGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTREIFKR 174
           S QK +EGK LI  F   CK         RN P H  + W  F  YC  DV V R I  R
Sbjct: 121 SEQKDKEGKALIRYFSVPCKPTKANGQRVRNLPEHAPDKWEKFKAYCGQDVEVERSIKNR 180

Query: 175 LEP--LSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSS 232
           +    L   EQELW LDQ INDRG  +D  L        +  +  L  E + LT GL + 
Sbjct: 181 ISKFELLKAEQELWALDQDINDRGVRIDADLVKHAIACDEQYQAGLMVEAKELT-GLPNP 239

Query: 233 SRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLN 292
           +   + LKTWL  + GL +  L +   + ++      +    +V   R   ++++V K  
Sbjct: 240 NSTAQ-LKTWL-EDKGLSVSSLAKDKIEELIEKTDDASVH--RVLRLRQEMAKTSVKKYL 295

Query: 293 TLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITS 352
            + +A+  D R+RG LQF GASRTGRW+G +   QNLP+   +  +LD   T L      
Sbjct: 296 AMEKALCPDSRVRGLLQFYGASRTGRWAGRLVQVQNLPQNKIA--DLDTARTLLKGGHYE 353

Query: 353 DPDPLQ-----IISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGED 407
             + L      ++S  VR+  I SEG +  V+D + IEARV+AW+AGE W+L  F T   
Sbjct: 354 AIELLYGQVPFVLSQLVRTAFIPSEGNEFYVSDFSAIEARVIAWLAGEGWRLDVFNTHGK 413

Query: 408 LYVTTYARSFNVAPAQVTKDQ--RAIGKVMELALGYQGGAKAFQKMAS-TTGLNLNTFAH 464
           +Y  + A+ F V    +TK    R  GKV ELALGYQGG  A  +M + T GL+ +    
Sbjct: 414 IYEASAAQMFKVPVESITKGSPLRQKGKVAELALGYQGGKGALIQMGALTMGLDEDELPG 473

Query: 465 LVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNEL 524
           LV                                         KAWR  + ++ + W ++
Sbjct: 474 LV-----------------------------------------KAWRTANKKIVQFWYDV 492

Query: 525 HQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYR------DVGNNRS 578
             A  + ++  K +  +      L ++  +   L + LPSGR L Y       D    + 
Sbjct: 493 EAAAVKAVKERKPVKIQH----GLTFL-CESGILFVQLPSGRRLAYAKPKLEIDDRFGKE 547

Query: 579 YLNTTTR----QLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVC 634
            L    +    +  R  TYGGKL ENIVQAV+RD LA  ++    AGY  V+ VHDE V 
Sbjct: 548 ALTYEGKLESGKWGRLNTYGGKLVENIVQAVARDCLAVTLIRLDDAGYKTVMHVHDEAVL 607

Query: 635 ETP----DTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           + P    + D+  A     +M     WAKGLPL A+G+ +  Y+K
Sbjct: 608 DVPRGKNELDKVEA-----IMGEPIPWAKGLPLTADGFITDYYKK 647


>gi|308174986|ref|YP_003921691.1| DNA-dependent DNA polymerase, family A [Bacillus amyloliquefaciens
           DSM 7]
 gi|307607850|emb|CBI44221.1| DNA-dependent DNA polymerase, family A [Bacillus amyloliquefaciens
           DSM 7]
          Length = 648

 Score =  333 bits (853), Expect = 8e-89,   Method: Compositional matrix adjust.
 Identities = 244/703 (34%), Positives = 345/703 (49%), Gaps = 84/703 (11%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M TL ID ET S +DL KCG+  Y E  D  ++LFA+ FD+ P+++ D      +P  + 
Sbjct: 1   MKTLSIDIETFSSVDLLKCGVYAYTEASDFEILLFAYAFDEEPIKVIDLAQGEALPHEVL 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKL 118
            AL ++ V   A+N+ FERT +   FN  +P  +W CT V A + GLP  L  V +ALKL
Sbjct: 61  VALTSSKVIKTAYNANFERTCIAKHFNTMLPPTQWRCTAVHATTLGLPGNLDGVAKALKL 120

Query: 119 SSQKMEEGKELIARF---CKGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTREIFKR 174
           S QK +EGK LI  F   CK         RN P H  + W  F  YC  DV V R I  R
Sbjct: 121 SEQKDKEGKALIRYFSVPCKPTKANGQRVRNLPEHAPDKWEKFKTYCGQDVEVERSIKNR 180

Query: 175 L---EPLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVS 231
           +   EPL + EQELW LDQ INDRG  +D  L        +  +  L  E + LT GL +
Sbjct: 181 ISKFEPLKA-EQELWALDQDINDRGVRIDADLVKHAIACDEQYQAGLMVEAKELT-GLPN 238

Query: 232 SSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKL 291
            +   + LK WL  + GL +  L +   + ++      +    +V   R   ++++V K 
Sbjct: 239 PNSTAQ-LKKWL-EDKGLSVSSLAKDKIEELIEKTDDASVH--RVLRLRQEMAKTSVKKY 294

Query: 292 NTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSIT 351
             + +A+  D R+RG LQF GASRTGRW+G +   QNLP+   +  +LD   T L     
Sbjct: 295 LAMEKALCPDSRVRGLLQFYGASRTGRWAGRLVQVQNLPQNKIA--DLDTARTLLKGGHY 352

Query: 352 SDPDPLQ-----IISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGE 406
              + L      ++S  VR+  I SEG +  V+D + IEARV+AW+AGE W+L  F T  
Sbjct: 353 EAIELLYGQVPFVLSQLVRTAFIPSEGNEFYVSDFSAIEARVIAWLAGEGWRLDVFNTHG 412

Query: 407 DLYVTTYARSFNVAPAQVTKDQ--RAIGKVMELALGYQGGAKAFQKMAS-TTGLNLNTFA 463
            +Y  + A+ F V    +TK    R  GKV ELALGYQGG  A  +M + T GL+ +   
Sbjct: 413 KIYEASAAQMFKVPVESITKGSPLRQKGKVAELALGYQGGKGALIQMGALTMGLDEDELP 472

Query: 464 HLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNE 523
            LV                                         KAWR  + ++ + W +
Sbjct: 473 GLV-----------------------------------------KAWRTANKKIVQFWYD 491

Query: 524 LHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYR------DVGNNR 577
           +  A  + ++  K +  +      L ++  +   L + LPSGR L Y       D    +
Sbjct: 492 VEAAAVKAVKERKPVKIQH----GLTFL-CESGILFVQLPSGRRLAYAKPKLEIDDRFGK 546

Query: 578 SYLNTTTR----QLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIV 633
             L    +    +  R  TYGGKL ENIVQAV+RD LA  ++    AGY  V+ VHDE V
Sbjct: 547 EALTYEGKLESGKWGRLNTYGGKLVENIVQAVARDCLAVTLIRLDDAGYKTVMHVHDETV 606

Query: 634 CETP-DTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
            + P   +E +   +  +M     WAKGLPL A+G+ +  Y+K
Sbjct: 607 LDVPRGKNELDK--VESIMGEPIPWAKGLPLTADGFITDYYKK 647


>gi|220930425|ref|YP_002507334.1| DNA-directed DNA polymerase [Clostridium cellulolyticum H10]
 gi|220000753|gb|ACL77354.1| DNA-directed DNA polymerase [Clostridium cellulolyticum H10]
          Length = 652

 Score =  330 bits (846), Expect = 5e-88,   Method: Compositional matrix adjust.
 Identities = 228/697 (32%), Positives = 341/697 (48%), Gaps = 75/697 (10%)

Query: 4   LFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLKEAL 61
           L ID ET S +DL KCG+ +Y E  D  ++LFA+ +DD P+ + D      +P+ + + L
Sbjct: 5   LSIDIETYSSVDLIKCGVYRYVEAPDFEILLFAYAYDDEPITVIDLADFEELPEQVTKDL 64

Query: 62  ENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKLSSQ 121
            + DV   A+N+ FERT +   +N  +P  +W CT V A + GLP  L  V + L L +Q
Sbjct: 65  TDPDVIKAAYNANFERTCIAKFYNKPMPPEQWRCTSVHALTLGLPGNLDGVAKVLGLDAQ 124

Query: 122 KMEEGKELIARF---CKGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTREIFKRLE- 176
           K   GK LI  F   CK         RN P+H  + W+ F +YCK DV V R I K++E 
Sbjct: 125 KDTAGKNLIKYFSVPCKPTKVNGGRTRNFPHHAPDKWKQFKDYCKQDVVVERAIRKKIEK 184

Query: 177 -PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSSSRC 235
            P+   E +LW LDQ IND G  +D  L     +      T+LD E + LT GL  +   
Sbjct: 185 YPVPEHEWKLWTLDQKINDAGVRLDPVLVQQALKCDLQYATRLDAEAKELT-GL-DNPNS 242

Query: 236 LEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLNTLV 295
             +L  WL  + GL +++         L    K      ++   R   S+++  K   + 
Sbjct: 243 TTQLTVWL-KKQGLTVDNGLGKDYIPGLLDQAKGDETVTRMLELRKEMSKTSTKKYEAME 301

Query: 296 EAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHL----PTSIT 351
            AM SD R RG LQF GA+RT RW+G +   QNLP+       + + + H        + 
Sbjct: 302 RAMCSDDRARGLLQFCGANRTWRWAGRLIQVQNLPQNKIPDLGVARELLHSGKFEAIELL 361

Query: 352 SDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVT 411
            +  P  ++S  +R+  I S+G + +V+D + IEARV+AW+AGE W++K F++   +Y  
Sbjct: 362 FNSPPF-VLSQLIRTAFIPSDGCRFIVSDFSAIEARVIAWLAGESWRMKVFKSHGKIYEA 420

Query: 412 TYARSFNVAPAQVTKDQ--RAIGKVMELALGYQGGAKAFQKMAS-TTGLNLNTFAHLVKT 468
           + +  F+V   ++TK    R  GK+ ELALGY G   A + M +   GL+ +    LV  
Sbjct: 421 SASHMFHVPIEEITKGNPLRQKGKIAELALGYGGSIGALEAMGALKMGLDADELPDLV-- 478

Query: 469 NSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELHQAF 528
                                                   AWR  + ++ +LW ++ +A 
Sbjct: 479 ---------------------------------------TAWRNSNPKIVKLWWDVDKAA 499

Query: 529 EQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVY-----RDVGNNRSYL--- 580
              +     +    R    + +  KD   L + LPSGR L Y     +D    R  L   
Sbjct: 500 MTAVREHMPV----RIQYGITFSYKD-GFLFIKLPSGRKLAYVKPKIKDGKFGRPALTYE 554

Query: 581 --NTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETPD 638
             +   +   R  TYG KL ENIVQAV+RD LA  M+    AGYDI + VHDE++ + P+
Sbjct: 555 GMDQIKKTWERIDTYGPKLVENIVQAVARDCLAVNMLRLDDAGYDIRMHVHDEVILDVPN 614

Query: 639 TDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           TD    + +  +M+    WA GLPL+A+GYE++ Y+K
Sbjct: 615 TDTDALAQVNEIMSQPIDWAPGLPLRADGYETEFYKK 651


>gi|307569599|emb|CAR82778.1| phage-related DNA polymerase family protein [Listeria monocytogenes
           L99]
          Length = 644

 Score =  329 bits (844), Expect = 8e-88,   Method: Compositional matrix adjust.
 Identities = 225/702 (32%), Positives = 337/702 (48%), Gaps = 92/702 (13%)

Query: 3   TLFIDFETRSPIDLTKCGICKY--AEDVCVILFAFGFDDHPVELWDCVHDPVMPQVLKEA 60
            L ID ET S  D+  CG   Y  +ED  ++LFA+ +DD PV++ D   D + P  + E 
Sbjct: 5   VLRIDIETYSGRDIKNCGAYAYTESEDFEILLFAYAYDDEPVKVIDLTIDEI-PDTVLED 63

Query: 61  LENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKLSS 120
           L N  V   AHN+ FERT L   +N  +P  +W CT+V     GLP++L  + +AL+L+ 
Sbjct: 64  LNNRRVLKTAHNANFERTCLAKYYNRKMPPEQWQCTMVHGTLLGLPASLDMMSKALRLAQ 123

Query: 121 QKMEEGKELIARFC---KGETHECLYDRNKPNH-REAWRLFGEYCKGDVTVTREIFKRLE 176
           +K  EGK LI  FC   K         RN P H  E W  F EYC+ DV V R I K++ 
Sbjct: 124 EKDNEGKALIRYFCMPCKPTKANGGRTRNYPEHASEKWAKFIEYCRQDVVVERSIAKKIA 183

Query: 177 --PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSSSR 234
             P    EQ  W LDQ I D+G  +DV L        +  +  L ++ + LT GL  +  
Sbjct: 184 KFPFPEDEQRNWELDQRIADKGVRIDVDLVKHAIACQERYQASLSKKAKGLT-GL-ENPN 241

Query: 235 CLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLNTL 294
            +++LK WL  + G  +  L + +   +L+ ++ L     ++   R   S++++ K   +
Sbjct: 242 SVQQLKDWL-ADMGYPVSSLNKDSVSELLA-DEDLDEDVREMLLLRQEMSKTSIKKYEKM 299

Query: 295 VEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPR-------------PSRSHEELDQ 341
             A   DGR+RG LQF GA+RTGRW+G +   QNLPR              +  +E  + 
Sbjct: 300 QHARCHDGRVRGLLQFNGANRTGRWAGRLVQVQNLPRNYIKDIAEVRKDLKAGDYEAFEM 359

Query: 342 IITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKA 401
           + +++P           ++S  +R+  IA +G    + D + IEARV+AW+AGEQW+L  
Sbjct: 360 MYSNVP----------DVLSQLIRTAFIAEDGYTFDITDFSAIEARVIAWLAGEQWRLDV 409

Query: 402 FETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMAS-TTGLNLN 460
           F +   +Y  + ++ F++   +V K+ R  GKV ELALGY GG  A   M +   GL  N
Sbjct: 410 FNSHGKIYEASASQMFHIPIEEVDKNLRQKGKVSELALGYNGGVNALIAMGALEMGLKEN 469

Query: 461 TFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSEL 520
               +V                                          AWR+    ++ L
Sbjct: 470 ELQGIV-----------------------------------------DAWRKASPAITSL 488

Query: 521 WNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVY-------RDV 573
           W  + +  +  I   K   ++K + +   Y   +   L + LPSGR+L Y          
Sbjct: 489 WRGVEKHAKLAISTRK---SQKYKGLTFYY---EAGILFIKLPSGRNLAYFRAKLVPGKY 542

Query: 574 GNNRSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIV 633
           G    Y   T +   ++YTYGGKL ENIVQA++RD LA  +      G D V+ VHDE +
Sbjct: 543 GPQICYEGVTDKGWRKQYTYGGKLVENIVQAIARDCLAISLRRIEDTGIDTVMHVHDEAI 602

Query: 634 CETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
            E  ++ E +   L  ++    SWA GLPL+ +G+ S  Y K
Sbjct: 603 TEVQES-ESSVDKLNAILAEPISWAPGLPLQGDGFSSDFYMK 643


>gi|227520155|ref|ZP_03950204.1| DNA-directed DNA polymerase [Enterococcus faecalis TX0104]
 gi|227072400|gb|EEI10363.1| DNA-directed DNA polymerase [Enterococcus faecalis TX0104]
          Length = 653

 Score =  328 bits (842), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 244/711 (34%), Positives = 346/711 (48%), Gaps = 95/711 (13%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M TL ID ET S  DLTK G+ KYA+  +  ++LFA+  D  PVE  D     + P  + 
Sbjct: 1   MKTLNIDIETYSDEDLTKVGVYKYADSPNFEILLFAYSVDGQPVECEDLTISEI-PDEIV 59

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIH----RWICTLVLARSNGLPSALKAVGE 114
            AL + +V  +A N+ FER  L    +L +P +    +W CT+V A   GLP++L    +
Sbjct: 60  AALTDKNVLKIAFNAQFERVCLSK--HLGVPYYLDPAQWHCTMVHANELGLPASLGQCAK 117

Query: 115 ALKLSSQKMEEGKELIARF---CKGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTRE 170
            L +  QK   G +LI  F   CK      +  RN P H  E W+ F EYC  DV V   
Sbjct: 118 YLNIEQQKDTRGTQLINFFSKPCKPTKKNGMRTRNLPEHAPEKWQTFIEYCIQDVNVEMA 177

Query: 171 IFKRLE--PLSSKEQELWYLDQTINDRGYCVDVALA-HTLNQIVDVERTKLDQELESLTY 227
           I  +L   P+   E +L+ LDQ INDRG  +D  LA   ++ + D+    L+ E+++LT 
Sbjct: 178 IANKLNRFPVPESEWKLYTLDQRINDRGAEIDHELATAAIDIMADLSEAGLN-EMKALT- 235

Query: 228 GLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSA 287
           GL  +   L +LK WL  E G   E L +    + L+    L     +V   R+  S S+
Sbjct: 236 GL-ENPNSLAQLKKWL-EEQGTPFEKLGKEVVLKALALGN-LPENVAEVLKLRLSLSNSS 292

Query: 288 VLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELD------- 340
             K   +  A  SD R+ G LQF GA+RTGRW+G +   QNLPR   S  E+D       
Sbjct: 293 TKKYLMMDNARCSDNRIHGILQFYGANRTGRWAGRLLQVQNLPRNYLS--EIDFARQLVK 350

Query: 341 -QIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKL 399
            + +  +     + PD L+     +R+ ++A EG + +V+D + IEARV+AW A + W L
Sbjct: 351 AKDVEGIELMYENVPDTLK---QLIRTGLVAKEGHRFIVSDFSAIEARVIAWYAKQDWVL 407

Query: 400 KAFETGEDLYVTTYARSFNVA-------PAQVTKDQRAIGKVMELALGYQGGAKAFQKMA 452
             F T   +Y  T A+ F++         +   KD R  GKV  LALGYQGG  A + M 
Sbjct: 408 DVFRTHGKIYEATAAQMFHLGEVTDYDWKSHEGKDMRQRGKVATLALGYQGGPGALKAMG 467

Query: 453 STTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQ 512
           +                               ++    EH ++D+            WR 
Sbjct: 468 A-------------------------------LENGIEEHELQDIV---------DRWRT 487

Query: 513 KHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYR- 571
            + R+   W+E  +A    ++NG      K+    L + KK    L + LPSGR L Y  
Sbjct: 488 ANKRIKNFWHETQKAVIDCLQNG----GIKKGPRGLKFYKK-AGFLFIQLPSGRKLAYAK 542

Query: 572 ------DVGNNRSYLNTTTR-QLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDI 624
                 D G    Y     +   T + TYGGKL ENIVQA +RD+LAE M+   KAGY I
Sbjct: 543 AHLKEGDYGPAIFYEGQGDKVAFTEQQTYGGKLVENIVQATARDVLAEAMVRLEKAGYPI 602

Query: 625 VLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           V  VHDE V E P+ ++ +   +  +M+  P WA+GLPL AEG+E+K Y K
Sbjct: 603 VFHVHDEAVAEVPEGEK-SIEEMNKIMSIVPDWAEGLPLNAEGFETKYYMK 652


>gi|257088833|ref|ZP_05583194.1| DNA polymerase [Enterococcus faecalis CH188]
 gi|256997645|gb|EEU84165.1| DNA polymerase [Enterococcus faecalis CH188]
 gi|315160597|gb|EFU04614.1| DNA-directed DNA polymerase [Enterococcus faecalis TX0645]
 gi|315579443|gb|EFU91634.1| DNA-directed DNA polymerase [Enterococcus faecalis TX0630]
          Length = 653

 Score =  327 bits (839), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 244/711 (34%), Positives = 344/711 (48%), Gaps = 95/711 (13%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M TL ID ET S  DLTK G+ KYA+  +  ++LFA+  D  PVE  D     + P  + 
Sbjct: 1   MKTLNIDIETYSDEDLTKVGVYKYADSPNFEILLFAYSVDGQPVECEDLTISEI-PDEIV 59

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIH----RWICTLVLARSNGLPSALKAVGE 114
            AL + +V  +A N+ FER  L     L +P +    +W CT+V A   GLP++L    +
Sbjct: 60  AALTDKNVLKIAFNAQFERVCLSKY--LGVPYYLDPAQWHCTMVHANELGLPASLGQCAK 117

Query: 115 ALKLSSQKMEEGKELIARF---CKGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTRE 170
            L +  QK   G +LI  F   CK      +  RN P H  E W+ F EYC  DV V   
Sbjct: 118 YLNIEQQKDTRGTQLINFFSKPCKPTKKNGMRTRNLPEHAPEKWQTFIEYCIQDVNVEMA 177

Query: 171 IFKRLE--PLSSKEQELWYLDQTINDRGYCVDVALA-HTLNQIVDVERTKLDQELESLTY 227
           I  +L   P+   E +L+ LDQ INDRG  +D  LA   ++ + D+    L+ E++ LT 
Sbjct: 178 IANKLNRFPVPESEWKLYTLDQRINDRGAEIDHELATAAIDIMADLSEAGLN-EMKELT- 235

Query: 228 GLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSA 287
           GL  +   L +LK WL  E G   E L +    + L+    L     +V   R+  S S+
Sbjct: 236 GL-ENPNSLAQLKKWL-EEQGTPFEKLGKEVVLKALALGN-LPENVAEVLKLRLSLSNSS 292

Query: 288 VLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELD------- 340
             K   +  A  SD R+ G LQF GA+RTGRW+G +   QNLPR   S  E+D       
Sbjct: 293 TKKYLMMDNARCSDNRIHGILQFYGANRTGRWAGRLLQVQNLPRNYLS--EIDFARQLVK 350

Query: 341 -QIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKL 399
            + +  +       PD L+     +R+ ++A EG + +V+D + IEARV+AW A + W L
Sbjct: 351 AKDVEGIELMYEDVPDTLK---QLIRTGLVAKEGHRFIVSDFSAIEARVIAWYAKQDWVL 407

Query: 400 KAFETGEDLYVTTYARSFNVA-------PAQVTKDQRAIGKVMELALGYQGGAKAFQKMA 452
           + F T   +Y  T A+ F++         +   KD R  GKV  LALGYQGG  A + M 
Sbjct: 408 EVFRTHGKIYEATAAQMFHLGEVTDYDWKSHEGKDMRQRGKVATLALGYQGGPGALKAMG 467

Query: 453 STTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQ 512
           +                               ++    EH ++D+            WR 
Sbjct: 468 A-------------------------------LENGIEEHELQDIV---------DRWRT 487

Query: 513 KHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYR- 571
            + R+   W+E  +A    ++NG      K+    L + KK    L + LPSGR L Y  
Sbjct: 488 ANKRIKNFWHETQKAVIDCLQNG----GIKKGPRGLKFYKK-AGFLFIQLPSGRKLAYAK 542

Query: 572 ------DVGNNRSYLNTTTR-QLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDI 624
                 D G    Y     +   T + TYGGKL ENIVQA +RD+LAE M+   KAGY I
Sbjct: 543 AHLEQGDYGPAIFYEGQGDKVAFTEQQTYGGKLVENIVQATARDVLAEAMVRLEKAGYPI 602

Query: 625 VLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           V  VHDE V E P+ ++ +   +  +M+  P WA+GLPL AEG+E+K Y K
Sbjct: 603 VFHVHDEAVAEVPEGEK-SIEEMNEIMSVVPDWAEGLPLNAEGFETKYYMK 652


>gi|94989082|ref|YP_597183.1| phage-related DNA polymerase [Streptococcus pyogenes MGAS9429]
 gi|94542590|gb|ABF32639.1| phage-related DNA polymerase [Streptococcus pyogenes MGAS9429]
          Length = 640

 Score =  327 bits (838), Expect = 5e-87,   Method: Compositional matrix adjust.
 Identities = 240/703 (34%), Positives = 348/703 (49%), Gaps = 92/703 (13%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYA--EDVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M  L ID ET S  D+ K G+ KYA  ED  ++LFA+  D   VE  D      +P+ +K
Sbjct: 1   MRHLNIDIETYSSNDI-KNGVYKYADAEDFEILLFAYSIDGGEVECLDLTRQS-LPEDIK 58

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIH--RWICTLVLARSNGLPSALKAVGEAL 116
           + L +  V   A N+ FER  L     L   +   +W CT+VLA+  GLP++L+     L
Sbjct: 59  DMLFDDKVRKHAFNAQFERVCLSRYLGLPYYLDPAQWQCTMVLAQELGLPASLEKCALYL 118

Query: 117 KLSSQKMEEGKELIARF---CKGETHECLYDRNKPNHREA-WRLFGEYCKGDVTVTREIF 172
           KL+ +K   GK LI  F   CK         RN P H    W++F  YC  DV V   I 
Sbjct: 119 KLAQEKDAAGKNLIKYFSVPCKPTKANGGRTRNLPEHDPGKWQMFINYCMQDVVVEMAIA 178

Query: 173 KRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLV 230
           ++LE  P+  +E + +  DQ INDRG  +D  L  +     DV+   L  EL++LT    
Sbjct: 179 EKLESVPVHDREWDYYVCDQRINDRGVALDKELVASALYCKDVKMESLSGELKALTGLDN 238

Query: 231 SSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLK 290
            +SR   +L  WL  E G     LT+   ++ L   KK   +  +V   +++ + S++ K
Sbjct: 239 PNSRA--QLLPWL-KEHGYSANGLTKADVEQEL---KKAEGELKRVLELKLQTAMSSLKK 292

Query: 291 LNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSI 350
              +  AM SDGR+ G LQF GASRTGRW+G V   QNL R     ++LD    ++    
Sbjct: 293 YEAMERAMCSDGRVHGLLQFYGASRTGRWAGRVVQVQNLAR--NYIKDLDDAREYVKKR- 349

Query: 351 TSDPDPLQIISDC--------VRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAF 402
             D D ++I+ D         VR+ ++A +G    V+D + IEARV+AW AGEQW+L  F
Sbjct: 350 --DIDAVEILYDSLNDTLKQLVRTALVAKDGYTFYVSDFSAIEARVIAWFAGEQWRLDVF 407

Query: 403 ETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTF 462
            T   +Y  + ++ F +   ++ K+ R  GK+ ELALGYQGG  A ++M +   LN+   
Sbjct: 408 STHGKIYEASASQMFGIPIEEIDKELRQKGKISELALGYQGGPGALKQMGA---LNMG-- 462

Query: 463 AHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWN 522
                                 ++E   +  ++D             WR+ + ++ + W 
Sbjct: 463 ----------------------VKEEELQGVVDD-------------WRRANKKIVQFWK 487

Query: 523 ELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYR-------DVGN 575
           ++ +A  + I++   I   K R       +  K  L + LPSGR+L Y        D G+
Sbjct: 488 DVQRAAIKAIKSRAPIKLGKIR------FRYRKGFLFITLPSGRNLAYARAKVEPGDYGD 541

Query: 576 NRSYLNTTTRQ-LTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVC 634
              Y     R   T + TYGGKL ENIVQA +RDILAE ++    AGYD+V  VHDE + 
Sbjct: 542 KIIYEGQGDRAYFTAQETYGGKLVENIVQATARDILAEALLRIEAAGYDVVFHVHDEAII 601

Query: 635 ETPD--TDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           E      +E N      LM+  P WA+GLPL +EGY +K Y K
Sbjct: 602 EGSGLIIEEVN-----DLMSQAPEWAEGLPLNSEGYVTKYYMK 639


>gi|297585291|ref|YP_003701071.1| DNA-directed DNA polymerase [Bacillus selenitireducens MLS10]
 gi|297143748|gb|ADI00506.1| DNA-directed DNA polymerase [Bacillus selenitireducens MLS10]
          Length = 655

 Score =  326 bits (835), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 227/707 (32%), Positives = 339/707 (47%), Gaps = 93/707 (13%)

Query: 2   ATLFIDFETRSPIDLTKCGICKYAED--VCVILFAFGFDDHPVELWDCVHDPVMPQVLKE 59
           + L ID ET S +DL + G+  YAE     ++L A+ FDD  V + D V D  +P  + +
Sbjct: 8   SVLSIDIETFSNVDLKESGVYAYAEGEGFTILLLAYAFDDEEVIVVDLVQDEPIPTTVLK 67

Query: 60  ALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKLS 119
           AL +  +   A+N+ FERT L A  N  +P  +W C+ V A + GLP  L  V   L L 
Sbjct: 68  ALIDPSIMKTAYNANFERTCLAAYLNQPMPTEQWHCSSVHALTLGLPGHLDGVANVLNLG 127

Query: 120 SQKMEEGKELIARF---CKGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTREIFKRL 175
            QK   GK LI  F   CK         RN P H  E W  +  YC+ DV V R + KRL
Sbjct: 128 DQKDNAGKALIRYFSVPCKPTASNGHRTRNLPEHDLEKWHAYKAYCRQDVEVERALRKRL 187

Query: 176 --EPLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSSS 233
              P+  KEQ LW LDQ +ND G  +D  L     Q+   E+  L +E + +T GL  + 
Sbjct: 188 ASNPIPEKEQRLWELDQRMNDEGVRIDTDLVRQAIQLDAKEQALLLEEAKQIT-GL-ENP 245

Query: 234 RCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLNT 293
             + +L+ WL    G+    L +     +L ++  L     +V   R   S+++V K   
Sbjct: 246 NSVAQLRDWL-TSRGIETSGLAKKQVSDLLQTD--LPGDVRRVLILRQMMSKTSVKKYEA 302

Query: 294 LVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELD-----------QI 342
           +  ++  DG +RG LQF GA+RTGRW+G +    NLP+      +LD           ++
Sbjct: 303 MDRSICKDGHIRGLLQFYGANRTGRWAGRIVQAHNLPK--HRIGDLDEARQLVKTGNYEL 360

Query: 343 ITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAF 402
           IT L  S+        ++S   R+  I  +G + VV+D + IEARV+AW+AGE+W++K F
Sbjct: 361 ITTLYGSLAD------LLSQLTRTAFIPKKGYRFVVSDFSAIEARVIAWLAGERWRMKVF 414

Query: 403 ETGEDLYVTTYARSFNVAPAQVTKDQ--RAIGKVMELALGYQGGAKAFQKMAS-TTGLNL 459
           E    +Y  + ++ F V   ++TK    R  GK+ ELALGY G   A  +M +   GL+ 
Sbjct: 415 EGHGKIYEASASQMFGVPIEEITKASPLRQKGKIAELALGYGGAKGALTQMGALEMGLSE 474

Query: 460 NTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSE 519
           +    LV                                         KAWR+ +  +  
Sbjct: 475 DELPALV-----------------------------------------KAWRKANPNIVN 493

Query: 520 LWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVY--RDVGNNR 577
           LW +L ++  + ++  K + A+       +        L   LPSGRSL Y    +G + 
Sbjct: 494 LWYDLEKSAFEAVKWQKVVTAKSG-----IQFYGGSGLLRARLPSGRSLSYVRPQIGIDE 548

Query: 578 SY---------LNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTV 628
            +         +   ++Q  R  TYGGK+ EN+VQA++RD LAE M+    AGY I   V
Sbjct: 549 RFGREEITYEGVMQGSKQWGRISTYGGKIAENMVQAIARDCLAEAMLRLDAAGYQIRFHV 608

Query: 629 HDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           HDE+V E P+  +  A  +  +M+    WA GLP+ A+ +E+  Y+K
Sbjct: 609 HDEVVIEVPNEQDAKAD-IERIMSEPIDWAPGLPMNADSFETGYYKK 654


>gi|71911263|ref|YP_282813.1| phage-encoded DNA polymerase [Streptococcus pyogenes MGAS5005]
 gi|94992973|ref|YP_601072.1| phage-related DNA polymerase [Streptococcus pyogenes MGAS2096]
 gi|71854045|gb|AAZ52068.1| phage-encoded DNA polymerase [Streptococcus pyogenes MGAS5005]
 gi|94546481|gb|ABF36528.1| phage-related DNA polymerase [Streptococcus pyogenes MGAS2096]
          Length = 640

 Score =  326 bits (835), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 240/703 (34%), Positives = 347/703 (49%), Gaps = 92/703 (13%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYA--EDVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M  L ID ET S  D+ K G+ KYA  ED  ++LFA+  D   VE  D      +P+ +K
Sbjct: 1   MRHLNIDIETYSSNDI-KNGVYKYADAEDFEILLFAYSIDGGEVECLDLTRQS-LPEDIK 58

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIH--RWICTLVLARSNGLPSALKAVGEAL 116
           + L +  V   A N+ FER  L     L   +   +W CT+VLA+  GLP++L+     L
Sbjct: 59  DMLFDDKVRKHAFNAQFERVCLSRYLGLPYYLDPAQWQCTMVLAQELGLPASLEKCALYL 118

Query: 117 KLSSQKMEEGKELIARF---CKGETHECLYDRNKPNHREA-WRLFGEYCKGDVTVTREIF 172
           KL+ +K   GK LI  F   CK         RN P H    W++F  YC  DV V   I 
Sbjct: 119 KLAQEKDAAGKNLIKYFSVPCKPTKANGGRTRNLPEHDPGKWQMFINYCMQDVVVEMAIA 178

Query: 173 KRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLV 230
           ++LE  P+  +E + +  DQ INDRG  +D  L  +     DV+   L  EL++LT    
Sbjct: 179 EKLESVPVHDREWDYYVCDQRINDRGVALDKELVASALYCKDVKMESLSGELKALTGLDN 238

Query: 231 SSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLK 290
            +SR   +L  WL  E G     LT+   ++ L   KK   +  +V   +++ + S++ K
Sbjct: 239 PNSRA--QLLPWL-KEHGYSANGLTKADVEQEL---KKAEGELKRVLELKLQTAMSSLKK 292

Query: 291 LNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSI 350
              +  AM SDGR+ G LQF GASRTGRW+G V   QNL R     ++LD    ++    
Sbjct: 293 YEAMERAMCSDGRVHGLLQFYGASRTGRWAGRVVQVQNLAR--NYIKDLDDAREYVKKR- 349

Query: 351 TSDPDPLQIISDC--------VRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAF 402
             D D ++I+ D         VR+ ++A +G    V+D + IEARV+AW AGEQW+L  F
Sbjct: 350 --DIDAVEILYDSLNDTLKQLVRTALVAKDGYTFYVSDFSAIEARVIAWFAGEQWRLDVF 407

Query: 403 ETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTF 462
            T   +Y  + ++ F +   ++ K+ R  GK+ ELALGYQGG  A ++M +   LN+   
Sbjct: 408 STHGKIYEASASQMFGIPIEEIDKELRQKGKISELALGYQGGPGALKQMGA---LNMG-- 462

Query: 463 AHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWN 522
                                 ++E   +  ++D             WR+ + ++ + W 
Sbjct: 463 ----------------------VKEEELQGLVDD-------------WRRANKKIVQFWK 487

Query: 523 ELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYR-------DVGN 575
           ++ +A  + I++   I   K R       +  K  L + LPSGR+L Y        D G+
Sbjct: 488 DVQRAAIKAIKSRAPIKLGKIR------FRYRKGFLFITLPSGRNLAYARAKVEPGDYGD 541

Query: 576 NRSYLNTTTRQ-LTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVC 634
              Y     R   T + TYGGKL ENIVQA +RDILAE ++    AGYD+V  VHDE + 
Sbjct: 542 KIIYEGQGDRAYFTAQETYGGKLVENIVQATARDILAEALLRIEAAGYDVVFHVHDEAII 601

Query: 635 ETPD--TDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           E      +E N      LM   P WA+GLPL +EGY +K Y K
Sbjct: 602 EGSGLIIEEVN-----DLMAQAPEWAEGLPLNSEGYVTKYYMK 639


>gi|304439199|ref|ZP_07399117.1| DNA-directed DNA polymerase [Peptoniphilus duerdenii ATCC BAA-1640]
 gi|304372331|gb|EFM25919.1| DNA-directed DNA polymerase [Peptoniphilus duerdenii ATCC BAA-1640]
          Length = 643

 Score =  325 bits (834), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 229/706 (32%), Positives = 347/706 (49%), Gaps = 95/706 (13%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M  + ID ET S +DL K G+ KYAE  D  ++LFA+  DD  V++ D     ++P+ + 
Sbjct: 1   MKKISIDLETYSSVDLGKSGVYKYAESEDFEILLFAYSIDDGEVKVIDLASGEIIPEEIL 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKL 118
            AL +  +   A N+ FER  L       +    W CT++ +   GLP +L+ VGE LKL
Sbjct: 61  SALSDESIEKWAFNANFERVCLSRFLEERLKPQGWYCTMIWSAYLGLPLSLEKVGEVLKL 120

Query: 119 SSQKMEEGKELIARF---CKGETHECLYDRNKPNHREA-WRLFGEYCKGDVTVTREIFKR 174
             QKM EGK LI  F   CK      +  RN P+H    W +F EY + DV    EI K+
Sbjct: 121 DKQKMNEGKALIRYFSIPCKPTKTNGMRTRNLPHHDLGKWYIFKEYNQRDVETEMEIKKK 180

Query: 175 LE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTK-LDQELESLTYGLVS 231
           L   P+   E E +++DQ INDRG  +D  L  +  +  ++ R + +D+ +E LT GL +
Sbjct: 181 LSVFPMPQSEWENYWVDQNINDRGILIDEILVDSAIKFDEILREENMDRAIE-LT-GLEN 238

Query: 232 SSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKL 291
            +  L+ LK WL  + GL ++ L +   +   S+ K       +V   R   S+S+V K 
Sbjct: 239 PNSPLQ-LKEWLN-KKGLEIDSLAKKDVE---SAIKNAEGDIKEVLELRQELSKSSVRKY 293

Query: 292 NTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSIT 351
           + +      + R RG +QF GA+RTGR+SG +   QNL R   + ++LD     L  S+ 
Sbjct: 294 DAMKNVKGKENRARGLIQFYGANRTGRYSGRLIQVQNLRR--NNLKDLD-----LARSLV 346

Query: 352 SDPD----------PLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKA 401
            + D          P  I+S  +R+  I  EG + +++D + IEARVLAW+A EQW L A
Sbjct: 347 KNRDYETMEFLYESPSDILSQLIRTAFIPKEGTRFIISDFSAIEARVLAWIAEEQWVLDA 406

Query: 402 FETGEDLYVTTYARSFNVAPAQ--VTKDQRAIGKVMELALGYQGGAKAFQKMAST-TGLN 458
           FE GED+Y  T +R F V   +  +    R  GK+  LA GYQG   A + M     GL+
Sbjct: 407 FENGEDIYCRTASRMFGVPVEKHGINGHLRQKGKIATLACGYQGALGALKAMGGIEMGLS 466

Query: 459 LNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVS 518
            +    +V +                                         WR+ +  + 
Sbjct: 467 EDELQSIVDS-----------------------------------------WREANPNIV 485

Query: 519 ELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVY--RDVGNN 576
            LW ++    ++ ++       R + +   + +  +K  L + LPS R L Y    +G N
Sbjct: 486 SLWWDIDSVVKRVVK------TRSKEEYKNLVISYEKGILFIELPSKRRLAYPKAKIGMN 539

Query: 577 RSYLNTTT-------RQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVH 629
           R    +          +  +  +YGGK  ENIVQA++RDILAE MM   K G++IV+ +H
Sbjct: 540 RFGGESVVYEGIVVGNKWDKIESYGGKFVENIVQAIARDILAEAMMRLEKKGFNIVMHIH 599

Query: 630 DEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           DE+V E   +D  +   +  +M+  P WA GL L A+G+ES+ Y+K
Sbjct: 600 DEVVIE---SDSSSIEEVNQIMSIVPGWASGLILDADGFESEFYKK 642


>gi|315656936|ref|ZP_07909823.1| prophage LambdaSa04 DNA-directed DNA polymerase [Mobiluncus
           curtisii subsp. holmesii ATCC 35242]
 gi|315492891|gb|EFU82495.1| prophage LambdaSa04 DNA-directed DNA polymerase [Mobiluncus
           curtisii subsp. holmesii ATCC 35242]
          Length = 655

 Score =  325 bits (833), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 244/712 (34%), Positives = 336/712 (47%), Gaps = 95/712 (13%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M TLF D ET SP+ L K G+  Y E  D  ++LF++  D  PVE+ D  +   MP  + 
Sbjct: 1   MRTLFCDIETFSPVQLAKAGVYPYCEHPDFDLLLFSYSVDGGPVEIVDLANGQSMPDEVL 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLD---------IPIHRWICTLVLARSNGLPSAL 109
            AL + DV   AHN+ FER  L A  +           +   +W CT+V +   GLP +L
Sbjct: 61  AALVDPDVVKWAHNAAFERVCLSAWLHRHHSELLGDGFLDPRQWRCTMVWSAYLGLPMSL 120

Query: 110 KAVGEALKLSSQKMEEGKELIARFCKGETHECLYD---RNKPNHRE-AWRLFGEYCKGDV 165
            A+   LKL  QK   G++LI +FC   T   L     RN P+     W  F +Y + DV
Sbjct: 121 DAIAAVLKLDVQKDSAGRKLIKQFCTPATPSVLNGGKHRNPPSADPTGWAHFIDYNRRDV 180

Query: 166 TVTREIFKRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELE 223
            V + I  RL   P+   E + + LDQ IND G  +D  L      + +  R       +
Sbjct: 181 EVEQAIHDRLACFPMPESEWDTYALDQRINDAGILLDHTLVDNAVAVDEHHRNASLARAQ 240

Query: 224 SLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRA 283
            LT GL + +  ++ LK WL    G  LE L +      L +    T    +V   R   
Sbjct: 241 KLT-GLDNPNSPIQ-LKQWLATR-GCELESLAKAEVDSALDTA---TGAVKEVLELRGDL 294

Query: 284 SRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQII 343
           ++S+V K   +     SDGR RG +QF GA RTGR++G +   QNLPR      +LDQ  
Sbjct: 295 AKSSVKKYQAMQNVAGSDGRARGLIQFYGAGRTGRFAGRLVQVQNLPR--NYLPDLDQAR 352

Query: 344 THLPTS--------ITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGE 395
           T + T           S PD L   S  +R+  I S G + +VAD + IEARV+AW+AGE
Sbjct: 353 TLVRTGNLDALELLYESVPDTL---SQLIRTAFIPSTGHRFIVADFSAIEARVIAWLAGE 409

Query: 396 QWKLKAFETGEDLYVTTYARSFNVAPAQ---VTKDQRAIGKVMELALGYQGGAKAFQKMA 452
              L+AF  G+DLY  T +R F V P +   V  + R  GK+  LA GY G   A + M 
Sbjct: 410 TSTLEAFREGKDLYCETASRMFGV-PVEKHGVNGELRQKGKIAVLACGYGGSVGALKAMG 468

Query: 453 STTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQ 512
           +   LN+    H +K                                      +  AWRQ
Sbjct: 469 A---LNMGLAEHELKP-------------------------------------IVDAWRQ 488

Query: 513 KHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRD 572
            +  +  LW ++ +A    I + + I  R  R         +     + LPSGR L Y  
Sbjct: 489 ANPHIVGLWADVEEAAIAAISSRQPIRLRNLR------FSVESGIFFIELPSGRRLAYVQ 542

Query: 573 --VGNNR-------SYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYD 623
             +G NR           TT R+  +  TYGGKL ENIVQA++RD+L  GM    KAG+ 
Sbjct: 543 PRLGENRWGGTSVTYTGTTTARRWGQLETYGGKLVENIVQAIARDLLVTGMHAVAKAGHQ 602

Query: 624 IVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           IV+ VHDEIV + P+   F  +    LM++ P+WA+GLPL A+GYE   YRK
Sbjct: 603 IVMHVHDEIVIDEPENSGFTVTDACALMSTLPAWAEGLPLDADGYECAYYRK 654


>gi|29374964|ref|NP_814117.1| DNA polymerase, putative [Enterococcus faecalis V583]
 gi|29342422|gb|AAO80188.1| DNA polymerase, putative [Enterococcus faecalis V583]
 gi|315574067|gb|EFU86258.1| DNA-directed DNA polymerase [Enterococcus faecalis TX0309B]
 gi|315582012|gb|EFU94203.1| DNA-directed DNA polymerase [Enterococcus faecalis TX0309A]
          Length = 653

 Score =  325 bits (833), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 243/711 (34%), Positives = 343/711 (48%), Gaps = 95/711 (13%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M TL ID ET S  DLTK G+ KYA+  +  ++LFA+  D  PVE  D     + P  + 
Sbjct: 1   MKTLNIDIETYSDEDLTKVGVYKYADSPNFEILLFAYSVDGQPVECEDLTISEI-PDEIV 59

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIH----RWICTLVLARSNGLPSALKAVGE 114
            AL + +V  +A N+ FER  L     L IP +    +W CT+V A   GLP++L    +
Sbjct: 60  AALTDKNVLKIAFNAQFERVCLSKY--LGIPYYLDPAQWHCTMVHANELGLPASLGQCAK 117

Query: 115 ALKLSSQKMEEGKELIARF---CKGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTRE 170
            L +  QK   G +LI  F   CK      +  RN P H  E W+ F EYC  DV V   
Sbjct: 118 YLNIEQQKDTRGTQLINFFSKPCKPTKKNGMRTRNLPEHAPEKWQTFIEYCIQDVNVEMA 177

Query: 171 IFKRLE--PLSSKEQELWYLDQTINDRGYCVDVALA-HTLNQIVDVERTKLDQELESLTY 227
           I  +L   P+   E +L+ LDQ INDRG  +D  LA   ++ + D+    L+ E+++LT 
Sbjct: 178 IANKLNRFPVPESEWKLYTLDQRINDRGAEIDHELATAAIDIMADLSEAGLN-EMKALT- 235

Query: 228 GLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSA 287
           GL  +   L +LK WL  E G   E L +    + L+    L     +V   R+  S S+
Sbjct: 236 GL-ENPNSLAQLKKWL-EEQGTPFEKLGKEVVLKALALGN-LPENVAEVLKLRLSLSNSS 292

Query: 288 VLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELD------- 340
             K   +  A  SD R+ G LQF GA+RTGRW+G +   QNLPR   S  E+D       
Sbjct: 293 TKKYLMMDNARCSDNRIHGILQFYGANRTGRWAGRLLQVQNLPRNYLS--EIDFARQLVK 350

Query: 341 -QIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKL 399
            + +  +       PD L+     +R+ ++A EG + +V+D + IEARV+AW A + W L
Sbjct: 351 AKDVEGIELMYEDVPDTLK---QLIRTGLVAKEGHRFIVSDFSAIEARVIAWYAKQDWVL 407

Query: 400 KAFETGEDLYVTTYARSFNVA-------PAQVTKDQRAIGKVMELALGYQGGAKAFQKMA 452
           + F T   +Y  T A+ F++         +   KD R  GKV  LALGYQGG  A + M 
Sbjct: 408 EVFRTHGKIYEATAAQMFHLGEVTDYDWKSHEGKDMRQRGKVATLALGYQGGPGALKAMG 467

Query: 453 STTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQ 512
           +                               ++    EH ++D+            WR 
Sbjct: 468 A-------------------------------LENGIEEHELQDIV---------DRWRT 487

Query: 513 KHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYR- 571
            + R+   W+E  +A    ++NG      K+    L + KK    L + LPSGR L Y  
Sbjct: 488 ANKRIKNFWHETQKAVIDCLQNG----GIKKGPRGLKFYKK-AGFLFIQLPSGRKLAYAK 542

Query: 572 ------DVGNNRSYLNTTTR-QLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDI 624
                 D G    Y     +   T + TYGGKL ENIVQA +RD+LAE M    + GY I
Sbjct: 543 AHLKEGDYGPAIFYEGQGDKVAFTEQQTYGGKLVENIVQATARDVLAEAMQRLEREGYPI 602

Query: 625 VLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           V  VHDE V E P+ ++ +   +  +M+  P WA+GLPL AEG+E+K Y K
Sbjct: 603 VFHVHDEAVAEVPEGEK-SIEEMNKIMSVVPDWAEGLPLNAEGFETKYYMK 652


>gi|325687766|gb|EGD29787.1| prophage LambdaSa04 DNA-directed DNA polymerase [Streptococcus
           sanguinis SK72]
          Length = 643

 Score =  324 bits (831), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 230/701 (32%), Positives = 336/701 (47%), Gaps = 85/701 (12%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAEDVC--VILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M TL ID ET S +DLTKCG+ +Y + +   ++LFA+  D++  ++ D V    +P+ + 
Sbjct: 1   MKTLSIDIETYSDVDLTKCGVYRYVDSLAFEILLFAYKEDENETQVVDLVQGEQIPEEIL 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKL 118
            AL +  +   A N+ FER  L       +    W CT VLA S GLP +L+ VG  L +
Sbjct: 61  LALLDDAIIKTAFNANFERVCLSKFLGEHLSAKSWSCTAVLAASLGLPLSLEGVGRVLNI 120

Query: 119 SSQKMEEGKELIARF---CKGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTREIFKR 174
             QKM+EG  LI  F   CK      + +RN P+H  E W LF  YCK DV V + I  R
Sbjct: 121 EEQKMKEGSRLIRYFCLPCKATKANGMRERNFPHHAPEDWELFKSYCKRDVEVEQAIRVR 180

Query: 175 LE--PLSSKEQELWYLDQTINDRGYCVDVAL---AHTLNQIVDVERTKLDQELESLTYGL 229
           L   PL   EQ  + LDQ INDRG  VD  L   A   +     + TK   EL  L    
Sbjct: 181 LRNYPLLESEQFFYQLDQEINDRGIEVDQQLVEQAILCDLSYKEQVTKRAYELSGL---- 236

Query: 230 VSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVL 289
             +   + +LK WL  E G+ ++ L +    + L   K+   + +++   R+  S+++V 
Sbjct: 237 -ENPNSVSQLKGWL-EEQGVFMDSLGKKEVAKHL---KEADGEVLEMLKLRLLMSKTSVK 291

Query: 290 KLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIIT---HL 346
           K   +   + SDGR+ G LQF GA+RTGRW+G +   QNLP+       L + +      
Sbjct: 292 KYQAIERCVCSDGRVHGLLQFYGANRTGRWAGRLVQVQNLPQNKLKDLSLARTLVKEGQF 351

Query: 347 PTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGE 406
            T  T   +   ++S+ +R+  +   G + +VAD A IEARVLAW++GE W+L+ FE G 
Sbjct: 352 ETLDTLYENVPGVLSELIRTAFVPKAGHQFIVADFAAIEARVLAWLSGESWRLEVFEQGG 411

Query: 407 DLYVTTYARSFNVAPAQ--VTKDQRAIGKVMELALGYQGGAKAFQKMAST-TGLNLNTFA 463
           D+Y  + +  F V   +       R  GK+ ELALGY G   A   M +   GL      
Sbjct: 412 DIYCASASSMFGVPVEKHGANSHLRQKGKIAELALGYGGSVGALTAMGALDMGLEEEELQ 471

Query: 464 HLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNE 523
            LV                                           WR  +  +   W E
Sbjct: 472 PLVNQ-----------------------------------------WRSANPHIVAFWWE 490

Query: 524 LHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRD--VGNNR---- 577
           + +  +Q  E       R+ + +  + +      L + LPSGR L Y    +G N     
Sbjct: 491 IDKVAKQVYET------REPKKIKNLVISYQSGMLFITLPSGRKLAYVKPRMGMNAFGKP 544

Query: 578 --SYLNT-TTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVC 634
             +Y     +++ TR  TYG KL ENIVQ ++RD+LA GM+   + G  IVL VHDE V 
Sbjct: 545 GLTYEGIGESKKWTRLETYGPKLVENIVQGIARDLLAYGMIQLKQKGLAIVLHVHDEAVV 604

Query: 635 ETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           E     E + + +  L+ + P WA+GLPL+A+GY  + Y+K
Sbjct: 605 E---VREESVAKVCQLLATKPDWAEGLPLRADGYACEFYKK 642


>gi|327461124|gb|EGF07457.1| prophage LambdaSa04 DNA-directed DNA polymerase [Streptococcus
           sanguinis SK1057]
          Length = 643

 Score =  324 bits (831), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 230/701 (32%), Positives = 337/701 (48%), Gaps = 85/701 (12%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAEDVC--VILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M TL ID ET S +DLTKCG+ +Y + +   ++LFA+  D++  ++ D V    +P+ + 
Sbjct: 1   MKTLSIDIETYSDVDLTKCGVYRYVDSLAFEILLFAYKEDENETQVVDLVQGEQIPEEIL 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKL 118
            AL +  +   A N+ FER  L       +    W CT VLA S GLP +L+ VG  L +
Sbjct: 61  LALLDDAIIKTAFNANFERVCLSKFLGEHLSAKSWSCTAVLAASLGLPLSLEGVGRVLNI 120

Query: 119 SSQKMEEGKELIARF---CKGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTREIFKR 174
             QKM+EG  LI  F   CK      + +RN P+H  E W LF  YCK DV V + I  R
Sbjct: 121 EEQKMKEGSRLIRYFCLPCKATKANGMRERNFPHHAPEDWELFKSYCKRDVEVEQAIRVR 180

Query: 175 LE--PLSSKEQELWYLDQTINDRGYCVDVAL---AHTLNQIVDVERTKLDQELESLTYGL 229
           L   PL   EQ  + LDQ INDRG  VD  L   A   +     + TK   EL  L    
Sbjct: 181 LRNYPLLESEQFFYQLDQEINDRGIEVDQQLVEQAILCDLSYKEQVTKRAYELSGL---- 236

Query: 230 VSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVL 289
             +   + +LK WL  E G+ ++ L +    + L   K+   + +++   R+  S+++V 
Sbjct: 237 -ENPNSVSQLKGWL-EEQGVFMDSLGKKEVAKHL---KEADGEVLEMLKLRLLMSKTSVK 291

Query: 290 KLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIIT---HL 346
           K   +   + SDGR+ G LQF GA+RTGRW+G +   QNLP+       L + +     +
Sbjct: 292 KYQAIERCVCSDGRVHGLLQFYGANRTGRWAGRLVQVQNLPQNKLKDLSLARTLVKEGQV 351

Query: 347 PTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGE 406
            T  T   +   ++S+ +R+  +   G + +VAD A IEARVLAW++GE W+L+ FE G 
Sbjct: 352 ETLDTLYENVPGVLSELIRTAFVPKAGHQFIVADFAAIEARVLAWLSGESWRLEVFEQGG 411

Query: 407 DLYVTTYARSFNVAPAQ--VTKDQRAIGKVMELALGYQGGAKAFQKMAST-TGLNLNTFA 463
           D+Y  + +  F V   +       R  GK+ ELALGY G   A   M +   GL      
Sbjct: 412 DIYCASASSMFGVPVEKHGANSHLRQKGKIAELALGYGGSVGALTAMGALDMGLEEEELQ 471

Query: 464 HLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNE 523
            LV                                           WR  +  +   W E
Sbjct: 472 PLVNQ-----------------------------------------WRSANPHIVAFWWE 490

Query: 524 LHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRD--VGNNR---- 577
           + +  +Q  E       R+ + +  + +      L + LPSGR L Y    +G N     
Sbjct: 491 IDKVAKQVYET------REPKKIKNLVISYQSGMLFITLPSGRKLAYVKPRMGMNAFGKP 544

Query: 578 --SYLNT-TTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVC 634
             +Y     +++ TR  TYG KL ENIVQ ++RD+LA GM+   + G  IVL VHDE V 
Sbjct: 545 GLTYEGIGESKKWTRLETYGPKLVENIVQGIARDLLAYGMIQLKQKGLAIVLHVHDEAVV 604

Query: 635 ETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           E     E + + +  L+ + P WA+GLPL+A+GY  + Y+K
Sbjct: 605 E---VREESVAKVCQLLATKPDWAEGLPLRADGYACEFYKK 642


>gi|281416455|ref|YP_003347375.1| DNA polymerase [Enterococcus phage phiFL4A]
 gi|270209631|gb|ACZ64170.1| DNA polymerase [Enterococcus phage phiFL4A]
          Length = 653

 Score =  324 bits (830), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 242/711 (34%), Positives = 342/711 (48%), Gaps = 95/711 (13%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M TL ID ET S  DLTK G+ KYA+  +  ++LFA+  D  PVE  D     + P  + 
Sbjct: 1   MKTLNIDIETYSDEDLTKVGVYKYADSPNFEILLFAYSVDGQPVECEDLTISEI-PDEIV 59

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIH----RWICTLVLARSNGLPSALKAVGE 114
            AL + +V  +A N+ FER  L     L +P +    +W CT+V A   GLP++L    +
Sbjct: 60  AALTDKNVLKIAFNAQFERVCLSKY--LGVPYYLDPAQWHCTMVHANELGLPASLGQCAK 117

Query: 115 ALKLSSQKMEEGKELIARF---CKGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTRE 170
            L +  QK   G +LI  F   CK      +  RN P H  E W+ F EYC  DV V   
Sbjct: 118 YLNIEQQKDTRGTQLINFFSKPCKPTKKNGMRTRNLPEHAPEKWQTFIEYCIQDVNVEMA 177

Query: 171 IFKRLE--PLSSKEQELWYLDQTINDRGYCVDVALA-HTLNQIVDVERTKLDQELESLTY 227
           I  +L   P+   E +L+ LDQ INDRG  +D  LA   ++ + D+    L+ E++ LT 
Sbjct: 178 IANKLNRFPVPESEWKLYTLDQRINDRGAEIDHELATAAIDIMADLSEAGLN-EMKELT- 235

Query: 228 GLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSA 287
           GL  +   L +LK WL  E G   E L +    + L+    L     +V   R+  S S+
Sbjct: 236 GL-ENPNSLAQLKKWL-EEQGTPFEKLGKEVVLKALALGN-LPENVAEVLKLRLSLSNSS 292

Query: 288 VLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELD------- 340
             K   +  A  SD R+ G LQF GA+RTGRW+G +   QNLPR   S  E+D       
Sbjct: 293 TKKYLMMDNARCSDNRIHGILQFYGANRTGRWAGRLLQVQNLPRNYLS--EIDFARQLVK 350

Query: 341 -QIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKL 399
            + +  +       PD L+     +R+ ++A EG + +V+D + IEARV+AW A + W L
Sbjct: 351 AKDVEGIELMYEDVPDTLK---QLIRTGLVAKEGHRFIVSDFSAIEARVIAWYAKQDWVL 407

Query: 400 KAFETGEDLYVTTYARSFNVA-------PAQVTKDQRAIGKVMELALGYQGGAKAFQKMA 452
           + F T   +Y  T A+ F++         +   KD R  GKV  LALGYQGG  A + M 
Sbjct: 408 EVFRTHGKIYEATAAQMFHLGEVTDYDWKSHEGKDMRQRGKVATLALGYQGGPGALKAMG 467

Query: 453 STTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQ 512
           +                               ++    EH ++D+            WR 
Sbjct: 468 A-------------------------------LENGIEEHELQDIV---------DRWRT 487

Query: 513 KHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYR- 571
            + R+   W+E  +A    ++NG      K+    L + KK    L + LPSGR L Y  
Sbjct: 488 ANKRIKNFWHETQKAVIDCLQNG----GIKKGPRGLKFYKK-AGFLFIQLPSGRKLAYAK 542

Query: 572 ------DVGNNRSYLNTTTR-QLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDI 624
                 D G    Y     +   T + TYGGKL ENIVQA +RD+LAE M    + GY I
Sbjct: 543 AHLKEGDYGPAIFYEGQGDKVAFTEQQTYGGKLVENIVQATARDVLAEAMQRLEREGYPI 602

Query: 625 VLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           V  VHDE V E P+ ++ +   +  +M+  P WA+GLPL AEG+E+K Y K
Sbjct: 603 VFHVHDEAVAEVPEGEK-SIEEMNEIMSVVPDWAEGLPLNAEGFETKYYMK 652


>gi|323484113|ref|ZP_08089483.1| hypothetical protein HMPREF9474_01234 [Clostridium symbiosum
           WAL-14163]
 gi|323402555|gb|EGA94883.1| hypothetical protein HMPREF9474_01234 [Clostridium symbiosum
           WAL-14163]
          Length = 646

 Score =  323 bits (828), Expect = 5e-86,   Method: Compositional matrix adjust.
 Identities = 230/698 (32%), Positives = 341/698 (48%), Gaps = 83/698 (11%)

Query: 4   LFIDFETRSPIDLTKCGICKYAEDVC--VILFAFGFDDHPVELWDCVHDPVMPQVLKEAL 61
           L ID ET S +DL KCG+  YA+     V+LFA+ FD    ++ D      +P  +  A+
Sbjct: 5   LEIDIETYSDVDLIKCGVYAYADSPAFEVLLFAYSFDGGETQVIDLAQGEELPGEVSAAI 64

Query: 62  ENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKLSSQ 121
            + DV   A N+ FERT L   F   +    W C+ V A    LP +L+ VG  L L  Q
Sbjct: 65  FDDDVMKTAFNANFERTCLSKHFGKQLSPESWHCSAVQAAMLALPRSLEEVGAVLGLEQQ 124

Query: 122 KMEEGKELIARF---CKGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTREIFKRLE- 176
           KM+EGK+LI  F   CK         RN P H  E W LF  YC  DV V +EI ++L+ 
Sbjct: 125 KMKEGKDLIRYFCMPCKPTKANGGRTRNLPCHAPEKWELFKSYCIRDVDVEKEIRRKLQH 184

Query: 177 -PLSSKEQELWYLDQTINDRGYCVDVAL---AHTLNQIVDVERTKLDQELESLTYGLVSS 232
            P+   E EL+ LDQ INDRG  VD  L   A + + +     TK   EL  L      +
Sbjct: 185 FPIPESEMELYRLDQKINDRGVLVDRELVRQAVSCDLLYKDVVTKRAYELTGL-----EN 239

Query: 233 SRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLN 292
              + ++K+WL  E G+ +E L++ T   ++  +     + +++   R+  ++++V K  
Sbjct: 240 PNSVAQIKSWLG-ENGVEMESLSKKTVAGLIEESDGEVQELLRL---RLLMAKTSVKKYE 295

Query: 293 TLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHL----PT 348
            +  ++ SDGR+ G LQF GA+RTGRW+G +   QNLP+      E+ + +         
Sbjct: 296 AMERSVCSDGRVHGLLQFYGANRTGRWAGRLVQVQNLPQNHILDLEMARNLVKQGRFEDV 355

Query: 349 SITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDL 408
            +  D  P  ++S+ +R+  I   G + VVAD + IEARVLAW++GE+W+L+ F +   +
Sbjct: 356 ELLYDSTP-NVLSELIRTAFIPKPGYRFVVADFSAIEARVLAWLSGERWRLEVFASHGKI 414

Query: 409 YVTTYARSFNVAPAQVTKDQ--RAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLV 466
           Y  + +  F+V   +VTK    R  GK+ ELALGY G   A   M +   L++     LV
Sbjct: 415 YEASASAMFHVPIEEVTKGSPFRQKGKISELALGYGGAVGALTSMGA---LDMG----LV 467

Query: 467 KTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELHQ 526
           +   AP                                 +  AWR  +  +++ W ++  
Sbjct: 468 EEELAP---------------------------------LVSAWRSANPHITQFWWDVDA 494

Query: 527 AFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRD--VGNNRSYLNTTT 584
           A        KA+  +K+     +  +     L + LPSGR L Y    +  N+   N  T
Sbjct: 495 A------AVKAVTEKKKTRAGRIVFEYKSGILFVELPSGRKLSYVKPRMALNKFGRNGLT 548

Query: 585 -------RQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETP 637
                  ++  R  TYG KL ENIVQ  +RD+LAE M+   + GY IV+  HDEI+ E P
Sbjct: 549 YEGIAENKKWDRIETYGPKLVENIVQGTARDLLAEAMLRVEEMGYPIVMHCHDEIIAEVP 608

Query: 638 DTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           +       M   +M   P WA GLPL+A+GYE   Y+K
Sbjct: 609 EGTGSVEEMC-AVMAVQPEWADGLPLRADGYECAFYKK 645


>gi|300856814|ref|YP_003781798.1| phage related DNA polymerase [Clostridium ljungdahlii DSM 13528]
 gi|300436929|gb|ADK16696.1| phage related DNA polymerase [Clostridium ljungdahlii DSM 13528]
          Length = 650

 Score =  322 bits (825), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 239/715 (33%), Positives = 333/715 (46%), Gaps = 106/715 (14%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M TL ID ET   +D+ K G  KY E     ++LFA+ F+D PVE+ D      +PQ +K
Sbjct: 1   MDTLAIDVETYCELDIKKVGAYKYCEHPSFQILLFAYAFNDEPVEVIDFAQGEELPQKVK 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKL 118
            AL N  +   A N+ FE   LK      I    W CT+V +   GLP +L  VG+ L+ 
Sbjct: 61  TALLNPGILKTAFNANFEINALKKYLINGIDAEDWQCTMVQSLILGLPGSLDMVGKVLRF 120

Query: 119 --SSQKMEEGKELIARFCK---------GETHECLYDRNKPNHR-EAWRLFGEYCKGDVT 166
               QKM+EGK LI  FCK         G T      RN P H  E W +F +Y K DV 
Sbjct: 121 EEDKQKMKEGKALIQYFCKPCKPTKSNGGRT------RNLPEHAPEKWEIFKKYNKQDVE 174

Query: 167 VTREIFKRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELES 224
           V R I  +L   P +  EQ LW LDQ INDRG   D+ L     +  +    +L +E   
Sbjct: 175 VERAIRNKLNRYPTTENEQRLWELDQCINDRGVGADIELIEKAIECNNSYNKRLTKEATE 234

Query: 225 LTYGLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRAS 284
           LT GL S+     +LK W+    G  ++ LT+ +   ++  +K    +  ++   R   +
Sbjct: 235 LT-GL-SNPNSPTQLKRWIGERVGHEVKSLTKDSIPTLIKESK--DEKVKKILELRQLMA 290

Query: 285 RSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSH-EELDQII 343
           ++++ K  T+  A   DGR+RG LQF GA+RTGRW+G +   QNLP   ++H  +LD   
Sbjct: 291 KTSIKKYETMQRARCEDGRMRGLLQFYGANRTGRWAGRLVQVQNLP---QNHLPDLDDAR 347

Query: 344 THLPTS--------ITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGE 395
             + T           S PD L   S  +R+  I  EG + +VAD + IEARV+AW AGE
Sbjct: 348 NFIRTGQFDKVEFLYDSIPDTL---SQLIRTAFIPKEGNRFIVADFSAIEARVIAWYAGE 404

Query: 396 QWKLKAFETGEDLYVTTYARSFNVAPAQ--VTKDQRAIGKVMELALGYQGGAKAFQKMAS 453
           QW+L  F    D+Y  + ++ F V   +  +    R  GK+ ELALGY G   A   M  
Sbjct: 405 QWRLDVFNNNGDIYCASASKMFKVPVEKHGINGHLRQKGKIAELALGYGGSVGALMSMDK 464

Query: 454 TTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQK 513
                                           ++N PE  +  L          K WR  
Sbjct: 465 --------------------------------KKNIPEDELPGLV---------KDWRDA 483

Query: 514 HSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKK---DKNNLILMLPSGRSLVY 570
              +++ W ++ +A ++ I        R+R  V L +  K   D   L + LPSGR L Y
Sbjct: 484 SPHITKFWWDVDKAAKKAI--------RERTTVVLQFGLKFIYDPGVLFIQLPSGRKLAY 535

Query: 571 -RDVGNNRSY---------LNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKA 620
            R       Y         L  T++Q T   TYG K+ ENIVQA +RD L   M      
Sbjct: 536 IRPKIEPGPYDKPIITYEGLQQTSKQWTTLETYGPKIVENIVQATARDCLGITMQRVEDK 595

Query: 621 GYDIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           G+ IV+ VHDE++C+ P   +     +  +      WA GLPLKA+GYE   Y K
Sbjct: 596 GFHIVMHVHDELICDVP-KGKGTVEEICDIFGEPIEWAPGLPLKADGYECNYYMK 649


>gi|325690425|gb|EGD32428.1| prophage LambdaSa04 DNA-directed DNA polymerase [Streptococcus
           sanguinis SK115]
          Length = 645

 Score =  321 bits (823), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 229/710 (32%), Positives = 334/710 (47%), Gaps = 101/710 (14%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAED--VCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M TL ID ET S +DLTKCG+ +Y +     ++LFA+  D+   ++ D      +P+ + 
Sbjct: 1   MRTLSIDIETYSDVDLTKCGVYRYVDSPQFEILLFAYKIDEENTQIVDLAQGEELPKGIL 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKL 118
            AL +  V   A N+ FER  L       +    W CT V A S GLP +L+ VG  L +
Sbjct: 61  SALRDDAVVKTAFNANFERVCLSKYLKQKLSARSWSCTAVQAASLGLPLSLEGVGRVLNI 120

Query: 119 SSQKMEEGKELIARF---CKGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTREIFKR 174
             QKM+EG+ LI  F   C+      + +RN P+H  E W LF  YCK DV V + I KR
Sbjct: 121 EEQKMKEGQRLIRYFCLPCRPTIANGMRERNWPHHALEDWELFKRYCKRDVEVEQAIRKR 180

Query: 175 LE--PLSSKEQELWYLDQTINDRGYCVDVALAH--TLNQIVDVER-TKLDQELESLTYGL 229
           L   PL   EQ L+ LDQ INDRG  VD  L     L  +   E+ T+   EL  L    
Sbjct: 181 LSNYPLLESEQLLYQLDQAINDRGIAVDQELVSQAILGDLSYKEQVTQRAYELSGL---- 236

Query: 230 VSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVL 289
             +   + +LK WL    G+ ++ L +    + L   K++  + +++   R+  S+++V 
Sbjct: 237 -DNPNSVSQLKGWLE-NQGVFMDSLGKKDVAKQL---KEVDGEILEMLKLRLLMSKTSVK 291

Query: 290 KLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITH---- 345
           K   +   + SD R+ G LQF GA+RTGRW+G +   QNLP+      +L + +      
Sbjct: 292 KYQAMERCVCSDDRVHGLLQFYGANRTGRWAGRLVQVQNLPQNKLKDLDLARTLVKDGQL 351

Query: 346 LPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETG 405
               +  D  P  ++S+ +R+  +   G + +VAD A IEARVLAW++GE W+L+ FE G
Sbjct: 352 KALDLLYDNVP-NVLSELIRTAFVPKSGHQFIVADFAAIEARVLAWLSGETWRLEVFEQG 410

Query: 406 EDLYVTTYARSFNVAPAQ--VTKDQRAIGKVMELALGYQGGAKAFQKMAS-TTGLNLNTF 462
            D+Y  + A  F V   +  V    R  GK+ ELALGY G   A + M +   GL+    
Sbjct: 411 GDIYCASAASMFGVPVEKHGVNGHLRQKGKIAELALGYGGSVGALKAMGALDMGLDEEEL 470

Query: 463 AHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWN 522
             LV                                           WR  +  +   W 
Sbjct: 471 QPLVNQ-----------------------------------------WRMANPHIVAFWW 489

Query: 523 ELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGR---------------- 566
            + +A ++  E       R+ + V  + +        + LPSGR                
Sbjct: 490 VIDKASKEVYET------REPQKVGNLLLYYQAGMFFIALPSGRKLAYVKPRMELNAFGK 543

Query: 567 -SLVYRDVGNNRSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIV 625
             L Y  +G N+ +        +R  TYG KL ENIVQ ++RD+LA GMM   K   DIV
Sbjct: 544 PGLTYEGIGENKKW--------SRIDTYGPKLVENIVQGIARDLLAHGMMQLQKQELDIV 595

Query: 626 LTVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           L VHDE V E  +  E +   +  L  + P WA+GLPL+A+GY  + Y+K
Sbjct: 596 LHVHDEAVVEVKEG-EASVEEVCQLFATLPDWAEGLPLRADGYACQFYQK 644


>gi|157311150|ref|YP_001469195.1| polymerase [Streptococcus phage P9]
 gi|119104299|gb|ABL61044.1| polymerase [Streptococcus phage P9]
          Length = 640

 Score =  321 bits (823), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 238/703 (33%), Positives = 347/703 (49%), Gaps = 92/703 (13%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYA--EDVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M  L ID ET S  D+ K G+ KYA  ED  ++LFA+  D   VE  D      +P+ +K
Sbjct: 1   MRHLNIDIETYSSNDI-KNGVYKYADAEDFEILLFAYSIDGGEVECLDLTRQS-LPEDIK 58

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIH--RWICTLVLARSNGLPSALKAVGEAL 116
           + L +  V   A N+ FER  L     L   +   +W CT+VLA+  GLPS+L+     L
Sbjct: 59  DMLFDDKVRKHAFNAQFERVCLSRYLGLPYYLDPCQWQCTMVLAQELGLPSSLEKCALYL 118

Query: 117 KLSSQKMEEGKELIARF---CKGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTREIF 172
           KL+ +K   GK LI  F   CK         RN P H  E W++F +YC  DV V   I 
Sbjct: 119 KLAQEKDTSGKNLIRYFSLPCKPSKTNGGRTRNLPEHAPEKWQMFIDYCIQDVVVEMAIA 178

Query: 173 KRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLV 230
           ++LE  P+  +E + +  DQ INDRG  +D  L  +     DV+   L  EL+++T    
Sbjct: 179 EKLESVPVHDREWDYYACDQRINDRGVALDKELVASALYCKDVKMESLSGELKAITGLAN 238

Query: 231 SSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLK 290
            +SR   +L  WL  E G     LT+   ++ L   K    +  +V   +++ + S++ K
Sbjct: 239 PNSRA--QLLPWL-KEHGYSANGLTKADVEQEL---KTAEGELKRVLELKLQTAMSSLKK 292

Query: 291 LNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSI 350
              +  AM SDGR+ G LQF GASRTGRW+G V   QNL R     ++LD    ++    
Sbjct: 293 YEAMERAMCSDGRVHGLLQFYGASRTGRWAGRVVQVQNLAR--NYIKDLDDAREYVKKR- 349

Query: 351 TSDPDPLQIISDC--------VRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAF 402
             D D ++I+ D         VR+ ++A +G    V+D + IEARV+AW AGEQW+L  F
Sbjct: 350 --DIDAVEILYDSLNDTLKQLVRTALVAKDGCTFYVSDFSAIEARVIAWFAGEQWRLDVF 407

Query: 403 ETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTF 462
            T   +Y  + ++ F +   ++ K+ R  GK+ ELALGYQGG  A ++M +   LN+   
Sbjct: 408 STHGKIYEASASQMFGIPIEEIDKELRQKGKISELALGYQGGPGALKQMGA---LNMG-- 462

Query: 463 AHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWN 522
                                 ++E   +  ++D             WR+ + ++ + W 
Sbjct: 463 ----------------------VKEEELQGLVDD-------------WRRANKKIVQFWK 487

Query: 523 ELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYR-------DVGN 575
           ++ +A  + I++   I   K R       +  K  L + LPSGR+L Y        D G+
Sbjct: 488 DVQRAAIKAIKSRAPIKLGKLR------FRYRKGFLFITLPSGRNLAYARAKVEPGDYGD 541

Query: 576 NRSYLNTTTRQ-LTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVC 634
              Y     +   T + TYGGKL ENIVQA +RDILAE ++    AGY +V  VHDE + 
Sbjct: 542 KIIYEGQGDKAYFTAQETYGGKLVENIVQATARDILAEALLRIEAAGYGVVFHVHDEAII 601

Query: 635 ETPD--TDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           E      +E N      LM   P WA+GLPL +EGY +K Y K
Sbjct: 602 EGSGLTIEEVN-----DLMAQAPEWAEGLPLNSEGYVTKYYMK 639


>gi|322382461|ref|ZP_08056356.1| hypothetical protein PL1_2400 [Paenibacillus larvae subsp. larvae
           B-3650]
 gi|321153574|gb|EFX45963.1| hypothetical protein PL1_2400 [Paenibacillus larvae subsp. larvae
           B-3650]
          Length = 662

 Score =  321 bits (823), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 231/718 (32%), Positives = 336/718 (46%), Gaps = 108/718 (15%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M  L ID ET S +DL  CG+ +Y E  D  V+LFA+ +DD PV++ D      +P  + 
Sbjct: 9   MKILQIDLETYSSVDLKDCGVYRYVESPDFEVLLFAYAYDDDPVQVIDLTAFEDLPDQVV 68

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKL 118
             L + +V   A N+ FERT +K  F +     +W CT V A + GLP  L+ V E LKL
Sbjct: 69  HDLTDPNVLKTAFNAAFERTCIKKHFGIKCNPSQWRCTAVWALALGLPGYLEGVAEVLKL 128

Query: 119 SSQKMEEGKELIARF---CKGETHECLYDRNKPNHR--EAWRLFGEYCKGDVTVTREIFK 173
            +QK   GK LI  F   CK         RN P H   E W  +  Y   DV V RE+ +
Sbjct: 129 EAQKDTRGKNLIKYFSVPCKPTKANGGRTRNHPPHHDMEKWEQYKAYNIQDVVVEREVRR 188

Query: 174 RLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVS 231
           +LE  P+   E +LW LDQ INDRG  +D  L +      D  +T L QE + +T   + 
Sbjct: 189 KLERFPVPQHEWDLWALDQRINDRGIQLDPTLFNQAIDCADQYKTGLLQEAKDITQ--LE 246

Query: 232 SSRCLEKLKTWLFLETGLHLED--LTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVL 289
           +   L KLK WL  E GL   D    E     ++ +  + T + +Q+   R    +++V 
Sbjct: 247 NPNSLTKLKEWL-AEQGLETPDGLGKEHMPTLLVQAPDEDTRRVLQI---RQELGKTSVD 302

Query: 290 KLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPR-------------PSRSH 336
           K N +  ++ +DGR RG LQF GA+RTGRW+G +   QNLP+              S   
Sbjct: 303 KYNAMARSICADGRARGILQFCGANRTGRWAGRIIQVQNLPQNKLNALWMAREVLKSGDF 362

Query: 337 EELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQ 396
           + L+ +   LP+          ++S  +R+  I S G + +V+D + IEAR++AW+A E 
Sbjct: 363 DLLEMLYGALPS----------VLSQLIRTVFIPSPGCRFIVSDFSAIEARIIAWLADEH 412

Query: 397 WKLKAFETGEDLYVTTYARSFNVAPAQVTKDQ-----RAIGKVMELALGYQGGAKAFQKM 451
           W L  F+    +Y    ++ F V    + K       RA GKV  LA GYQGG  A  KM
Sbjct: 413 WVLNVFQDHGKIYEAAASQMFKVPMETIVKGHPNYELRAKGKVATLACGYQGGPPALIKM 472

Query: 452 ASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWR 511
            +                               ++   PE  +  +          K WR
Sbjct: 473 GA-------------------------------LKSGIPEEELPGIV---------KRWR 492

Query: 512 QKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDK---NNLILMLPSGRSL 568
           + + R+ +LW    +A    +        R++R VPL +  K +     L   LPSGRSL
Sbjct: 493 KANPRIVKLWYAAEEAALTAV--------REKRTVPLAHGVKYRYKSGTLFADLPSGRSL 544

Query: 569 VYRDV-----------GNNRSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNA 617
            Y +            G     ++   ++     TYGG+L EN+VQA++RD LAE +M  
Sbjct: 545 AYVNPRIKPDPNFGKDGLVFDGMDQIKKKWMSHRTYGGRLVENLVQAIARDCLAESLMRL 604

Query: 618 TKAGYDIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
             A Y  V+ VHDE+V + P     +   +  +M+    WA GLPL A G+E + Y+K
Sbjct: 605 DAAEYRTVMHVHDEVVLDVP-IGTGSVDHVTGIMSQPIDWAPGLPLSAAGFECEFYQK 661


>gi|315654969|ref|ZP_07907874.1| prophage LambdaSa04 DNA-directed DNA polymerase [Mobiluncus
           curtisii ATCC 51333]
 gi|315490930|gb|EFU80550.1| prophage LambdaSa04 DNA-directed DNA polymerase [Mobiluncus
           curtisii ATCC 51333]
          Length = 640

 Score =  320 bits (821), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 234/699 (33%), Positives = 339/699 (48%), Gaps = 84/699 (12%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M TL ID ET SP+ L K G+ KY    D  ++LF++  D   V   D      +P  + 
Sbjct: 1   MRTLSIDIETYSPVILAKAGVYKYCNHPDFKILLFSYAIDSCTVRTVDLASGEQLPDAVL 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKL 118
           +AL ++ VT  A+N+ FERT L A     +    W C++V A + GLP +LK VG+ L L
Sbjct: 61  DALADSAVTKWAYNASFERTCLSAYLGRLLDPAGWRCSMVWAATLGLPLSLKDVGKVLNL 120

Query: 119 SSQKMEEGKELIARFCKGETHECLYDRNKPNHREA-WRLFGEYCKGDVTVTREIFKRLE- 176
            +QKM+EGK+LI  FC  + +     R  P+   A W+LF  Y   DV V   I ++L  
Sbjct: 121 DAQKMDEGKDLIKHFCVPDDNS---QRRLPSSDPAGWKLFKMYNARDVEVETAIRQKLAD 177

Query: 177 -PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSSSRC 235
            P+     E + +DQ INDRG  +D  LA     I +  R +       LT GL + +  
Sbjct: 178 FPVPDYLWEQYEVDQRINDRGIRIDTTLAANAIAIDEEHRAQALARAHKLT-GLDNPASP 236

Query: 236 LEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLNTLV 295
           L+ L+ WL  + G  +E + + +    L++      +A+++   R   SRS+V K   ++
Sbjct: 237 LQ-LQEWLN-QHGCPIESMAKESVDDALANATGQVREALEL---RQELSRSSVAKYRKMI 291

Query: 296 EAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPR---PSRSHEE---LDQIITHLPTS 349
           +   +D R  G LQF GA+RTGRW+G +   QNLPR   P  +       D     L   
Sbjct: 292 DVTCTDQRAHGLLQFYGANRTGRWAGRLVQVQNLPRNYLPDLTQARGLVRDGNGETLEML 351

Query: 350 ITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLY 409
            +S PD L   S  +R+  I S   + +VAD + IEARVLAW+AGE+  L AF+ GEDLY
Sbjct: 352 YSSVPDTL---SQLIRTAFIPSGAHRFIVADYSAIEARVLAWLAGEETTLAAFKNGEDLY 408

Query: 410 VTTYARSFNVAPAQ---VTKDQRAIGKVMELALGYQGGAKAFQKMAS-TTGLNLNTFAHL 465
             T +  F V P +   V  + R  GK+  LA GY G   A + M +   GL+ +    +
Sbjct: 409 CATASAMFGV-PVEKHGVNSELRQKGKIAVLACGYNGSVGALKAMGALKMGLSEDELQPI 467

Query: 466 VKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELH 525
           V                                          AWRQ +  + +LW+++ 
Sbjct: 468 V-----------------------------------------DAWRQANPNIVQLWHKVD 486

Query: 526 QAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVY--RDVGNNRSYLNTT 583
            A  + I  G+ +  R       +  +K    L + LPSGR L Y    +G NR    + 
Sbjct: 487 NAATRAISTGRPLTLRN------LGFEKKSGILFITLPSGRRLAYVKPGIGVNRFGGTSI 540

Query: 584 T-------RQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCET 636
           T       R+  +  TYGGKL ENIVQA +RD+LAE +     AG+ IV+ +HDE+V + 
Sbjct: 541 TYWGQGVARKWQKLETYGGKLVENIVQATARDLLAEAITRIENAGHQIVMHIHDEVVIDE 600

Query: 637 PDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           P       + +  LM   P WA+GLP+ A GYE   Y+K
Sbjct: 601 PINSGTTVADICALMNELPQWAEGLPIDAAGYECGFYQK 639


>gi|139473888|ref|YP_001128604.1| phage DNA polymerase [Streptococcus pyogenes str. Manfredo]
 gi|209559298|ref|YP_002285770.1| DNA polymerase [Streptococcus phage NZ131.2]
 gi|134272135|emb|CAM30380.1| putative phage DNA polymerase [Streptococcus pyogenes str.
           Manfredo]
 gi|209540499|gb|ACI61075.1| DNA polymerase [Streptococcus phage NZ131.2]
          Length = 640

 Score =  319 bits (818), Expect = 9e-85,   Method: Compositional matrix adjust.
 Identities = 238/703 (33%), Positives = 347/703 (49%), Gaps = 92/703 (13%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYA--EDVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M  L ID ET S  D+ K G+ KYA  ED  ++LFA+  D   VE  D      +P+ +K
Sbjct: 1   MRHLNIDIETYSSNDI-KNGVYKYADAEDFEILLFAYSIDGGEVECLDLTRQS-LPEDIK 58

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIH--RWICTLVLARSNGLPSALKAVGEAL 116
           + L +  V   A N+ FER  L     L   +   +W CT+VLA+  GLPS+L+     L
Sbjct: 59  DMLFDDKVRKHAFNAQFERVCLSRYLGLPYYLDPCQWQCTMVLAQELGLPSSLEKCALYL 118

Query: 117 KLSSQKMEEGKELIARF---CKGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTREIF 172
           KL+ +K   GK LI  F   CK         RN P H  E W++F +YC  DV V   I 
Sbjct: 119 KLAQEKDTSGKNLIRYFSLPCKPSKANGGRTRNLPEHAPEKWQMFIDYCIQDVVVEMAIA 178

Query: 173 KRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLV 230
           ++LE  P+  +E + +  DQ INDRG  +D  L  +     DV+   L  EL++LT    
Sbjct: 179 EKLESVPVHDREWDYYACDQRINDRGVALDKELVASALYCKDVKMESLSGELKALTGLDN 238

Query: 231 SSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLK 290
            +SR   +L  WL  E G  +  LT+   ++ L   K    +  +V   +++ + S++ K
Sbjct: 239 PNSRA--QLLPWL-KEHGYSVNGLTKADVEQEL---KTAEGELKRVLELKLQTAMSSLKK 292

Query: 291 LNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSI 350
              +  AM SDGR+ G LQF GASRTGRW+G V   QNL R     ++LD    ++    
Sbjct: 293 YEAMERAMCSDGRVHGLLQFYGASRTGRWAGRVVQVQNLAR--NYIKDLDDAREYVKKR- 349

Query: 351 TSDPDPLQIISDC--------VRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAF 402
             D D ++I+ D         VR+ ++A +     V+D + IEARV+AW AGEQW+L  F
Sbjct: 350 --DIDAVEILYDSLNDTLKQLVRTALVAKDCCTFYVSDFSAIEARVIAWFAGEQWRLDVF 407

Query: 403 ETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTF 462
            T   +Y  + ++ F +   ++ K+ R  GK+ ELALGYQGG  A ++M +   LN+   
Sbjct: 408 STHGKIYEASASQMFGIPIEEIDKELRQKGKISELALGYQGGPGALKQMGA---LNMG-- 462

Query: 463 AHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWN 522
                                 ++E   +  ++D             WR+ + ++ + W 
Sbjct: 463 ----------------------VKEEELQGLVDD-------------WRRANKKIVQFWK 487

Query: 523 ELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYR-------DVGN 575
           ++ +A  + I++   I   K R       +  K  L + LPSGR+L Y        D G+
Sbjct: 488 DVQRAAIKAIKSRAPIKLGKLR------FRYRKGFLFITLPSGRNLAYARAKVEPGDYGD 541

Query: 576 NRSYLNTTTRQ-LTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVC 634
              Y     +   T + TYGGKL ENIVQA +RDILAE ++    AGY +V  VHDE + 
Sbjct: 542 KIVYEGQGDKAYFTAQETYGGKLVENIVQATARDILAEALLRIEAAGYGVVFHVHDEAII 601

Query: 635 ETPD--TDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           E      +E N      LM   P WA+GLPL +EGY +K Y K
Sbjct: 602 EGSGLTIEEVN-----DLMAQAPEWAEGLPLNSEGYVTKYYMK 639


>gi|302873662|ref|YP_003842295.1| DNA-directed DNA polymerase [Clostridium cellulovorans 743B]
 gi|307686614|ref|ZP_07629060.1| DNA-directed DNA polymerase [Clostridium cellulovorans 743B]
 gi|302576519|gb|ADL50531.1| DNA-directed DNA polymerase [Clostridium cellulovorans 743B]
          Length = 645

 Score =  319 bits (817), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 228/705 (32%), Positives = 348/705 (49%), Gaps = 91/705 (12%)

Query: 1   MATLFIDFETRSPIDLTKCGICKY--AEDVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M TL ID ET S +DL K G+  Y  + +  ++LFA+ FD   V++ D      +P  + 
Sbjct: 1   MQTLSIDIETFSDVDLIKSGVYAYTASPNFEILLFAYAFDSDEVKIIDFASGEELPAEII 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKL 118
           EAL N ++   A N+ FER  L    N  +  + W CT V A + G P +L  V + L L
Sbjct: 61  EALLNENIIKSAFNAQFERICLSRHLNKKLTANAWQCTAVQAATLGFPLSLDGVAQVLGL 120

Query: 119 SSQKMEEGKELIARF---CKGETHECLYDRNKPNH-REAWRLFGEYCKGDVTVTREIFKR 174
           + QKM+EGKELI  F   CK         RN P H  E W  F +YC  DV V R I K+
Sbjct: 121 TEQKMKEGKELIRYFSIPCKPTRVNEGRTRNLPQHSSEKWNDFKKYCIRDVEVERAIRKK 180

Query: 175 LE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSS 232
           L   P+S  EQ  + LD  INDRG  VD+ L     +   + +     E + LT GL  +
Sbjct: 181 LSRYPISENEQRNYILDHEINDRGVFVDLDLVARAMECDRLHKEDTFTEAQRLT-GL-DN 238

Query: 233 SRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLN 292
              + +LK WL +E G+ ++ L++     +    K+   +  ++ N R++ +++++ K  
Sbjct: 239 PNSVAQLKQWL-IENGVEVDSLSKKAVSDL---AKEADGEVERLLNLRLQLAKTSIKKYE 294

Query: 293 TLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITS 352
            +  A+  D R+RG LQF GA+RTGRW+G +   QNLP   ++H +   +  +L  S   
Sbjct: 295 AIERAVCPDKRVRGLLQFYGANRTGRWAGRLVQVQNLP---QNHLKDLTLARNLVKSGDF 351

Query: 353 DPDPL------QIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGE 406
           D   L       ++S+ +R+  I     + +VAD + IEARV+AW+AGE+W++  F T  
Sbjct: 352 DTLALLFESVPHVLSELIRTAFIPKSNHRFIVADFSAIEARVIAWLAGEKWRMDVFATHG 411

Query: 407 DLYVTTYARSFNVAPAQVTKDQ--RAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAH 464
            +Y  + ++ F V   ++TK    R  GK+ ELALGY G   A   M +   L++     
Sbjct: 412 KIYEASASQMFKVPIEEITKTSALRQKGKISELALGYGGSVGALTAMGA---LDMGV--- 465

Query: 465 LVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNEL 524
                                         ED   G        AWRQ +  +++LW ++
Sbjct: 466 -----------------------------AEDELQGLVT-----AWRQANPNITKLWWDI 491

Query: 525 HQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVY-----------RDV 573
            +A  + ++    ++  K      + ++ +   + + LPSGR L Y           RD 
Sbjct: 492 DKAAIKAVKKKTTVMVGK------IKLQYESGIMFITLPSGRRLSYIKPRIEPNKFERDA 545

Query: 574 GNNRSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIV 633
                     T++  R  TYG KL ENIVQA++RD+LAE M+   + GY+IV+ +HDEIV
Sbjct: 546 VTYEGI--GATKKWERIETYGPKLVENIVQAIARDLLAEAMLRVAENGYEIVMHIHDEIV 603

Query: 634 CETPDTDEFNASMLY---HLMTSNPSWAKGLPLKAEGYESKRYRK 675
            E P     N   L     +M   P+WA+ LPL+A+G+E + YRK
Sbjct: 604 IEAP----LNFGSLKDVCEVMAIAPTWAESLPLRADGFECEYYRK 644


>gi|153814242|ref|ZP_01966910.1| hypothetical protein RUMTOR_00451 [Ruminococcus torques ATCC 27756]
 gi|145848638|gb|EDK25556.1| hypothetical protein RUMTOR_00451 [Ruminococcus torques ATCC 27756]
          Length = 644

 Score =  319 bits (817), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 221/701 (31%), Positives = 334/701 (47%), Gaps = 84/701 (11%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYA--EDVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M TL ID ET S + L  CG+ +YA  E   ++LFA+  +D P ++ D      MP+ + 
Sbjct: 1   MDTLAIDIETYSDVSLPDCGVHRYAASEQFEILLFAYSLNDEPTKIIDIASGQTMPEEIM 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKL 118
           E L +  V   A N+ FER  +   F L +    W CT V A    LP +L+ VGEAL L
Sbjct: 61  ECLMDDSVVKTAFNAAFERNCINRFFGLSLKPEGWRCTAVQASMLSLPLSLEGVGEALNL 120

Query: 119 SSQKMEEGKELIARF---CKGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTREIFKR 174
             +KM EGK+LI  F   CK         RN P+   E W LF  YC  DV V ++I  +
Sbjct: 121 DKKKMSEGKDLIRYFCMPCKPTKANGGRTRNLPSDAPEKWELFKTYCIRDVDVEKQIRNK 180

Query: 175 LE--PLSSKEQELWYLDQTINDRGYCVD---VALAHTLNQIVDVERTKLDQELESLTYGL 229
           L   P+  +EQEL+ +DQ INDRG  VD   ++ A   + +     +K   E+  L    
Sbjct: 181 LAKFPIPDREQELYCMDQRINDRGIMVDRELISNAVACDLLYKEAASKRAYEISGL---- 236

Query: 230 VSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVL 289
             +   + +LK WL  E G+ ++ L +   + ++   +K   +  ++   R+  S+++V 
Sbjct: 237 -ENPNSVSQLKDWLN-EKGIEVDSLAKAAVEELV---EKTEGEVSEMMKLRLSMSKTSVK 291

Query: 290 KLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIIT----H 345
           K   +  ++  DGR+ G LQF GA+RTGRW+G +    NLP+      EL + I     +
Sbjct: 292 KYEAMERSVCPDGRVHGLLQFYGANRTGRWAGRLVQIHNLPQNHMEDLELARSIVKEGRY 351

Query: 346 LPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETG 405
               +  D  P +++S+ +R+  +A  G + +V+D + IEARV+ ++AGE W ++ F   
Sbjct: 352 DLVELLYDSTP-EVLSELIRTAFVAKPGCRFIVSDFSAIEARVMGYLAGEGWVMEEFRGA 410

Query: 406 EDLYVTTYARSFNVAPAQVTKDQ--RAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFA 463
             +Y  T ++ F++   ++TK    RA GKV  LA  Y G   A   M +   +      
Sbjct: 411 GKIYEQTASKMFHIPIEEITKGSPYRARGKVASLACQYGGAEGALVSMGALNFVEEEELK 470

Query: 464 HLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNE 523
            LV++                                         WR  +  +   W E
Sbjct: 471 GLVQS-----------------------------------------WRTANPHIVNYWYE 489

Query: 524 LHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVY--------RDVGN 575
           +  A +  ++       RK   V  V +      L + LPSGR L Y        R    
Sbjct: 490 IDGAVKAAVKE------RKMTTVGRVTVYYQSGMLKIALPSGRVLSYVRPRMTVNRFGSE 543

Query: 576 NRSYLNT-TTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVC 634
           + SY    T R+ TR  +YG K  ENIVQA +RD+LAE M+   K G+DIV  +HDE+V 
Sbjct: 544 SVSYEGVGTNRKWTRIESYGAKFCENIVQATARDVLAEAMLRLEKKGFDIVCHIHDEVVL 603

Query: 635 ETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           E P+    +   +  +M   P W +GLPLKA G+ES  Y+K
Sbjct: 604 EVPEGTS-SVEEVNEIMAVCPDWCEGLPLKAAGFESPFYKK 643


>gi|331085755|ref|ZP_08334838.1| hypothetical protein HMPREF0987_01141 [Lachnospiraceae bacterium
           9_1_43BFAA]
 gi|330406678|gb|EGG86183.1| hypothetical protein HMPREF0987_01141 [Lachnospiraceae bacterium
           9_1_43BFAA]
          Length = 646

 Score =  318 bits (816), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 235/703 (33%), Positives = 331/703 (47%), Gaps = 91/703 (12%)

Query: 3   TLFIDFETRSPIDLTKCGICKYAED--VCVILFAFGFDDHPVELWDCVHDPVMPQVLKEA 60
           TL ID ET S +DL  CG+ KY+      ++L A+  DD      D  +    P+   E 
Sbjct: 4   TLAIDIETYSDVDLISCGVYKYSSSPHFEILLIAYSVDDEETVCIDVANGEEPPKEFIEM 63

Query: 61  LENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKLSS 120
           L +  VT  A N+ FERT     ++       W CT V A    LP +L+ VG  L L  
Sbjct: 64  LFDDTVTKTAFNANFERTCFSNYYHHSFRPEAWRCTAVQATMLALPLSLEGVGAVLGLDK 123

Query: 121 QKMEEGKELIARFC---KGETHECLYDRNKP-NHREAWRLFGEYCKGDVTVTREIFKRLE 176
           QKM EGKELI  FC   K         RN P +  E WR F  YC  DV V ++I +RL 
Sbjct: 124 QKMTEGKELIKYFCSPCKATKSNGGRTRNLPKDAPEKWRWFKTYCIRDVDVEKQIRQRLA 183

Query: 177 --PLSSKEQELWYLDQTINDRGYCVDVAL---AHTLNQIVDVERTKLDQELESLTYGLVS 231
             P+  +EQE++ LDQ INDRG  VD  L   A   + +     T    EL  L      
Sbjct: 184 KFPIPKREQEIYCLDQRINDRGIMVDRNLVNHAVACDLLYKETATARAYELTGL-----E 238

Query: 232 SSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKL 291
           +   + +LK WL  E GL ++ L + T + +   + K      +V   R+  S+++V K 
Sbjct: 239 NPNSVSQLKLWL-KEKGLEVDSLAKDTVKDL---SMKAEGDVQEVLKLRLATSKTSVKKY 294

Query: 292 NTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIIT----HLP 347
             +  ++ ++ R+ G LQF GA+RTGRW+G +    NLP+      EL + +     +  
Sbjct: 295 EAIDRSVCAENRVHGLLQFYGANRTGRWAGRLVQIHNLPQNHLPDLELARALVSEGRYEE 354

Query: 348 TSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGED 407
             +  +  P  ++S+ +R+  +A  G + +++D + IEARVLAW+AGE+W+L+ FET   
Sbjct: 355 VELFYESTP-NVLSELIRTAFVAKPGCRFIISDYSAIEARVLAWLAGEEWRLQVFETHGK 413

Query: 408 LYVTTYARSFNVAPAQVTKDQ--RAIGKVMELALGYQGGAKAFQKMAS-TTGLNLNTFAH 464
           +Y  + +  F+VA  ++TK    R  GK+ ELALGY G   A   M +   GL       
Sbjct: 414 IYEASASAMFHVAIEEITKTSPLRQKGKISELALGYGGAVGALTSMGALKMGLTEEELPG 473

Query: 465 LVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNEL 524
           LV T                                         WR  +  ++  W  +
Sbjct: 474 LVST-----------------------------------------WRSANPHITAFWWAV 492

Query: 525 HQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNNRSYLNTTT 584
            +A    + +      +K   V  V  +     L + LPSGR L Y      R  LN   
Sbjct: 493 DEAAVTAVRD------KKPSKVGRVSFEYKSGILFVTLPSGRKLSYV---KPRMMLNKFG 543

Query: 585 RQ-LTRE-----------YTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEI 632
           R+ LT E            TYG KL ENIVQA SRDILAE M+   K G+DIV  VHDE+
Sbjct: 544 REGLTYEGIGESKKWMRLETYGPKLVENIVQAASRDILAEAMLRLEKEGFDIVCHVHDEV 603

Query: 633 VCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           V E PD    +   +  +M  NP W +GLPLKA G+ES  Y+K
Sbjct: 604 VLEVPDGKS-SVEEVNEIMAVNPVWTEGLPLKAAGFESPFYKK 645


>gi|154504839|ref|ZP_02041577.1| hypothetical protein RUMGNA_02349 [Ruminococcus gnavus ATCC 29149]
 gi|153794722|gb|EDN77142.1| hypothetical protein RUMGNA_02349 [Ruminococcus gnavus ATCC 29149]
          Length = 644

 Score =  318 bits (815), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 222/707 (31%), Positives = 336/707 (47%), Gaps = 96/707 (13%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYA--EDVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M TL ID ET S + L  CG+ +YA  E   ++LFA+  +D P ++ D      +P  + 
Sbjct: 1   MDTLAIDIETYSDVSLPDCGVHRYAASEQFEILLFAYSLNDEPTQIIDLASGEKIPDEIM 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKL 118
           E L +  V   A+N+ FER  +   F L +    W CTLV A    LP +L+ VGEAL L
Sbjct: 61  EYLTDDSVIKTAYNAAFERNCINRFFGLSLKPEGWRCTLVQASMLSLPLSLEGVGEALNL 120

Query: 119 SSQKMEEGKELIARF---CKGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTREIFKR 174
             +KM EGK+LI  F   CK         RN P+   E W LF  YC  DV V ++I  +
Sbjct: 121 DKKKMSEGKDLIRYFCMPCKPTKANGGRTRNLPSDAPEKWELFKTYCTRDVDVEKQIRNK 180

Query: 175 LE--PLSSKEQELWYLDQTINDRGYCVD---VALAHTLNQIVDVERTKLDQELESLTYGL 229
           L   P+  +EQ+L+ +DQ INDRG  VD   +  A   + +     TK   E+  L    
Sbjct: 181 LAKFPIPDREQKLYCMDQRINDRGIMVDQELIGHAVACDLLYKETVTKKAYEISGL---- 236

Query: 230 VSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVL 289
             +   + +LK WL  E G+ ++ L +   + ++ + +    + +++   R+  S+++V 
Sbjct: 237 -ENPNSVSQLKDWLN-EKGIEVDSLAKAAVEELVENTQGDVAEMMKL---RLAMSKTSVK 291

Query: 290 KLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITH---- 345
           K   +  ++  DGR+ G LQF GA+RTGRW+G +    NLP+      EL + +      
Sbjct: 292 KYEAMERSVCPDGRVHGLLQFYGANRTGRWAGRLVQIHNLPQNHMEDLELARSLVKEGRY 351

Query: 346 --LPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFE 403
             +     S PD   ++S+ +R+  +A  G + +V+D + IEARV+ ++AGE W ++ F 
Sbjct: 352 DLVELLYDSTPD---VLSELIRTAFVARPGCRFIVSDFSAIEARVMGYLAGEGWVMEEFR 408

Query: 404 TGEDLYVTTYARSFNVAPAQVTKDQ--RAIGKVMELALGYQGGAKAFQKMASTTGLNLNT 461
               +Y  T ++ F++   ++TK    RA GKV  LA  Y G   A   M +   +    
Sbjct: 409 GAGKIYEQTASKMFHIPIGEITKGSPYRARGKVASLACQYGGAEGALISMGALNFVEEEE 468

Query: 462 FAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELW 521
              LV++                                         WR  +  +   W
Sbjct: 469 LKGLVQS-----------------------------------------WRTANPHIVNYW 487

Query: 522 NELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVY--------RDV 573
            E+  A +  ++       RK   V +V +      L + LPSGR L Y        R  
Sbjct: 488 YEIDGAVKAAVKE------RKMTKVGMVTVYYQSGMLKITLPSGRVLSYVRPRMTVNRFG 541

Query: 574 GNNRSYLNT-TTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEI 632
             + SY    T R+ TR  +YG K  ENIVQA +RD+LAE M+   K G+DIV  +HDE+
Sbjct: 542 SESVSYEGIGTNRKWTRIESYGAKFCENIVQATARDVLAEAMLRLEKKGFDIVCHIHDEV 601

Query: 633 VCETPD----TDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           V E P+     +E N      +M   P W +GLPLKA G+ES  Y+K
Sbjct: 602 VLEVPEGTSSVEEVNG-----IMAVCPDWCEGLPLKAAGFESPFYKK 643


>gi|225871341|ref|YP_002747288.1| phage DNA polymerase [Streptococcus equi subsp. equi 4047]
 gi|225700745|emb|CAW95387.1| putative phage DNA polymerase [Streptococcus equi subsp. equi 4047]
          Length = 640

 Score =  318 bits (814), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 238/703 (33%), Positives = 346/703 (49%), Gaps = 92/703 (13%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYA--EDVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M  L ID ET S  D+ K G+ KYA  ED  ++LFA+  D   VE  D      +P+ +K
Sbjct: 1   MRHLNIDIETYSSNDI-KNGVYKYADAEDFEILLFAYSIDGGEVECLDLTRQS-LPEDIK 58

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIH--RWICTLVLARSNGLPSALKAVGEAL 116
           + L +  V   A N+ FER  L     L   +   +W CT+VLA+  GLPS+L+     L
Sbjct: 59  DMLFDDKVRKHAFNAQFERVCLSRYLGLPYYLDPCQWQCTMVLAQELGLPSSLEKCALYL 118

Query: 117 KLSSQKMEEGKELIARF---CKGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTREIF 172
           KL  +K   GK LI  F   CK         RN P H  E W++F +YC  DV V   I 
Sbjct: 119 KLVQEKDTSGKNLIRYFSLPCKPSKANGGRTRNLPEHAPEKWQMFIDYCIQDVVVEMAIA 178

Query: 173 KRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLV 230
           ++LE  P+  +E + +  DQ INDRG  +D  L  +     DV+   L  EL++LT    
Sbjct: 179 EKLESVPVHDREWDYYACDQRINDRGVALDKELVASALYCKDVKMESLSGELKALTGLDN 238

Query: 231 SSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLK 290
            +SR   +L  WL  E G  +  LT+   ++ L   K    +  +V   +++ + S++ K
Sbjct: 239 PNSRA--QLLPWL-KEHGYSVNGLTKADVEQEL---KTAEGELKRVLELKLQTAMSSLKK 292

Query: 291 LNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSI 350
              +  AM SDGR+ G LQF GASRTGRW+G V   QNL R     ++LD    ++    
Sbjct: 293 YEAMERAMCSDGRVHGLLQFYGASRTGRWAGRVVQVQNLAR--NYIKDLDDAREYVKKR- 349

Query: 351 TSDPDPLQIISDC--------VRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAF 402
             D D ++I+ D         VR+ ++A +     V+D + IEARV+AW AGEQW+L  F
Sbjct: 350 --DIDAVEILYDSLNDTLKQLVRTALVAKDCCTFYVSDFSAIEARVIAWFAGEQWRLDVF 407

Query: 403 ETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTF 462
            T   +Y  + ++ F +   ++ K+ R  GK+ ELALGYQGG  A ++M +   LN+   
Sbjct: 408 STHGKIYEASASQMFGIPIEEIDKELRQKGKISELALGYQGGPGALKQMGA---LNMG-- 462

Query: 463 AHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWN 522
                                 ++E   +  ++D             WR+ + ++ + W 
Sbjct: 463 ----------------------VKEEELQGLVDD-------------WRRANKKIVQFWK 487

Query: 523 ELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYR-------DVGN 575
           ++ +A  + I++   I   K R       +  K  L + LPSGR+L Y        D G+
Sbjct: 488 DVQRAAIKAIKSRAPIKLGKLR------FRYRKGFLFITLPSGRNLAYARAKVEPGDYGD 541

Query: 576 NRSYLNTTTRQ-LTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVC 634
              Y     +   T + TYGGKL ENIVQA +RDILAE ++    AGY +V  VHDE + 
Sbjct: 542 KIVYEGQGDKAYFTAQETYGGKLVENIVQATARDILAEALLRIEAAGYGVVFHVHDEAII 601

Query: 635 ETPD--TDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           E      +E N      LM   P WA+GLPL +EGY +K Y K
Sbjct: 602 EGSGLTIEEVN-----DLMAQAPEWAEGLPLNSEGYVTKYYMK 639


>gi|160937655|ref|ZP_02085015.1| hypothetical protein CLOBOL_02545 [Clostridium bolteae ATCC
           BAA-613]
 gi|158439300|gb|EDP17052.1| hypothetical protein CLOBOL_02545 [Clostridium bolteae ATCC
           BAA-613]
          Length = 661

 Score =  317 bits (812), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 229/712 (32%), Positives = 344/712 (48%), Gaps = 92/712 (12%)

Query: 3   TLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQV---- 56
           T+ +D ET S ID+ + G+  YA   D  ++L  + +D   V++ D       P+     
Sbjct: 2   TMNVDIETYSSIDIREAGVYAYASAPDFEILLIGYRYDGQDVKVIDLTDPLADPERDFPD 61

Query: 57  LKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEAL 116
             E L + DV   A+N+ FERT L +     +P  +W CT V A + GLP  L  VGEAL
Sbjct: 62  FWEGLYSPDVIKTAYNANFERTCLASWLGRPMPPEQWRCTAVHAATLGLPGTLGGVGEAL 121

Query: 117 KLSSQKMEE--GKELIARFCKG---ETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTRE 170
            L   K ++  GK LI  FCK         +  RN P H  + W+LF EY + DV     
Sbjct: 122 GLPEDKQKDKIGKSLIQYFCKPCKPTKTNGMRSRNLPEHAPDKWQLFIEYNRQDVVAEAT 181

Query: 171 IFKRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYG 228
           I ++L+  P++ +EQELW LDQ IND G  +D+ LA  + Q   + + +L QE   LT G
Sbjct: 182 IREKLQIYPVARQEQELWNLDQHINDHGVRLDMDLADKIIQYDGIYQERLKQEARKLT-G 240

Query: 229 LVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTP-----QAIQVFNNRMRA 283
           L ++   L +LK W F+  GL +  +T+ +   + +  K+L         +++   R   
Sbjct: 241 L-NNPNSLPQLKMWFFMTYGLDVPSITKDSIPVIEAQLKELKTTHDVLPGLRMLQIRKEL 299

Query: 284 SRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQII 343
            +++V K   +  A+  DG LRG LQF GA+RTGRW+G +    NLP+      +L + +
Sbjct: 300 GKTSVKKYQAMRHAVCPDGYLRGILQFYGANRTGRWAGRIVQVHNLPQNKIPDLDLARDL 359

Query: 344 THLPTSITSDPDPLQII--------SDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGE 395
                    D D L+++        S  +R+  I SEG + VV+D + IEARV+AW+A E
Sbjct: 360 VK-----QEDFDTLELLFEGIPFVFSQLIRTAFIPSEGYRFVVSDFSAIEARVIAWLADE 414

Query: 396 QWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQ--RAIGKVMELALGYQGGAKAFQKMAS 453
           +W+L  F T   +Y  + A+ F+V    + K    R  GKV ELALGY GG  A + M  
Sbjct: 415 KWRLNVFRTHGKIYEASAAQMFHVPIENIKKGSRLRQQGKVAELALGYGGGFGAMKAMD- 473

Query: 454 TTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQK 513
                        K  + P++                               +   WR+ 
Sbjct: 474 -------------KAGTIPDD---------------------------EIPMIIANWRKA 493

Query: 514 HSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDV 573
              + +LW     A    IE  + I  + +  +   Y+ +    L + LPSGR L Y D 
Sbjct: 494 SPNICKLWRNAEAAARAAIEERRTI--KLKHGLSFSYINR---ILFIGLPSGRKLAYYDT 548

Query: 574 -------GNN---RSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYD 623
                  G +    + ++  T++  R  T+GGKL ENIVQA +RD LA  M   + AGY 
Sbjct: 549 RIEDDEKGKSVITYAGVDQETKKWGRLKTWGGKLVENIVQATARDCLAVTMERVSGAGYQ 608

Query: 624 IVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           IV+ VHDEI+ + P+TD      +  +M     WA+ LPL+ +GYE+  Y+K
Sbjct: 609 IVMHVHDEIIVDVPETDIDALEKITAIMAQPVPWAQELPLRGDGYETPFYKK 660


>gi|218133416|ref|ZP_03462220.1| hypothetical protein BACPEC_01281 [Bacteroides pectinophilus ATCC
           43243]
 gi|217990791|gb|EEC56797.1| hypothetical protein BACPEC_01281 [Bacteroides pectinophilus ATCC
           43243]
          Length = 644

 Score =  317 bits (812), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 225/707 (31%), Positives = 333/707 (47%), Gaps = 96/707 (13%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYA--EDVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M TL ID ET S + L  CG+ +YA  E   ++LFA+  +D P  + D      MP  + 
Sbjct: 1   MDTLAIDIETYSDVSLPDCGVHRYAASEQFEILLFAYSLNDEPTRIIDLASGQTMPDEIM 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKL 118
           E L +  V   A N+ FER  +   F L +    W CT V A    LP +L+ VGEAL L
Sbjct: 61  ECLMDDSVVKTAFNAAFERNCINRFFGLSLKPEGWRCTAVQASMLSLPLSLEGVGEALNL 120

Query: 119 SSQKMEEGKELIARF---CKGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTREIFKR 174
             +KM EGK+LI  F   CK         RN P+   E W LF  YC  DV V ++I  +
Sbjct: 121 DKKKMSEGKDLIRYFCMPCKPTKANGGRTRNLPSDAPEKWELFKTYCIRDVDVEKQIRNK 180

Query: 175 LE--PLSSKEQELWYLDQTINDRGYCVD---VALAHTLNQIVDVERTKLDQELESLTYGL 229
           L   P+  +EQEL+ +DQ INDRG  VD   ++ A T + +     +K   E+  L    
Sbjct: 181 LAKFPIPDREQELYCMDQRINDRGIMVDRELISHAVTCDLLYKEAASKRAYEISGL---- 236

Query: 230 VSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVL 289
             +   + +LK WL  E G+ ++ L +   + ++   +K   +  ++   R+  S+++V 
Sbjct: 237 -ENPNSVSQLKEWLN-EKGIEVDSLAKAAVEELV---EKTEGEISEMMKLRLSMSKTSVK 291

Query: 290 KLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITH---- 345
           K   +  ++  DGR+ G LQF GA+RTGRW+G +    NLP+      EL + I      
Sbjct: 292 KYEAMERSVCPDGRVHGLLQFYGANRTGRWAGRLVQIHNLPQNHMEDLELARSIVKEGRY 351

Query: 346 --LPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFE 403
             +     S PD   ++S+ +R+  +A  G + +V+D + IEARV+ ++AGE W ++ F 
Sbjct: 352 DLVELLYDSTPD---VLSELIRTAFVAKPGCRFIVSDFSAIEARVMGYLAGEGWVMEEFR 408

Query: 404 TGEDLYVTTYARSFNVAPAQVTKDQ--RAIGKVMELALGYQGGAKAFQKMASTTGLNLNT 461
               +Y  T ++ F++   ++TK    RA GKV  LA  Y G   A   M +   +    
Sbjct: 409 GAGKIYEQTASKMFHIPIEEITKGSPYRARGKVASLACQYGGAEGALVSMGALNFVEEEE 468

Query: 462 FAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELW 521
              LV++                                         WR  +  +   W
Sbjct: 469 LKGLVQS-----------------------------------------WRTANPHIVNYW 487

Query: 522 NELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVY--------RDV 573
            E+  A +  ++       RK   V  V +      L + LPSGR L Y        R  
Sbjct: 488 YEIDGAVKAAVKE------RKMTTVGRVTVYYQSGMLKIALPSGRVLSYVRPRMTVNRFG 541

Query: 574 GNNRSYLNT-TTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEI 632
             + SY    T R+ TR  +YG K  ENIVQA +RD+LAE M+   K G+DIV  +HDE+
Sbjct: 542 SESVSYEGIGTNRKWTRIESYGAKFCENIVQATARDVLAEAMLCLEKKGFDIVCHIHDEV 601

Query: 633 VCETPD----TDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           V E P+     +E N      +M   P W +GLPLKA G+ES  Y+K
Sbjct: 602 VLEVPEGTSSVEEVNG-----IMAVCPDWCEGLPLKAAGFESPFYKK 643


>gi|215401125|ref|YP_002332380.1| putative DNA polymerase [Staphylococcus phage phiSauS-IPLA35]
 gi|215260476|gb|ACJ64606.1| gp17 [Staphylococcus phage phiSauS-IPLA35]
          Length = 650

 Score =  316 bits (810), Expect = 7e-84,   Method: Compositional matrix adjust.
 Identities = 237/701 (33%), Positives = 336/701 (47%), Gaps = 85/701 (12%)

Query: 6   IDFETRSPIDLTKCGICKY--AEDVCVILFAFGFDDHPVELWDCVHDPVMP-----QVLK 58
           ID ET S  D++KCG  KY  AED  +++ A+  D   +   D       P     +  K
Sbjct: 3   IDIETYSNNDISKCGAYKYTEAEDFEILIIAYSIDGGAISAIDMTKVDNEPFHADYETFK 62

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKL 118
            AL + DV   A N+ FERT L   FN  +P   WICT+V +   GLP++L  VGE L+L
Sbjct: 63  IALFDPDVKKYAFNANFERTCLAKHFNKQMPPEEWICTMVNSMRIGLPASLDKVGEVLRL 122

Query: 119 SSQKMEEGKELIARF---CKGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTREIFKR 174
            +QK + GK LI  F   CK         RN P H  E W+ F +YC  DV V   I  +
Sbjct: 123 QNQKDKAGKNLIRYFSIPCKPTKVNGGRTRNLPEHDLEKWQQFIDYCIRDVEVEMTIANK 182

Query: 175 LE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSS 232
           ++  P+++ EQ  W  DQ INDRG  +  +L    N +    + +L ++ + +T GL  +
Sbjct: 183 IKDFPVTAIEQAYWVFDQHINDRGIKLSKSLMLGANVLDKQSKEELLKQAKHIT-GL-EN 240

Query: 233 SRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLN 292
                +L  WL  E GL + +L + T Q  L   K+ T +A ++   R++ S+++V K N
Sbjct: 241 PNSPTQLLAWLKDEQGLDIPNLQKKTVQDYL---KEATGKAKKMLEIRLQMSKTSVKKYN 297

Query: 293 TLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITS 352
            + + M SD R+RG  QF GA  TGRW+G     QNL +   S  EL+     +      
Sbjct: 298 KMHDMMCSDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTELEIARDLIKDQRFD 356

Query: 353 DPD------PLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGE 406
           D D      P  ++S  VR+   A EG +L V+D + IEARV+AW A EQW+L  F T  
Sbjct: 357 DLDLLLNVHPQDLLSQLVRTTFTAEEGNELAVSDFSAIEARVIAWYAKEQWRLDVFNTHG 416

Query: 407 DLYVTTYARSFNVAPAQVTKDQ--RAIGKVMELALGYQGGAKAFQKMAS-TTGLNLNTFA 463
            +Y  + ++ FNV    +TK    R  GKV ELALGYQGGA A + M +   G+  N   
Sbjct: 417 KIYEASASQMFNVPVESITKGDSLRQKGKVSELALGYQGGAGALKAMGALEMGIEENELQ 476

Query: 464 HLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNE 523
            LV +                                         WR  +  +   W  
Sbjct: 477 GLVDS-----------------------------------------WRNANPNIVNFWKA 495

Query: 524 LHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVY--RDVGNNR---- 577
             +A   T+++ K       R     YMK  K  L++ LPSGR+L Y    VG N     
Sbjct: 496 CQEAAINTVKSRKTHHTHGLR----FYMK--KGFLMIELPSGRALAYPKASVGENSWGSQ 549

Query: 578 --SYLN-TTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVC 634
              ++     R+ ++  TYGGKL ENIVQA +RD+LA  +     +G+ IV  VHDE++ 
Sbjct: 550 VVEFMGLDLNRKWSKLKTYGGKLVENIVQATARDLLAISIARLEASGFKIVGHVHDEVIV 609

Query: 635 ETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           E P  D      +  +M     WAKGL L ++G+ S  Y K
Sbjct: 610 EIP-KDSNGLKEIETIMNKPVDWAKGLNLNSDGFTSPFYMK 649


>gi|293400006|ref|ZP_06644152.1| prophage DNA polymerase [Erysipelotrichaceae bacterium 5_2_54FAA]
 gi|291306406|gb|EFE47649.1| prophage DNA polymerase [Erysipelotrichaceae bacterium 5_2_54FAA]
          Length = 651

 Score =  316 bits (810), Expect = 7e-84,   Method: Compositional matrix adjust.
 Identities = 219/707 (30%), Positives = 339/707 (47%), Gaps = 96/707 (13%)

Query: 8   FETRSPIDLTKCGICKY--AEDVCVILFAFGFDDHPVELWDCVHDPVMPQVLKEALENTD 65
            ET S +DL  CG+ KY  +ED  ++LFA+  DD PV++ D      +P  + + ++   
Sbjct: 1   METYSSVDLISCGVYKYVESEDFEILLFAYAVDDEPVKVVDLACGEKIPSEVLDLIDEPA 60

Query: 66  VTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKLS--SQKM 123
           +   AHN+ FER  L       +   +W C+++ A   GLP++LK VG  L LS   QKM
Sbjct: 61  IIKYAHNAVFERLCLSRYLGTQLDTDQWHCSMIHAMMLGLPASLKDVGAVLGLSEDKQKM 120

Query: 124 EEGKELIARFCK--------GETHECLYDRNKP-NHREAWRLFGEYCKGDVTVTREIFKR 174
             GK LI+ FCK        G+       RN P +  E W+LF +YC  DV   REI  +
Sbjct: 121 RIGKTLISYFCKPCKPTRVNGQR-----SRNTPADAPEKWQLFKDYCHRDVETEREISNK 175

Query: 175 LE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSS 232
           L+  P+ + E ELW  DQ +ND G  +D+ + HT+         +L  E E +T G+   
Sbjct: 176 LDKFPIPASEHELWCWDQKMNDHGARIDMEMVHTVLVFGHRYDEELINECERITNGI--G 233

Query: 233 SRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLN 292
            + + +LK W+  +    +E L +     +L  +  ++P+  +V   R  + ++++ K  
Sbjct: 234 PKKIAQLKEWICRKEDRSIESLDKDAVIELL-KDSSISPETRRVLQIRQESGKTSITKYA 292

Query: 293 TLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITS 352
            +  ++ +D RL G LQF GA+RTGRW+G +F PQNLPR + +  EL + +       + 
Sbjct: 293 AIQRSVCNDQRLHGFLQFYGANRTGRWAGRIFQPQNLPRNAFNDIELARKLVKEKDFESL 352

Query: 353 D---PDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLY 409
           D       Q+ S  +R+ VI   G    +AD + IEAR+ AW   E+W+ + F T   +Y
Sbjct: 353 DMLYGSYNQVFSTLIRTAVIPPNGHMFAIADYSAIEARLTAWFCNEEWRQEVFATTGKIY 412

Query: 410 VTTYARSFNVAPAQVTK--DQRAIGKVMELALGYQGGAKAFQKM-ASTTGLNLNTFAHLV 466
             + A+ F+V    VTK  D R  GKV ELALGY GG  A ++M  +  GL+ +    +V
Sbjct: 413 EASAAQMFHVPIESVTKGSDLRKKGKVAELALGYGGGVSALERMGGADMGLSEDEMQDIV 472

Query: 467 KTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELHQ 526
                                                      WR     + ++W  +  
Sbjct: 473 NK-----------------------------------------WRLASPNIKKMWYRVQD 491

Query: 527 AFEQTIENGKAIIARKRRDVPLVYMKK---DKNNLILMLPSGRSLVY-------RDVGNN 576
           A    +        R+R+ V +V+  +       L   LPSGR L Y          G+ 
Sbjct: 492 AAYTAV--------RERKRVSVVHGVRYFYSSGILFAELPSGRRLAYVRPKLKKGRYGDE 543

Query: 577 RSYL-------NTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVH 629
            +Y           T++  R+ T+GGKL EN++QA++RD LA+ M+     GY I++ +H
Sbjct: 544 LTYEGYGSDQDGKQTKKWCRQKTWGGKLFENLIQAIARDCLAKAMLKLDDVGYKIIMHIH 603

Query: 630 DEIVCETP-DTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           DE+V E P +T E     +  +M     WA GL L A+G+ S+ YRK
Sbjct: 604 DEVVVEVPSETAESCLIDIERIMGEPIPWAPGLILTADGFISEYYRK 650


>gi|21910979|ref|NP_665247.1| DNA polymerase A domain-containing protein [Streptococcus pyogenes
           MGAS315]
 gi|28876473|ref|NP_795675.1| putative DNA polymerase A domain [Streptococcus pyogenes phage
           315.6]
 gi|28895334|ref|NP_801684.1| DNA polymerase [Streptococcus pyogenes SSI-1]
 gi|50913380|ref|YP_059352.1| phage-related DNA polymerase [Streptococcus pyogenes MGAS10394]
 gi|21905187|gb|AAM80050.1| putative DNA polymerase A domain - phage-associated [Streptococcus
           pyogenes MGAS315]
 gi|28810580|dbj|BAC63517.1| putative DNA polymerase [Streptococcus pyogenes SSI-1]
 gi|50902454|gb|AAT86169.1| phage-related DNA polymerase [Streptococcus pyogenes MGAS10394]
          Length = 640

 Score =  316 bits (809), Expect = 9e-84,   Method: Compositional matrix adjust.
 Identities = 236/703 (33%), Positives = 346/703 (49%), Gaps = 92/703 (13%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYA--EDVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M  L ID ET S  D+ K G+ KYA  ED  ++LFA+  D   VE  D      +P+ +K
Sbjct: 1   MRHLNIDIETYSSNDI-KNGVYKYADAEDFEILLFAYSIDGGEVECLDLTRQS-LPEDIK 58

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIH--RWICTLVLARSNGLPSALKAVGEAL 116
           + L +  V   A N+ FER  L     L   +   +W CT+VLA+  GLPS+L+     L
Sbjct: 59  DMLFDDKVRKHAFNAQFERVCLSRYLGLPYYLDPCQWQCTMVLAQELGLPSSLEKCALYL 118

Query: 117 KLSSQKMEEGKELIARF---CKGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTREIF 172
           KL+ +K   GK LI  F   CK         RN P H  E W++F +YC  DV V   I 
Sbjct: 119 KLAQEKDTSGKNLIRYFSLPCKPSKTNGGRTRNLPEHAPEKWQMFIDYCIQDVVVEMAIA 178

Query: 173 KRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLV 230
           ++LE  P+  +E + +  DQ INDRG  +D  L  +     DV+   L  EL++LT    
Sbjct: 179 EKLESVPVHDREWDYYACDQRINDRGVALDKELVASALYCKDVKMESLSGELKALTGLDN 238

Query: 231 SSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLK 290
            +SR   +L  WL  E G     LT+   ++ L   K    +  +V   +++ + S++ K
Sbjct: 239 PNSRT--QLLPWL-KEHGYSASGLTKADVEKEL---KTAEGELKRVLELKLQTAMSSLKK 292

Query: 291 LNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSI 350
              +  A  SDGR+ G LQF GASRTGRW+G V   QNL R     ++LD    ++    
Sbjct: 293 YEAMERARCSDGRVHGLLQFYGASRTGRWAGRVVQVQNLAR--NYIKDLDDAREYVKKR- 349

Query: 351 TSDPDPLQIISDC--------VRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAF 402
             D D ++I+ D         VR+ ++A +G    V+D + IEARV+AW AGEQW+L  F
Sbjct: 350 --DIDAVEILYDSLNDTLKQLVRTALVAKDGCTFYVSDFSAIEARVIAWFAGEQWRLDVF 407

Query: 403 ETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTF 462
            T   +Y  + ++ F +   ++ K+ R  GK+ ELALGYQGG  A ++M +   LN+   
Sbjct: 408 STHGKIYEASASQMFGIPIEEIDKELRQKGKISELALGYQGGPGALKQMGA---LNMG-- 462

Query: 463 AHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWN 522
                                 ++E   +  ++D             WR+ + ++ + W 
Sbjct: 463 ----------------------VKEEELQGLVDD-------------WRRANKKIVQFWK 487

Query: 523 ELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYR-------DVGN 575
           ++ +A  + I++   +   K R       +  K  L + LPSGR+L Y        D G+
Sbjct: 488 DVQRAAIKAIKSRAPVRLGKLR------FRYRKGFLFITLPSGRNLAYARAKVEPGDYGD 541

Query: 576 NRSYLNTTTRQ-LTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVC 634
              Y     +   T + TYGGKL ENIVQA +RDILAE ++    AG+ +V  VHDE + 
Sbjct: 542 KIVYEGQGDKAYFTAQETYGGKLVENIVQATARDILAEALLRIEAAGHGVVFHVHDEAII 601

Query: 635 ETPD--TDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           E      +E N      LM   P WA+GLPL +EGY +K Y K
Sbjct: 602 EGSGLTIEEVN-----DLMAQAPEWAEGLPLNSEGYITKYYMK 639


>gi|304389855|ref|ZP_07371814.1| DNA-directed DNA polymerase [Mobiluncus curtisii subsp. curtisii
           ATCC 35241]
 gi|304327031|gb|EFL94270.1| DNA-directed DNA polymerase [Mobiluncus curtisii subsp. curtisii
           ATCC 35241]
          Length = 655

 Score =  316 bits (809), Expect = 9e-84,   Method: Compositional matrix adjust.
 Identities = 242/713 (33%), Positives = 338/713 (47%), Gaps = 97/713 (13%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M TLF D E+ SP  L K G+  YAE  D  ++LF +  D  PV++ D      MP  + 
Sbjct: 1   MRTLFCDIESFSPAQLAKTGVYLYAEHPDFDLLLFGYSIDGGPVKVVDLAGGQSMPDEVL 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLD---------IPIHRWICTLVLARSNGLPSAL 109
            AL ++ V   AHN+ FER  L A              +   +W CT++ +   GLP +L
Sbjct: 61  AALVDSSVVKWAHNAAFERVCLSAWLRAHHSELLGEGFLDPRQWRCTMIWSAYLGLPMSL 120

Query: 110 KAVGEALKLSSQKMEEGKELIARFCKGETHECLYD---RNKPNHRE-AWRLFGEYCKGDV 165
            AV   LKL  QK   GK+LI +FC   T   L     RN P+     W  F +Y + DV
Sbjct: 121 DAVAAVLKLDVQKDTVGKKLIKQFCTPATPSVLNGGKRRNPPSADPTGWARFIDYNRRDV 180

Query: 166 TVTREIFKRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELE 223
            V   I  RL   P+   E + + LDQ IND G  +D  L      + +  R       +
Sbjct: 181 EVELAIHDRLAFFPMPEAEWDTYALDQCINDAGILLDHTLVDNAVAVDEHHRNASLARAQ 240

Query: 224 SLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRA 283
            LT GL + +  ++ LK WL +  G  LE L +      L +   +  + +++   R   
Sbjct: 241 KLT-GLDNLNSPIQ-LKQWL-VTRGCELESLAKAEVDAALDTATGVVKEVLEL---RGDL 294

Query: 284 SRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQII 343
           ++S+V K   +     +DGR RG +QF GA RTGR++G +   QNLPR      +LDQ  
Sbjct: 295 AKSSVKKYQAMHNVAGADGRARGLIQFYGAGRTGRFAGRLVQVQNLPR--NYLPDLDQAR 352

Query: 344 THLPTS--------ITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGE 395
           + + T           S PD L   S  +R+  I S G + +VAD + IEARV+AW+AGE
Sbjct: 353 SLVQTGNLDALELLYESVPDTL---SQLIRTAFIPSPGHRFIVADFSAIEARVIAWLAGE 409

Query: 396 QWKLKAFETGEDLYVTTYARSFNVAPAQ---VTKDQRAIGKVMELALGYQGGAKAFQKM- 451
              L AF  G+DLY  T +R F+V P +   +  + R  GK+  LA GY G   A + M 
Sbjct: 410 TTTLAAFREGKDLYCETASRMFDV-PVEKHGINGELRQKGKIAVLACGYGGSVGALKAMG 468

Query: 452 ASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWR 511
           A T GL                                 EH ++ +           AWR
Sbjct: 469 AFTMGL--------------------------------AEHELKPIV---------DAWR 487

Query: 512 QKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYR 571
           Q +  + +LW ++ QA    I + + I  R  R         +   L + LPSGR L Y 
Sbjct: 488 QANPHIVQLWADVEQAAIAAISSRQPIRLRNLR------FSVESGILFIELPSGRRLAYV 541

Query: 572 D--VGNNR-------SYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGY 622
              +G NR           TT R+  +  TYGGKL ENIVQA++RD+L  GM    KAG+
Sbjct: 542 QPRLGENRWGGTSITYTGTTTARRWGQLETYGGKLVENIVQAIARDLLVVGMHAVAKAGH 601

Query: 623 DIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
            IV+ VHDEIV + P   +F  +    LM++ P+WA+GLPL A+GYE   YRK
Sbjct: 602 RIVMHVHDEIVIDEPTNLDFAVADACKLMSTLPAWAEGLPLDADGYECNYYRK 654


>gi|258455585|ref|ZP_05703542.1| DNA-directed DNA polymerase [Staphylococcus aureus A5937]
 gi|257862273|gb|EEV85044.1| DNA-directed DNA polymerase [Staphylococcus aureus A5937]
          Length = 653

 Score =  316 bits (809), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 237/706 (33%), Positives = 337/706 (47%), Gaps = 85/706 (12%)

Query: 1   MATLFIDFETRSPIDLTKCGICKY--AEDVCVILFAFGFDDHPVELWDCVHDPVMP---- 54
           M  + ID ET S  D++KCG+ KY  AED  +++ A+  D  P+   D       P    
Sbjct: 1   MKFMNIDIETYSSNDISKCGVYKYTEAEDFEILIIAYSIDGGPISAIDMTKVDNEPFHAD 60

Query: 55  -QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVG 113
            +  K AL +  V   A N+ FERT L   FN  +P   WICT+V +   GLP++L  VG
Sbjct: 61  YETFKIALFDPAVKKYAFNANFERTCLAKHFNKQMPPEEWICTMVNSMRIGLPASLDKVG 120

Query: 114 EALKLSSQKMEEGKELIARF---CKGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTR 169
           E L+L +QK + GK LI  F   CK         RN P H  E W+ F +YC  DV V  
Sbjct: 121 EVLRLQNQKDKAGKNLIRYFSIPCKPTKVNGGRTRNLPEHDLEKWQQFIDYCIRDVEVEM 180

Query: 170 EIFKRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTY 227
            I  +++  P++  EQ  W  DQ INDRG  +  +L    N +    + +L ++ + +T 
Sbjct: 181 TIANKIKDFPVTVIEQAYWVFDQHINDRGIKLSKSLMLGANVLDKQSKEELLKQAKHIT- 239

Query: 228 GLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSA 287
           GL  +     +L  WL  E GL + +L + T Q  L   K+ T +A ++   R++ S+++
Sbjct: 240 GL-ENPNSPTQLLAWLKDEQGLDIPNLQKKTVQDYL---KEATGKAKKMLEIRLQMSKTS 295

Query: 288 VLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLP 347
           V K N + + M SD R+RG  QF GA  TGRW+G     QNL +   S  EL+     + 
Sbjct: 296 VKKYNKMHDMMCSDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTELEIARDLIK 354

Query: 348 TSITSDPD------PLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKA 401
                D D      P  ++S  VR+   A EG +L V+D + IEARV+AW A EQW+L  
Sbjct: 355 EQRFDDLDLLLNVHPQDLLSQLVRTTFTAEEGNELAVSDFSAIEARVIAWYAKEQWRLDV 414

Query: 402 FETGEDLYVTTYARSFNVAPAQVTKDQ--RAIGKVMELALGYQGGAKAFQKMAS-TTGLN 458
           F T   +Y  + ++ FNV    +TK    R  GKV ELALGYQGGA A + M +   G+ 
Sbjct: 415 FNTHGKIYEASASQMFNVPVESITKGDPLRQKGKVSELALGYQGGAGALKAMGALEMGIE 474

Query: 459 LNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVS 518
            N    LV +                                         WR  +  + 
Sbjct: 475 ENELQGLVDS-----------------------------------------WRNANPNIV 493

Query: 519 ELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVY--RDVGNN 576
             W    +A   T+++ K       R     YMK  K  L++ LPSGR+L Y    VG N
Sbjct: 494 NFWKACQEAAINTVKSRKTHHTHGLR----FYMK--KGFLMIELPSGRALAYPKASVGEN 547

Query: 577 R------SYLN-TTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVH 629
                   ++     R+ ++  TYGGKL ENIVQA +RD+LA  +     +G+ IV  VH
Sbjct: 548 SWGSQVVEFMGLDLNRKWSKLKTYGGKLVENIVQATARDLLAISIARLEASGFKIVGHVH 607

Query: 630 DEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           DE++ E P         +  +M     WAKGL L ++G+ S  Y K
Sbjct: 608 DEVIVEIPRGSN-GLKEIETIMNKPVDWAKGLNLNSDGFTSPFYMK 652


>gi|253581725|ref|ZP_04858949.1| DNA polymerase [Fusobacterium varium ATCC 27725]
 gi|251836074|gb|EES64611.1| DNA polymerase [Fusobacterium varium ATCC 27725]
          Length = 657

 Score =  316 bits (809), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 238/719 (33%), Positives = 347/719 (48%), Gaps = 107/719 (14%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYA--EDVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M  L ID ET S +D+ K G+ KYA  +D  ++LFA+  D   V++ D     ++P+V+ 
Sbjct: 1   MKHLSIDIETYSSVDIKKAGMYKYALSDDFQILLFAYSIDFGEVKIIDLAKGEILPEVII 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKL 118
           EAL + ++   A+N+ FE   L         I +W  T+      G  + L A G A+ L
Sbjct: 61  EALNDKNIIKHAYNAPFEWWCLNQA-GYKTSIEQWRDTMFHGLYCGYTAGLGATGAAIGL 119

Query: 119 SSQKMEE--GKELIARFC---KGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTREIF 172
              K ++  GK LI  FC   K         RN P+H  E W LF  YC  DV    EI+
Sbjct: 120 PQDKKKDTTGKALIKLFCVPCKPTKKNGGRLRNLPHHEPEKWELFKNYCIQDVVTETEIY 179

Query: 173 KRLE--PLSSKEQELWYLDQTINDRGYCVDVAL---AHTLNQIVDVERTKLDQELESLTY 227
           KRL   P+  +EQELW LDQ IN  G  +D  L   A ++N IV  E T+     E++  
Sbjct: 180 KRLSNFPVPQEEQELWVLDQKINAYGVKIDTELVKGALSINDIVTAELTE-----EAIQV 234

Query: 228 GLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSA 287
             + +     +L  WL  +TG  +E+L + T   ++ S +    +A++V   R   ++++
Sbjct: 235 TGLDNPNSAAQLGKWLKEKTGQDIENLQKGTVSELIGSLED--KEAVRVLEIRQELAKTS 292

Query: 288 VLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELD---QIIT 344
           + K   + EA+  DGR+RG LQF GA+RTGRW+G +   QNLPR     E LD   +I+ 
Sbjct: 293 IKKYVAMEEAICPDGRIRGLLQFYGANRTGRWAGRLVQVQNLPR--NYLETLDYAREIVK 350

Query: 345 HLPTSITSDPDPLQII--------SDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQ 396
                 + D D L+++        S  +R+  + SEG K VVAD + IEARV+AW+AGEQ
Sbjct: 351 ------SQDADFLKLVYGNVSDTLSQLIRTAFVPSEGHKFVVADFSAIEARVIAWLAGEQ 404

Query: 397 WKLKAFETGEDLYVTTYARSFNVAPAQVTKDQ-----RAIGKVMELALGYQGGAKAFQKM 451
           W+ + F T   +Y  + ++ F V    + K       R  GKV ELALGY G + A   M
Sbjct: 405 WRQEVFATHGKIYEASASQMFGVPIELIKKGNPEYALRQKGKVAELALGYGGSSGALIAM 464

Query: 452 ASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWR 511
            +                               +     E  + D         V + WR
Sbjct: 465 GA-------------------------------LDMGLEEKELPD---------VVRRWR 484

Query: 512 QKHSRVSELWNELHQAFEQTIENG-----KAIIARKRRDVPLVYMKKDKNNLILMLPSGR 566
             + R+++LW  +  A  + +E G     K II    R++ L+Y   D++ L + LPSGR
Sbjct: 485 NANKRITDLWYGIENAVIKLMETGETQGLKGIIF--SREIDLIY---DQDFLTIKLPSGR 539

Query: 567 SLVY-------RDVGNNRSY---LNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMN 616
            L Y          G+N  +   +N TT++   + TYGGKL ENIVQA+SRD LA  +  
Sbjct: 540 KLYYPKPHLKENRFGSNALHYFGVNQTTKKWEVQETYGGKLVENIVQAISRDCLAVTLKR 599

Query: 617 ATKAGYDIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
               G   V+ +HDE V +     + N   +  LM     WA GL LKA G+ES  Y K
Sbjct: 600 LETEGLQTVMHIHDEAVIDADPNVDLNK--VCELMGQPIEWAPGLLLKAAGFESGYYMK 656


>gi|283469578|emb|CAQ48789.1| DNA polymerase [Staphylococcus aureus subsp. aureus ST398]
 gi|283470753|emb|CAQ49964.1| DNA polymerase [Staphylococcus aureus subsp. aureus ST398]
          Length = 653

 Score =  315 bits (806), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 237/706 (33%), Positives = 337/706 (47%), Gaps = 85/706 (12%)

Query: 1   MATLFIDFETRSPIDLTKCGICKY--AEDVCVILFAFGFDDHPVELWDCVHDPVMP---- 54
           M  + ID ET S  D++KCG  KY  AED  +++ A+  D  P+   D       P    
Sbjct: 1   MKFMNIDIETYSSNDISKCGAYKYTEAEDFEILIIAYSIDGGPISAIDMTKVDNEPFHAD 60

Query: 55  -QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVG 113
            +  K AL +  V   A N+ FERT L   FN  +P   WICT+V +   GLP++L  VG
Sbjct: 61  YETFKIALFDPAVKKYAFNANFERTCLAKHFNKQMPPEEWICTMVNSMRIGLPASLDKVG 120

Query: 114 EALKLSSQKMEEGKELIARF---CKGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTR 169
           E L+L +QK + GK LI  F   CK         RN P H  E W+ F +YC  DV V  
Sbjct: 121 EVLRLQNQKDKAGKNLIRYFSIPCKPTKVNGGRTRNLPEHDLEKWQQFIDYCIRDVEVEM 180

Query: 170 EIFKRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTY 227
            I  +++  P+++ EQ  W  DQ INDRG  +  +L    N +    + +L ++ + +T 
Sbjct: 181 AIANKIKDFPVTAIEQTYWVFDQHINDRGIKLSKSLMLGANVLDKQSKEELLKQAKHIT- 239

Query: 228 GLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSA 287
           GL  +     +L  WL  E GL + +L + T Q  L   K+ T +A ++   R++ S+++
Sbjct: 240 GL-ENPNSPTQLLAWLKDEQGLDIPNLQKKTVQDYL---KESTGKAKKMLEIRLQMSKTS 295

Query: 288 VLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLP 347
           V K N + + M SD R+RG  QF GA  TGRW+G     QNL +   S  EL+     + 
Sbjct: 296 VKKYNKMHDMMCSDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTELEIARDLIK 354

Query: 348 TSITSDPD------PLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKA 401
                D D      P  ++S  VR+   A EG +L V+D + IEARV+AW A EQW+L  
Sbjct: 355 EQRFDDLDLLLNVHPQDLLSQLVRTTFTAEEGNELAVSDFSAIEARVIAWYAKEQWRLDV 414

Query: 402 FETGEDLYVTTYARSFNVAPAQVTKDQ--RAIGKVMELALGYQGGAKAFQKMAS-TTGLN 458
           F T   +Y  + ++ FNV    +TK    R  GKV ELALGYQGGA A + M +   G+ 
Sbjct: 415 FNTHGKIYEASASQMFNVPVESITKGDPLRQKGKVSELALGYQGGAGALKAMGALEMGIE 474

Query: 459 LNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVS 518
            N    LV +                                         WR  +  + 
Sbjct: 475 ENELQGLVDS-----------------------------------------WRNANPNIV 493

Query: 519 ELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVY--RDVGNN 576
             W    +A   T+++ K       R     YMK  K  L++ LPSGR+L Y    VG N
Sbjct: 494 NFWKACQEAAINTVKSRKTHHTHGLR----FYMK--KGFLMIELPSGRALAYPKASVGEN 547

Query: 577 R------SYLN-TTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVH 629
                   ++     R+ ++  TYGGKL ENIVQA +RD+LA  +     +G+ IV  VH
Sbjct: 548 SWGSQVVEFMGLDLNRKWSKLKTYGGKLVENIVQATARDLLAISIARLEASGFKIVGHVH 607

Query: 630 DEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           DE++ E P         +  +M     WAKGL L ++G+ S  Y K
Sbjct: 608 DEVIVEIPRGSN-GLKEIETIMNKPVDWAKGLNLNSDGFTSPFYMK 652


>gi|331007743|ref|ZP_08330869.1| phage-like DNA polymerase [gamma proteobacterium IMCC1989]
 gi|330418451|gb|EGG92991.1| phage-like DNA polymerase [gamma proteobacterium IMCC1989]
          Length = 601

 Score =  315 bits (806), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 219/660 (33%), Positives = 328/660 (49%), Gaps = 78/660 (11%)

Query: 33  FAFGFDDHPVELWDCVHDPVMPQVLKEALENTDVTIVAHNSYFERTVLKACFNL-DIPIH 91
           +A G D+ P+ LW    D  +P+ +      ++ TI A NS+FE  +        + PI 
Sbjct: 3   YAIG-DEDPI-LWLPGDD--LPEFVTNP---SEFTIYAWNSFFEWCIWHHVQEWSNAPIF 55

Query: 92  RWICTLVLARSNGLPSALKAVGEALKL--SSQKMEEGKELIARFCKGETHECLYDRNKPN 149
            W  T  LA    +P AL A  +AL L    QK + GK LI R  K    + + D +   
Sbjct: 56  LWTDTAALAAVLAMPRALGACAKALGLPQDQQKDKRGKYLIQRLSKPNRGKRIQDADLLE 115

Query: 150 HREAWRLFGEYCKGDVTVTREIFKRLEPLSSKEQELWYLDQTINDRGYCVDVALAHTLNQ 209
                  F EYC+ DV V R +  RL PLS++E+++W LDQTIN RG  +D         
Sbjct: 116 E------FYEYCRQDVVVERAVLARLRPLSTQERKVWELDQTINIRGVFIDNQSVENALL 169

Query: 210 IVDVERTKLDQELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKL 269
           I+D    KL+QE+  LT   +++    +++  ++  E G  L    +   + VL  ++ L
Sbjct: 170 IIDQVTEKLNQEVAQLTASHLTNVSQRQRVMNYISDELGYSLIKFDKAYLETVLE-DETL 228

Query: 270 TPQAIQVFNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNL 329
            P A ++   R +  +++  K   L + +  D R  G L + GA+ TGRWSG  F PQNL
Sbjct: 229 PPIARRLIEIRQQLGKTSTAKYAALKKIVTEDNRAHGLLMYHGAT-TGRWSGKHFQPQNL 287

Query: 330 PRPS-RSHEELDQIITHLPTSITS--DPDPLQIISDCVRSCVIASEGKKLVVADLAGIEA 386
           PRPS +  +   ++  H  + +      DP++ +S  +R  + A EGK+L+V D + IEA
Sbjct: 288 PRPSFKDTDNCIRLFKHADSELLELIYDDPMEALSSSLRGMICAPEGKRLIVVDYSQIEA 347

Query: 387 RVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAK 446
           RVL W+AG++  L     G ++Y  T ++ + V P +V ++QR IGKV  LALGYQGGAK
Sbjct: 348 RVLPWLAGQEDALTKIRQGVEIYKITASQIYGVPPEKVNEEQRFIGKVATLALGYQGGAK 407

Query: 447 AFQKMASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERV 506
           AFQ MA   G+ ++T                                  DL      + +
Sbjct: 408 AFQGMAEVYGVEIDT----------------------------------DL-----ADEI 428

Query: 507 KKAWRQKHSRVSELWNELHQAFEQTIEN-GKAIIARKRRDVPLVYMKKDKNNLILMLPSG 565
           K  WR  + ++ + W  + +A    + + GK        ++  +  +   N L   LPSG
Sbjct: 429 KVDWRVANRKIVKFWWGVEKAALNAVTHPGKTF------EIRAIKFRFTDNYLFCRLPSG 482

Query: 566 RSLVYRDVGNNRSYL----------NTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMM 615
           R L Y     +              N+ TR+  R+ TYGGKL ENI QAV+RD++AE M+
Sbjct: 483 RLLAYYQPKTSIGKFDKEQVTFMGTNSLTRKWERQNTYGGKLVENITQAVARDLMAEAML 542

Query: 616 NATKAGYDIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
               AGY++VL+VHDE++ E  D D  +      LM   P WAKGLP+ +EG+E  RYRK
Sbjct: 543 RVENAGYEVVLSVHDELIAEAND-DFGSVEEFEQLMCELPVWAKGLPVTSEGFECLRYRK 601


>gi|262049890|ref|ZP_06022752.1| putative DNA polymerase [Staphylococcus aureus D30]
 gi|259162039|gb|EEW46619.1| putative DNA polymerase [Staphylococcus aureus D30]
          Length = 653

 Score =  315 bits (806), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 237/706 (33%), Positives = 336/706 (47%), Gaps = 85/706 (12%)

Query: 1   MATLFIDFETRSPIDLTKCGICKY--AEDVCVILFAFGFDDHPVELWDCVHDPVMP---- 54
           M  + ID ET S  D++KCG+ KY  AED  +++ A+  D  P+   D       P    
Sbjct: 1   MKFMNIDIETYSSNDISKCGVYKYTEAEDFEILIIAYSIDGGPISAIDMTKADNEPFHAD 60

Query: 55  -QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVG 113
            +  K AL +  V   A N+ FERT L   FN  +P   WICT+V +   GLP++L  VG
Sbjct: 61  YETFKIALFDPAVKKYAFNANFERTCLAKHFNKQMPPEEWICTMVNSMRIGLPASLDKVG 120

Query: 114 EALKLSSQKMEEGKELIARF---CKGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTR 169
           E L+L +QK + GK LI  F   CK         RN P H  E W+ F +YC  DV V  
Sbjct: 121 EVLRLQNQKDKAGKNLIRYFSIPCKPTKVNGGRTRNLPEHDLEKWQQFIDYCIRDVEVEM 180

Query: 170 EIFKRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTY 227
            I  +++  P++  EQ  W  DQ INDRG  +  +L    N +    + +L ++ + +T 
Sbjct: 181 TIANKIKDFPVTVIEQAYWVFDQHINDRGIKLSKSLMLGANVLDKQSKEELLKQAKHIT- 239

Query: 228 GLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSA 287
           GL  +     +L  WL  E GL + +L + T Q  L   K  T +A ++   R++ S+++
Sbjct: 240 GL-ENPNSPTQLLAWLKDEQGLDIPNLQKKTVQDYL---KVATGKAKKMLEIRLQMSKTS 295

Query: 288 VLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLP 347
           V K N + + M SD R+RG  QF GA  TGRW+G     QNL +   S  EL+     + 
Sbjct: 296 VKKYNKMHDMMCSDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTELEIARDLIK 354

Query: 348 TSITSDPD------PLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKA 401
                D D      P  ++S  VR+   A EG +L V+D + IEARV+AW A EQW+L  
Sbjct: 355 EQRFDDLDLLLNVHPQDLLSQLVRTTFTAEEGNELAVSDFSAIEARVIAWYAKEQWRLDV 414

Query: 402 FETGEDLYVTTYARSFNVAPAQVTKDQ--RAIGKVMELALGYQGGAKAFQKMAS-TTGLN 458
           F T   +Y  + ++ FNV    +TK    R  GKV ELALGYQGGA A + M +   G+ 
Sbjct: 415 FNTHGKIYEASASQMFNVPVESITKGDPLRQKGKVSELALGYQGGAGALKAMGALEMGIE 474

Query: 459 LNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVS 518
            N    LV +                                         WR  +  + 
Sbjct: 475 ENELQGLVDS-----------------------------------------WRNANPNIV 493

Query: 519 ELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRD--VGNN 576
             W    +A   T+++ K       R     YMK  K  L++ LPSGR+L Y    VG N
Sbjct: 494 NFWKACQEAAINTVKSRKTHHTHGLR----FYMK--KGFLMIELPSGRALAYPKALVGEN 547

Query: 577 R------SYLN-TTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVH 629
                   ++     R+ ++  TYGGKL ENIVQA +RD+LA  +     +G+ IV  VH
Sbjct: 548 SWGSQVIEFMGLDLNRKWSKLKTYGGKLVENIVQATARDLLAISIARLEASGFKIVGHVH 607

Query: 630 DEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           DE++ E P         +  +M     WAKGL L ++G+ S  Y K
Sbjct: 608 DEVIVEIPRGSN-GLKEIETIMNKPVDWAKGLNLNSDGFTSPFYMK 652


>gi|66395454|ref|YP_239831.1| ORF004 [Staphylococcus phage 2638A]
 gi|62635881|gb|AAX90992.1| ORF004 [Staphylococcus phage 2638A]
          Length = 653

 Score =  315 bits (806), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 236/706 (33%), Positives = 338/706 (47%), Gaps = 85/706 (12%)

Query: 1   MATLFIDFETRSPIDLTKCGICKY--AEDVCVILFAFGFDDHPVELWDCVHDPVMP---- 54
           M  + ID ET S  D++KCG  KY  AED  +++ A+  D  PV   D       P    
Sbjct: 1   MKYMNIDIETYSSNDISKCGAYKYVEAEDFEILIIAYSIDGGPVSAIDMTKVDNEPFHAD 60

Query: 55  -QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVG 113
            +  K AL + +V   A N+ FER  L   FN ++P   W CT+V     GLP++L  VG
Sbjct: 61  YETFKIALFDPEVRKYAFNANFERVCLAQHFNKEMPPEEWTCTMVNVTRIGLPASLDKVG 120

Query: 114 EALKLSSQKMEEGKELIARF---CKGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTR 169
           E L L +QK + GK LI  F   CK         RN P H  + W+ F +YC  DV V  
Sbjct: 121 EVLNLQNQKDKAGKNLIRYFSVPCKPTKVNGGRTRNLPQHDPKKWQQFIDYCVRDVEVEM 180

Query: 170 EIFKRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTY 227
            I  +++  P++ +EQ+ W LDQ INDRG  +  +L    N++  + + +L ++   +T 
Sbjct: 181 SIATKIKDFPVTKEEQKYWSLDQHINDRGIKLSKSLMLGANELDKISKAELLKQATKIT- 239

Query: 228 GLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSA 287
           GL + +   + LK WL  E GL + +L + T Q  L   K  T +A Q+   R++ S+++
Sbjct: 240 GLENPNSPSQLLK-WLNEEQGLDIPNLQKKTVQEYL---KYATGKAKQMLEIRLQMSKTS 295

Query: 288 VLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLP 347
           V K N + + M  D R+RG  QF GA  TGRW+G     QNL +   S  EL+     + 
Sbjct: 296 VKKYNKMHDMMCGDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTELNIARDFIK 354

Query: 348 ------TSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKA 401
                   +  D  P  ++S  VR+   A EG  L V+D + IEARV+AW A EQW+L  
Sbjct: 355 EQRFDDLDLLLDIHPQDLLSQLVRTTFTAEEGYALAVSDFSAIEARVIAWYAKEQWRLDV 414

Query: 402 FETGEDLYVTTYARSFNVAPAQVTKDQ--RAIGKVMELALGYQGGAKAFQKMAS-TTGLN 458
           F T   +Y  + A+ F V    + K    R  GKV ELALGYQGG  A + M +   G++
Sbjct: 415 FNTHGKIYEASAAQMFGVPVDSIKKGDPLRQKGKVSELALGYQGGPGALKAMGALDMGID 474

Query: 459 LNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVS 518
            +    LV +                                         WR+ +  + 
Sbjct: 475 ESELQGLVDS-----------------------------------------WRKANPNIV 493

Query: 519 ELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRD--VGNN 576
             W     A  +T+   +  +    R     YMK  K  L++ LPSGRSL Y    VG N
Sbjct: 494 AFWKGCQDAAIETVRTRQTHLTHGLR----FYMK--KGFLMIELPSGRSLAYPKARVGEN 547

Query: 577 R------SYLN-TTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVH 629
                   ++     R+ T+  TYGGKL ENIVQA +RD+LA  M     AG+ IV  VH
Sbjct: 548 SWGSPVVEFMGLDLNRKWTKLKTYGGKLVENIVQATARDLLAISMYRIEHAGFSIVGHVH 607

Query: 630 DEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           DE++ E PD        + ++M+    WA+GL L ++G+ S  Y K
Sbjct: 608 DEVIVEIPDGSG-GLKAIENIMSKPVKWAEGLKLNSDGFTSPFYMK 652


>gi|49485814|ref|YP_043035.1| putative DNA polymerase [Staphylococcus aureus subsp. aureus
           MSSA476]
 gi|49244257|emb|CAG42684.1| putative DNA polymerase [Staphylococcus aureus subsp. aureus
           MSSA476]
          Length = 653

 Score =  314 bits (805), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 236/706 (33%), Positives = 337/706 (47%), Gaps = 85/706 (12%)

Query: 1   MATLFIDFETRSPIDLTKCGICKY--AEDVCVILFAFGFDDHPVELWDCVHDPVMP---- 54
           M  + ID ET S  D++KCG  KY  AED  +++ A+  D   +   D       P    
Sbjct: 1   MKFMNIDIETYSSNDISKCGAYKYTEAEDFEILIIAYSIDGGAISAIDMTKVDNEPFHAD 60

Query: 55  -QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVG 113
            +  K AL +  V   A N+ FERT L   FN  +P   WICT+V +   GLP++L  VG
Sbjct: 61  YETFKIALFDPAVKKYAFNANFERTCLAKHFNKQMPPEEWICTMVNSMRIGLPASLDKVG 120

Query: 114 EALKLSSQKMEEGKELIARF---CKGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTR 169
           E L+L +QK + GK LI  F   CK         RN P H  E W+ F +YC  DV V  
Sbjct: 121 EVLRLQNQKDKAGKNLIRYFSIPCKPTKVNGGRTRNLPEHDLEKWQQFIDYCIRDVEVEM 180

Query: 170 EIFKRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTY 227
            I  +++  P+++ EQ  W  DQ INDRG  +  +L    N +    + +L ++ + +T 
Sbjct: 181 TIANKIKDFPVTAIEQAYWVFDQHINDRGIKLSKSLMLGANVLDKQSKEELLKQAKHIT- 239

Query: 228 GLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSA 287
           GL  +     +L  WL  E GL + +L + T Q  L   K+ T +A ++   R++ S+++
Sbjct: 240 GL-ENPNSPTQLLAWLKAEQGLDIPNLQKKTVQDYL---KRATGKAKKMLEIRLQMSKTS 295

Query: 288 VLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLP 347
           V K N + + M +D R+RG  QF GA  TGRW+G     QNL +   S  EL+     + 
Sbjct: 296 VKKYNKMHDMMCNDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTELEIARDLIK 354

Query: 348 TSITSDPD------PLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKA 401
                D D      P  ++S  VR+   A EG +L V+D + IEARV+AW A EQW+L  
Sbjct: 355 EQRFDDLDLLLNVHPQDLLSQLVRTTFTAEEGNELAVSDFSAIEARVIAWYAKEQWRLDV 414

Query: 402 FETGEDLYVTTYARSFNVAPAQVTKDQ--RAIGKVMELALGYQGGAKAFQKMAS-TTGLN 458
           F T   +Y  + ++ FNV    +TK    R  GKV ELALGYQGGA A + M +   G+ 
Sbjct: 415 FNTHGKIYEASASQMFNVPVESITKGDPLRQKGKVSELALGYQGGAGALKAMGALEMGIE 474

Query: 459 LNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVS 518
            N    LV +                                         WR  +  + 
Sbjct: 475 ENELQGLVDS-----------------------------------------WRNANPNIV 493

Query: 519 ELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVY--RDVGNN 576
             W    +A   T+++ K       R     YMK  K  L++ LPSGR+L Y    VG N
Sbjct: 494 NFWKACQEAAINTVKSRKTHHTHGLR----FYMK--KGFLMIELPSGRALAYPKASVGEN 547

Query: 577 R------SYLN-TTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVH 629
                   ++     R+ ++  TYGGKL ENIVQA +RD+LA  +     +G+ IV  VH
Sbjct: 548 SWGSQVVEFMGLDLNRKWSKLKTYGGKLVENIVQATARDLLAISIARLEASGFKIVGHVH 607

Query: 630 DEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           DE++ E P  D      +  +M     WAKGL L ++G+ S  Y K
Sbjct: 608 DEVIVEIP-KDSNGLKEIETIMNKPVDWAKGLNLNSDGFTSPFYMK 652


>gi|282919245|ref|ZP_06326980.1| DNA polymerase bacteriophage-type [Staphylococcus aureus subsp.
           aureus C427]
 gi|282317055|gb|EFB47429.1| DNA polymerase bacteriophage-type [Staphylococcus aureus subsp.
           aureus C427]
          Length = 653

 Score =  314 bits (805), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 237/706 (33%), Positives = 336/706 (47%), Gaps = 85/706 (12%)

Query: 1   MATLFIDFETRSPIDLTKCGICKY--AEDVCVILFAFGFDDHPVELWDCVHDPVMP---- 54
           M  + ID ET S  D++KCG+ KY  AED  +++ A+  D  P+   D       P    
Sbjct: 1   MKFMNIDIETYSSNDISKCGVYKYTEAEDFEILIIAYSIDGGPISAIDMTKVDNEPFHAD 60

Query: 55  -QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVG 113
            +  K AL +  V   A N+ FERT L   FN  +P   WICT+V +   GLP++L  VG
Sbjct: 61  YETFKIALFDPAVKKYAFNANFERTCLAKHFNKQMPPEEWICTMVNSMRIGLPASLDKVG 120

Query: 114 EALKLSSQKMEEGKELIARF---CKGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTR 169
           E L+L +QK + GK LI  F   CK         RN P H  E W+ F +YC  DV V  
Sbjct: 121 EVLRLQNQKDKAGKNLIRYFSIPCKPTKVNGGRTRNLPEHDLEKWQQFIDYCIRDVEVEM 180

Query: 170 EIFKRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTY 227
            I  +++  P++  EQ  W  DQ INDRG  +  +L    N +    + +L ++ + +T 
Sbjct: 181 TIANKIKDFPVTVIEQAYWVFDQHINDRGIKLSKSLMLGANVLDKQSKEELLKQAKHIT- 239

Query: 228 GLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSA 287
           GL  +     +L  WL  E GL + +L + T Q  L   K  T +A ++   R++ S+++
Sbjct: 240 GL-ENPNSPTQLLAWLKDEQGLDIPNLQKKTVQDYL---KVATGKAKKMLEIRLQMSKTS 295

Query: 288 VLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLP 347
           V K N + + M SD R+RG  QF GA  TGRW+G     QNL +   S  EL+     + 
Sbjct: 296 VKKYNKMHDMMCSDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTELEIARDLIK 354

Query: 348 TSITSDPD------PLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKA 401
                D D      P  ++S  VR+   A EG +L V+D + IEARV+AW A EQW+L  
Sbjct: 355 EQRFDDLDLLLNVHPQDLLSQLVRTTFTAEEGNELAVSDFSAIEARVIAWYAKEQWRLDV 414

Query: 402 FETGEDLYVTTYARSFNVAPAQVTKDQ--RAIGKVMELALGYQGGAKAFQKMAS-TTGLN 458
           F T   +Y  + ++ FNV    +TK    R  GKV ELALGYQGGA A + M +   G+ 
Sbjct: 415 FNTHGKIYEASASQMFNVPVESITKGDPLRQKGKVSELALGYQGGAGALKAMGALEMGIE 474

Query: 459 LNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVS 518
            N    LV +                                         WR  +  + 
Sbjct: 475 ENELQGLVDS-----------------------------------------WRNANPNIV 493

Query: 519 ELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRD--VGNN 576
             W    +A   T+++ K       R     YMK  K  L++ LPSGR+L Y    VG N
Sbjct: 494 NFWKACQEAAINTVKSRKTHHTHGLR----FYMK--KGFLMIELPSGRALAYPKALVGEN 547

Query: 577 R------SYLN-TTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVH 629
                   ++     R+ ++  TYGGKL ENIVQA +RD+LA  +     +G+ IV  VH
Sbjct: 548 SWGSQVVEFMGLDLNRKWSKLKTYGGKLVENIVQATARDLLAISIARLEASGFKIVGHVH 607

Query: 630 DEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           DE++ E P         +  +M     WAKGL L ++G+ S  Y K
Sbjct: 608 DEVIVEIPRGSN-GLKEIETIMNKPVDWAKGLNLNSDGFTSPFYMK 652


>gi|71274493|ref|ZP_00650781.1| DNA-directed DNA polymerase [Xylella fastidiosa Dixon]
 gi|71164225|gb|EAO13939.1| DNA-directed DNA polymerase [Xylella fastidiosa Dixon]
          Length = 567

 Score =  313 bits (802), Expect = 7e-83,   Method: Compositional matrix adjust.
 Identities = 225/575 (39%), Positives = 294/575 (51%), Gaps = 64/575 (11%)

Query: 154 WRLFGEYCKGDVTVTREIFKRLEP--LSSKEQELWYLDQTINDRGYCVDVALAHTLNQIV 211
           W  F EY + DV   R++ KRL     S  E  LW+LDQTINDRG  VD  LA      V
Sbjct: 3   WAQFVEYARRDVAAMRDVVKRLPSHNYSGAELALWFLDQTINDRGVLVDTDLAQAAIGAV 62

Query: 212 DVERTKLDQELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTP 271
           +  +  L    E+LT G V ++   + L   L  E G+ L D+ + T +R L  +  L P
Sbjct: 63  ERAKCTLAHRTEALTGGAVQAATQRDALLHHLSTEHGVALPDMQQHTVERCL--DDPLLP 120

Query: 272 QAI-QVFNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLP 330
           + + ++ + R +AS ++  K   L+   + DGRLRGTLQF GASRTGRW+G +F P NLP
Sbjct: 121 ETVRELLSIRRQASTTSTAKYQALLNCTSRDGRLRGTLQFNGASRTGRWAGRLFQPHNLP 180

Query: 331 RPSRSHEELDQIITHLPTS---ITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEAR 387
           RP+ S   +   I  +      +  D D + + S  +RSC+IA   KKLVVADL+ IE R
Sbjct: 181 RPTLSQPVIAVGIDAMKAGCVDLVFD-DVMALTSSALRSCLIAPTHKKLVVADLSNIEGR 239

Query: 388 VLAWMAGEQWKLKAFE----------------------------------------TGED 407
           VLAW+AGE  KL AF                                          G+D
Sbjct: 240 VLAWLAGETPKLHAFRDFDTCQGVDGTWHSGEAITHGALRGAPITLQRNAEHEPIRQGDD 299

Query: 408 LYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVK 467
           +Y   YA SF +AP  VTK QR IGKV ELALGY GG  AF   A+   ++L   A   +
Sbjct: 300 IYKRAYAHSFGIAPQAVTKQQRQIGKVQELALGYGGGVGAFAAFAAMYHIDLEAMAE--Q 357

Query: 468 TNSAPEEWEDAENFCRWMQENH-PEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELHQ 526
               P   ++A    +W + N  P   + D     AC+  K+AWR  H  ++  W  L  
Sbjct: 358 AALPPLLLQEAVEALQWTKANQRPTFGLSDR-AWLACDVFKRAWRNAHPAIAAFWKALQF 416

Query: 527 AFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYR----DVGNNRSYLNT 582
           A    I + +            + M+  +  L + LPSGR L Y     D     SY+ T
Sbjct: 417 AATDAIRHPETA-----HTCCGITMQYSRAWLRMHLPSGRVLYYAAPRVDEHGALSYMGT 471

Query: 583 --TTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETPDTD 640
              TR+ TR  TYGGKL ENI QAVSRD+LA  M     AGY IVLTVHDEI+ E  D  
Sbjct: 472 HPMTRKWTRITTYGGKLVENITQAVSRDVLAACMPAIEAAGYQIVLTVHDEIITEADDNA 531

Query: 641 EFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
            FNA+ L  LM + P WA+GLPL AEG+++ RYRK
Sbjct: 532 AFNAAHLAALMATPPPWAQGLPLAAEGFQTHRYRK 566


>gi|156603970|ref|YP_001429916.1| hypothetical protein SPTP3102_gp21 [Staphylococcus phage tp310-2]
 gi|154818056|gb|ABS87483.1| hypothetical protein [Staphylococcus phage tp310-2]
          Length = 650

 Score =  312 bits (800), Expect = 9e-83,   Method: Compositional matrix adjust.
 Identities = 237/701 (33%), Positives = 333/701 (47%), Gaps = 85/701 (12%)

Query: 6   IDFETRSPIDLTKCGICKY--AEDVCVILFAFGFDDHPVELWDCVHDPVMP-----QVLK 58
           ID ET S  D++KCG  KY  AED  +++ A+  D   +   D       P     +  K
Sbjct: 3   IDIETYSSNDISKCGAYKYTEAEDFEILIIAYSIDGGAISAIDMTKVDNEPFHADYETFK 62

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKL 118
            AL +  V   A N+ FERT L   FN  +P   WICT+V +   GLP++L  VGE L+L
Sbjct: 63  IALFDPAVKKYAFNANFERTCLAKHFNKQMPPEEWICTMVNSMRIGLPASLDKVGEVLRL 122

Query: 119 SSQKMEEGKELIARF---CKGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTREIFKR 174
            SQK + GK LI  F   CK         RN P H  E W+ F +YC  DV V   I  +
Sbjct: 123 QSQKDKAGKNLIRYFSIPCKPTKVNGGRTRNLPEHDLEKWQQFIDYCIRDVEVEMAIANK 182

Query: 175 LE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSS 232
           ++  P+++ EQ  W  DQ INDRG  +  +L    N +    + +L ++ + +T GL  +
Sbjct: 183 IKDFPVTAIEQTYWVFDQHINDRGIKLSKSLMLGANVLDKQSKEELLKQAKHIT-GL-EN 240

Query: 233 SRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLN 292
                +L  WL  E GL + +L + T Q  L   K+ T +A ++   R++ S+++V K N
Sbjct: 241 PNSPTQLLAWLKDEQGLDIPNLQKKTVQEYL---KEATGKAKKMLEIRLQMSKTSVKKYN 297

Query: 293 TLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITS 352
            + + M SD R+RG  QF GA  TGRW+G     QNL +   S  EL+     +      
Sbjct: 298 KMHDMMCSDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTELEIARDLIKEQRFD 356

Query: 353 DPD------PLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGE 406
           D D      P  ++S  VR+   A EG +L V+D + IEARV+AW A EQW+L  F T  
Sbjct: 357 DLDLLLNVHPQDLLSQLVRTTFTAEEGNELAVSDFSAIEARVIAWYAKEQWRLDVFNTHG 416

Query: 407 DLYVTTYARSFNVAPAQVTKDQ--RAIGKVMELALGYQGGAKAFQKMAS-TTGLNLNTFA 463
            +Y  + ++ FNV    +TK    R  GKV ELALGYQGGA A + M +   G+  N   
Sbjct: 417 KIYEASASQMFNVPVESITKGDPLRQKGKVSELALGYQGGAGALKAMGALEMGIEENELQ 476

Query: 464 HLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNE 523
            LV +                                         WR  +  +   W  
Sbjct: 477 GLVDS-----------------------------------------WRNANPNIVNFWKA 495

Query: 524 LHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRD--VGNNR---- 577
             +A   T+++ K       R     YMK  K  L++ LPSGR+L Y    VG N     
Sbjct: 496 CQEAAINTVKSRKTHHTHGLR----FYMK--KGFLMIELPSGRALAYPKALVGENSWGSQ 549

Query: 578 --SYLN-TTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVC 634
              ++     R+ ++  TYGGKL ENIVQA +RD+LA  +      GY IV  VHDE++ 
Sbjct: 550 VVEFMGLDLNRKWSKLKTYGGKLVENIVQATARDLLAISIARLEALGYKIVGHVHDEVIV 609

Query: 635 ETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           E P         +  +M     WAKGL L ++G+ S  Y K
Sbjct: 610 EIPRGSN-GLKEIETIMNKPVEWAKGLNLNSDGFTSPFYMK 649


>gi|66395591|ref|YP_239981.1| ORF003 [Staphylococcus phage 3A]
 gi|62635937|gb|AAX91048.1| ORF003 [Staphylococcus phage 3A]
          Length = 650

 Score =  312 bits (799), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 236/701 (33%), Positives = 333/701 (47%), Gaps = 85/701 (12%)

Query: 6   IDFETRSPIDLTKCGICKY--AEDVCVILFAFGFDDHPVELWDCVHDPVMP-----QVLK 58
           ID ET S  D++KCG+ KY  AED  +++ A+  D  P+   D       P     +  K
Sbjct: 3   IDIETYSSNDISKCGVYKYTEAEDFEILIIAYSIDGGPISAIDMTKVDNEPFHADYETFK 62

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKL 118
            AL +  V   A N+ FERT L   FN  +P   WICT+V +   GLP++L  VGE L+L
Sbjct: 63  IALFDPAVKKYAFNANFERTCLAKHFNKQMPPEEWICTMVNSMRIGLPASLDKVGEVLRL 122

Query: 119 SSQKMEEGKELIARF---CKGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTREIFKR 174
            +QK + GK LI  F   CK         RN P H  E W+ F +YC  DV V   I  +
Sbjct: 123 QNQKDKAGKNLIRYFSIPCKPTKVNGGRTRNLPEHDLEKWQQFIDYCIRDVEVEMTIANK 182

Query: 175 LE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSS 232
           ++  P++  EQ  W  DQ INDRG  +  +L    N +    + +L ++ + +T GL  +
Sbjct: 183 IKDFPVTVIEQAYWVFDQHINDRGIKLSKSLMLGANVLDKQSKEELLKQAKHIT-GL-EN 240

Query: 233 SRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLN 292
                +L  WL  E GL + +L + T Q  L   K  T +A ++   R++ S+++V K N
Sbjct: 241 PNSPTQLLAWLKDEQGLDIPNLQKKTVQDYL---KVATGKAKKMLEIRLQMSKTSVKKYN 297

Query: 293 TLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITS 352
            + + M SD R+RG  QF GA  TGRW+G     QNL +   S  EL+     +      
Sbjct: 298 KMHDMMCSDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTELEIARDLIKEQRFD 356

Query: 353 DPD------PLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGE 406
           D D      P  ++S  VR+   A EG +L V+D + IEARV+AW A EQW+L  F T  
Sbjct: 357 DLDLLLNVHPQDLLSQLVRTTFTAEEGNELAVSDFSAIEARVIAWYAKEQWRLDVFNTHG 416

Query: 407 DLYVTTYARSFNVAPAQVTKDQ--RAIGKVMELALGYQGGAKAFQKMAS-TTGLNLNTFA 463
            +Y  + ++ FNV    +TK    R  GKV ELALGYQGGA A + M +   G+  N   
Sbjct: 417 KIYEASASQMFNVPVESITKGDPLRQKGKVSELALGYQGGAGALKAMGALEMGIEENELQ 476

Query: 464 HLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNE 523
            LV +                                         WR  +  +   W  
Sbjct: 477 GLVDS-----------------------------------------WRNANPNIVNFWKA 495

Query: 524 LHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRD--VGNNR---- 577
             +A   T+++ K       R     YMK  K  L++ LPSGR+L Y    VG N     
Sbjct: 496 CQEAAINTVKSRKTHHTHGLR----FYMK--KGFLMIELPSGRALAYPKALVGENSWGSQ 549

Query: 578 --SYLN-TTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVC 634
              ++     R+ ++  TYGGKL ENIVQA +RD+LA  +      G+ IV  VHDE++ 
Sbjct: 550 VVEFMGLDLNRKWSKLKTYGGKLVENIVQATARDLLAISIARLEALGFKIVGHVHDEVIV 609

Query: 635 ETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           E P         +  +M     WAKGL L ++G+ S  Y K
Sbjct: 610 EIPRGSN-GLKEIETIMNKPVDWAKGLNLNSDGFTSPFYMK 649


>gi|66395659|ref|YP_240050.1| ORF003 [Staphylococcus phage 47]
 gi|282911107|ref|ZP_06318909.1| phage encoded DNA polymerase I [Staphylococcus aureus subsp. aureus
           WBG10049]
 gi|297207805|ref|ZP_06924239.1| bacteriophage DNA-directed DNA polymerase [Staphylococcus aureus
           subsp. aureus ATCC 51811]
 gi|62636083|gb|AAX91194.1| ORF003 [Staphylococcus phage 47]
 gi|282324802|gb|EFB55112.1| phage encoded DNA polymerase I [Staphylococcus aureus subsp. aureus
           WBG10049]
 gi|296887521|gb|EFH26420.1| bacteriophage DNA-directed DNA polymerase [Staphylococcus aureus
           subsp. aureus ATCC 51811]
 gi|312438063|gb|ADQ77134.1| bacterophage DNA-directed DNA polymerase [Staphylococcus aureus
           subsp. aureus TCH60]
 gi|329724432|gb|EGG60942.1| DNA-directed DNA polymerase [Staphylococcus aureus subsp. aureus
           21189]
          Length = 653

 Score =  312 bits (799), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 237/706 (33%), Positives = 335/706 (47%), Gaps = 85/706 (12%)

Query: 1   MATLFIDFETRSPIDLTKCGICKY--AEDVCVILFAFGFDDHPVELWDCVHDPVMP---- 54
           M  + ID ET S  D++KCG  KY  AED  +++ A+  D   +   D       P    
Sbjct: 1   MKFMNIDIETYSSNDISKCGAYKYTEAEDFEILIIAYSIDGGAISAIDMTKVDNEPFHAD 60

Query: 55  -QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVG 113
            +  K AL +  V   A N+ FERT L   FN  +P   WICT+V +   GLP++L  VG
Sbjct: 61  YETFKIALFDPAVKKYAFNANFERTCLAKHFNKQMPPEEWICTMVNSMRIGLPASLDKVG 120

Query: 114 EALKLSSQKMEEGKELIARF---CKGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTR 169
           E L+L SQK + GK LI  F   CK         RN P H  E W+ F +YC  DV V  
Sbjct: 121 EVLRLQSQKDKAGKNLIRYFSIPCKPTKVNGGRTRNLPEHDLEKWQQFIDYCIRDVEVEM 180

Query: 170 EIFKRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTY 227
            I  +++  P+++ EQ  W  DQ INDRG  +  +L    N +    + +L ++ + +T 
Sbjct: 181 AIANKIKDFPVTAIEQTYWVFDQHINDRGIKLSKSLMLGANVLDKQSKEELLKQAKHIT- 239

Query: 228 GLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSA 287
           GL  +     +L  WL  E GL + +L + T Q  L   K+ T +A ++   R++ S+++
Sbjct: 240 GL-ENPNSPTQLLAWLKDEQGLDIPNLQKKTVQEYL---KEATGKAKKMLEIRLQMSKTS 295

Query: 288 VLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLP 347
           V K N + + M SD R+RG  QF GA  TGRW+G     QNL +   S  EL+     + 
Sbjct: 296 VKKYNKMHDMMCSDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTELEIARDLIK 354

Query: 348 TSITSDPD------PLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKA 401
                D D      P  ++S  VR+   A EG +L V+D + IEARV+AW A EQW+L  
Sbjct: 355 EQRFDDLDLLLNVHPQDLLSQLVRTTFTAEEGNELAVSDFSAIEARVIAWYAKEQWRLDV 414

Query: 402 FETGEDLYVTTYARSFNVAPAQVTKDQ--RAIGKVMELALGYQGGAKAFQKMAS-TTGLN 458
           F T   +Y  + ++ FNV    +TK    R  GKV ELALGYQGGA A + M +   G+ 
Sbjct: 415 FNTHGKIYEASASQMFNVPVESITKGDPLRQKGKVSELALGYQGGAGALKAMGALEMGIE 474

Query: 459 LNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVS 518
            N    LV +                                         WR  +  + 
Sbjct: 475 ENELQGLVDS-----------------------------------------WRNANPNIV 493

Query: 519 ELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRD--VGNN 576
             W    +A   T+++ K       R     YMK  K  L++ LPSGR+L Y    VG N
Sbjct: 494 NFWKACQEAAINTVKSRKTHHTHGLR----FYMK--KGFLMIELPSGRALAYPKALVGEN 547

Query: 577 R------SYLN-TTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVH 629
                   ++     R+ ++  TYGGKL ENIVQA +RD+LA  +      G+ IV  VH
Sbjct: 548 SWGSQVVEFMGLDLNRKWSKLKTYGGKLVENIVQATARDLLAISIARLEALGFKIVGHVH 607

Query: 630 DEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           DE++ E P         +  +M     WAKGL L ++G+ S  Y K
Sbjct: 608 DEVIVEIPRGSN-GLKEIETIMNKPVDWAKGLNLNSDGFTSPFYMK 652


>gi|116630096|ref|YP_815268.1| DNA polymerase I [Lactobacillus gasseri ATCC 33323]
 gi|238854131|ref|ZP_04644478.1| DNA polymerase [Lactobacillus gasseri 202-4]
 gi|116095678|gb|ABJ60830.1| DNA polymerase I - 3'-5' exonuclease and polymerase domain
           [Lactobacillus gasseri ATCC 33323]
 gi|238833207|gb|EEQ25497.1| DNA polymerase [Lactobacillus gasseri 202-4]
          Length = 644

 Score =  312 bits (799), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 229/704 (32%), Positives = 346/704 (49%), Gaps = 90/704 (12%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M  + ID ET S  +L + G+ +YA+  D  ++LF +  D  PV++ D      +PQ + 
Sbjct: 1   MKQISIDIETYSSTNLNQTGVYRYADSDDFELLLFGYATDLGPVKVVDLTQGEKIPQPIV 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKL 118
           +AL++  +   A N+ FER  L       +    W C+ V + + GLP +L  VG  L L
Sbjct: 61  KALDDPTIIKSAFNAQFERVCLSRFVGHRLKPAGWHCSRVWSATLGLPLSLSDVGTVLGL 120

Query: 119 SSQKMEEGKELIARF---CKGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTREIFKR 174
             QK+  GKEL+  F   CK         RN P H  + W+ F +Y + DV V  EI ++
Sbjct: 121 PRQKITAGKELVRYFCTPCKPTKSNQNRTRNFPYHAPDKWQQFKQYNQRDVEVEMEITQK 180

Query: 175 LE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQEL---ESLTYGL 229
           LE  P+S  E E +++DQ INDRG  +D  L   +N  +  +    DQ L   + LT GL
Sbjct: 181 LERFPVSQNEWENYWMDQDINDRGIRIDQQL---VNNAIKCQENFHDQYLQVSQKLT-GL 236

Query: 230 VSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVL 289
            + +  L+ LK WL  + G++++ L++ +  ++L +    T +  QV + R   S+S+V 
Sbjct: 237 ANPNSPLQ-LKDWLN-QRGMNIDSLSKASVAQLLQTT---TGKVHQVLSLRQLLSKSSVK 291

Query: 290 KLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSH-EELDQII----- 343
           K   + +AM  DGR+ G LQF GA+RTGRW+G +   QNLPR S    EE  +++     
Sbjct: 292 KYQAMQKAMCRDGRVHGLLQFYGANRTGRWAGRLVQVQNLPRNSMPDLEEARELVKQGNT 351

Query: 344 THLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFE 403
           T L     S PD   ++S  +R+  I S+G    VAD + +EARV+AW++GE+W+ KAF 
Sbjct: 352 TALSMLYDSVPD---VLSQLIRTAFIPSQGHHFYVADFSAVEARVIAWLSGEEWRQKAFA 408

Query: 404 TGEDLYVTTYARSFNVAPAQ--VTKDQRAIGKVMELALGYQGGAKAFQKMASTT-GLNLN 460
             ED+Y  + ++ F V   +  V  + R  GK+ ELALGY G   A + M +T  GL   
Sbjct: 409 NNEDIYCASASQMFGVPVVKHGVNGELRQKGKIAELALGYGGSIGALKAMGATNLGLTEE 468

Query: 461 TFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSEL 520
               LV+                                          WR     + + 
Sbjct: 469 ELHSLVQM-----------------------------------------WRNASPHIVQF 487

Query: 521 WNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYR--DVGNNRS 578
           W ++ +A ++ I   K+ + +    +  +Y       + L L SGR L Y    +G NR 
Sbjct: 488 WWDIDKAAKECI---KSHLPQATHGIKFIYR---SGCMFLRLRSGRKLCYSKPKIGINRF 541

Query: 579 YLNTTT-------RQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDE 631
              + T       ++  R  TYG KL ENIVQA SRD+LAE M     AG  +V+ +HDE
Sbjct: 542 GSESITFMGINAVKKWDRIETYGAKLVENIVQATSRDLLAEAMRRLEDAGNPVVMHIHDE 601

Query: 632 IVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
            V + P    ++   +  +MT  P WA GL L A G+ S  Y+K
Sbjct: 602 AVIDAPAN--YSLEKMVKIMTEVPRWADGLILNAAGFVSDFYKK 643


>gi|284024530|ref|ZP_06378928.1| DNA-directed DNA polymerase [Staphylococcus aureus subsp. aureus
           132]
          Length = 653

 Score =  312 bits (799), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 236/706 (33%), Positives = 335/706 (47%), Gaps = 85/706 (12%)

Query: 1   MATLFIDFETRSPIDLTKCGICKY--AEDVCVILFAFGFDDHPVELWDCVHDPVMP---- 54
           M  + ID ET S  D++KCG+ KY  AED  +++ A+  D   +   D       P    
Sbjct: 1   MKFMNIDIETYSSNDISKCGVYKYTEAEDFEILIIAYSIDGGAISAIDMTKVDTEPFHAD 60

Query: 55  -QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVG 113
            +  K AL +  V   A N+ FERT L   FN  +P   WICT+V +   GLP++L  VG
Sbjct: 61  YETFKIALFDPAVKKYAFNANFERTCLAKYFNKQMPPEEWICTMVNSMRIGLPASLDKVG 120

Query: 114 EALKLSSQKMEEGKELIARF---CKGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTR 169
           E L+L +QK + GK LI  F   CK         RN P H  E W+ F +YC  DV V  
Sbjct: 121 EVLRLQNQKDKAGKNLIRYFSIPCKPTKVNGGRTRNLPEHDLEKWQQFIDYCIRDVEVEM 180

Query: 170 EIFKRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTY 227
            I  +++  P++  EQ  W  DQ INDRG  +  +L    N +    + +L ++ + +T 
Sbjct: 181 TIANKIKDFPVTVIEQAYWVFDQHINDRGIKLSKSLMLGANVLDKQSKEELLKQAKHIT- 239

Query: 228 GLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSA 287
           GL  +     +L  WL  E GL + +L + T Q  L   K  T +A ++   R++ S+++
Sbjct: 240 GL-ENPNSPTQLLAWLKDEQGLDIPNLQKKTVQDYL---KVATGKAKKMLEIRLQMSKTS 295

Query: 288 VLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLP 347
           V K N + + M SD R+RG  QF GA  TGRW+G     QNL +   S  EL+     + 
Sbjct: 296 VKKYNKMHDMMCSDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTELEIARDLIK 354

Query: 348 TSITSDPD------PLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKA 401
                D D      P  ++S  VR+   A EG +L V+D + IEARV+AW A EQW+L  
Sbjct: 355 EQRFDDLDLLLNVHPQDLLSQLVRTTFTAEEGNELAVSDFSAIEARVIAWYAKEQWRLDV 414

Query: 402 FETGEDLYVTTYARSFNVAPAQVTKDQ--RAIGKVMELALGYQGGAKAFQKMAS-TTGLN 458
           F T   +Y  + ++ FNV    +TK    R  GKV ELALGYQGGA A + M +   G+ 
Sbjct: 415 FNTHGKIYEASASQMFNVPVESITKGDPLRQKGKVSELALGYQGGAGALKAMGALEMGIE 474

Query: 459 LNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVS 518
            N    LV +                                         WR  +  + 
Sbjct: 475 ENELQGLVDS-----------------------------------------WRNANPNIV 493

Query: 519 ELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRD--VGNN 576
             W    +A   T+++ K       R     YMK  K  L++ LPSGR+L Y    VG N
Sbjct: 494 NFWKACQEAAINTVKSRKTHHTHGLR----FYMK--KGFLMIELPSGRALAYPKALVGEN 547

Query: 577 R------SYLN-TTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVH 629
                   ++     R+ ++  TYGGKL ENIVQA +RD+LA  +     +G+ IV  VH
Sbjct: 548 SWGSQVVEFMGLDLNRKWSKLKTYGGKLVENIVQATARDLLAISIARLEASGFKIVGHVH 607

Query: 630 DEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           DE++ E P         +  +M     WAKGL L ++G+ S  Y K
Sbjct: 608 DEVIVEIPRGSN-GLKEIETIMNKPVDWAKGLNLNSDGFTSPFYMK 652


>gi|170730595|ref|YP_001776028.1| phage-related DNA polymerase [Xylella fastidiosa M12]
 gi|167965388|gb|ACA12398.1| phage-related DNA polymerase [Xylella fastidiosa M12]
          Length = 567

 Score =  312 bits (799), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 227/575 (39%), Positives = 295/575 (51%), Gaps = 64/575 (11%)

Query: 154 WRLFGEYCKGDVTVTREIFKRLEP--LSSKEQELWYLDQTINDRGYCVDVALAHTLNQIV 211
           W  F EY + DV   R++ KRL     S  E  LW+LDQTINDRG  VD  LA      V
Sbjct: 3   WAQFVEYARRDVAAMRDVVKRLPSHNYSGAELALWFLDQTINDRGVLVDTDLAQAAIGAV 62

Query: 212 DVERTKLDQELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTP 271
           +  +  L    E+LT G V ++   + L   L  E G+ L D+ + T +R L  +  L P
Sbjct: 63  ERAKCTLAHRTEALTGGAVQAATQRDALLHHLSTEHGVALPDMQQHTVERCL--DDPLLP 120

Query: 272 QAI-QVFNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLP 330
           + + ++ + R +AS ++  K   L+   + DGRLRGTLQF GASRTGRW+G +F P NLP
Sbjct: 121 ETVRELLSIRRQASTTSTAKYQALLNCTSRDGRLRGTLQFNGASRTGRWAGRLFQPHNLP 180

Query: 331 RPSRSHEELDQIITHLPTS---ITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEAR 387
           RP+ S   +   I  +      +  D D + + S  +RSC+IA   KKLVVADL+ IE R
Sbjct: 181 RPTLSQPVIAVGIDAMKAGCVDVVFD-DVMALTSSALRSCLIAPTHKKLVVADLSNIEGR 239

Query: 388 VLAWMAGEQWKLKAF----------------------------------------ETGED 407
           VLAW+AGE  KL AF                                          G+D
Sbjct: 240 VLAWLAGETPKLHAFGDFDTCQGVDGTWHSGEAITHGALRGAPITLQRNAEHEPIRQGDD 299

Query: 408 LYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVK 467
           +Y   YA SF +AP  VTK+QR IGKV ELALGY GG  AF   A+   ++L   A   +
Sbjct: 300 IYKRAYAHSFGIAPQAVTKEQRQIGKVQELALGYGGGVGAFAAFAAMYHIDLEAMAE--Q 357

Query: 468 TNSAPEEWEDAENFCRWMQENH-PEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELHQ 526
               P   ++A    +W + N  P   + D     AC+  K+AWR  H  ++  W  L  
Sbjct: 358 AALPPLLLQEAVEALQWTKANQRPTFGLSDR-AWLACDVFKRAWRNAHPAIAAFWQALQ- 415

Query: 527 AFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYR----DVGNNRSYLNT 582
            F  T   G    A     + + Y    +  L L LPSGR L Y     D     SY+ T
Sbjct: 416 -FAATDAIGHPETAHTCCGITVQY---SRAWLRLRLPSGRVLYYAAPRVDEHGALSYMGT 471

Query: 583 --TTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETPDTD 640
              TR+ TR  TYGGKL ENI QAVSRD+LA  M     AGY IVLTVHDE++ E  D  
Sbjct: 472 HPITRKWTRITTYGGKLVENITQAVSRDVLAACMPAIEAAGYAIVLTVHDEMITEADDNA 531

Query: 641 EFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
            FNA+ L  LM + P WA+GLPL AEG+++ RYRK
Sbjct: 532 AFNAAHLAALMATPPPWAQGLPLAAEGFQTHRYRK 566


>gi|71898326|ref|ZP_00680499.1| DNA-directed DNA polymerase [Xylella fastidiosa Ann-1]
 gi|71731849|gb|EAO33907.1| DNA-directed DNA polymerase [Xylella fastidiosa Ann-1]
          Length = 567

 Score =  312 bits (799), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 224/575 (38%), Positives = 294/575 (51%), Gaps = 64/575 (11%)

Query: 154 WRLFGEYCKGDVTVTREIFKRLEP--LSSKEQELWYLDQTINDRGYCVDVALAHTLNQIV 211
           W  F EY + DV   R++ KRL     S  E  LW+LDQTINDRG  VD  LA      V
Sbjct: 3   WAQFVEYARRDVAAMRDVVKRLPSHNYSGAELALWFLDQTINDRGVLVDTDLAQAAIGAV 62

Query: 212 DVERTKLDQELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTP 271
           +  +  L    E+LT G V ++   + L   L  E G+ L D+ + T +R L  +  L P
Sbjct: 63  ERAKCTLAHRTEALTGGAVQAATQRDALLHHLSTEHGVALPDMQQHTVERCL--DDPLLP 120

Query: 272 QAI-QVFNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLP 330
           + + ++ + R +AS ++  K   L+   + DGRLRGTLQF GASRTGRW+G +F P NLP
Sbjct: 121 ETVRELLSIRRQASTTSTAKYQALLNCTSRDGRLRGTLQFNGASRTGRWAGRLFQPHNLP 180

Query: 331 RPSRSHEELDQIITHLPTS---ITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEAR 387
           RP+ S   +   I  +      +  D D + + S  +RSC+IA   KKLVVADL+ IE R
Sbjct: 181 RPTLSQPVIAVGIDAMKAGCVDLVFD-DVMALTSSALRSCLIAPTHKKLVVADLSNIEGR 239

Query: 388 VLAWMAGEQWKLKAFE----------------------------------------TGED 407
           VLAW+AGE  KL AF                                          G+D
Sbjct: 240 VLAWLAGETPKLHAFRDFDTCQGVDGTWHSGEAITHGALRGAPITLQRNAEHEPIRQGDD 299

Query: 408 LYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVK 467
           +Y   YA SF +AP  VTK QR IGKV ELALGY GG  AF   A+   ++L   A   +
Sbjct: 300 IYKRAYAHSFGIAPQAVTKQQRQIGKVQELALGYGGGVGAFAAFAAMYHIDLEAMAE--Q 357

Query: 468 TNSAPEEWEDAENFCRWMQENH-PEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELHQ 526
               P   ++A    +W + N  P   + D     AC+  K+AWR  H  ++  W  L  
Sbjct: 358 AALPPLLLQEAVEALQWTKANQRPTFGLSDR-AWLACDVFKRAWRNAHPAIAAFWKALQF 416

Query: 527 AFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYR----DVGNNRSYLNT 582
           A    I + +            + M+  +  L + LPSGR L Y     D     SY+ T
Sbjct: 417 AATDAIRHPETA-----HTCCGITMQYSRAWLRMHLPSGRVLYYAAPRVDEHGALSYMGT 471

Query: 583 --TTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETPDTD 640
              TR+ TR  TYGGKL ENI QAVSRD+LA  M     AGY IVLTVHDE++ E  D  
Sbjct: 472 HPMTRKWTRITTYGGKLVENITQAVSRDVLAACMPAIEAAGYAIVLTVHDEMITEADDNA 531

Query: 641 EFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
            FNA+ L  LM + P WA+GLPL AEG+++ RYRK
Sbjct: 532 AFNAAHLAALMATPPPWAQGLPLAAEGFQTHRYRK 566


>gi|255994008|ref|ZP_05427143.1| prophage LambdaSa04, DNA polymerase [Eubacterium saphenum ATCC
           49989]
 gi|255993676|gb|EEU03765.1| prophage LambdaSa04, DNA polymerase [Eubacterium saphenum ATCC
           49989]
          Length = 666

 Score =  311 bits (798), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 237/715 (33%), Positives = 334/715 (46%), Gaps = 98/715 (13%)

Query: 4   LFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQV----L 57
           L+ID ET S +D+   G+ KYAE  D  V+L A+  DD  VEL D      + Q     +
Sbjct: 6   LYIDIETFSSVDIRTAGLYKYAESGDFEVLLLAYAIDDGDVELIDLTDGGEITQQKLVGV 65

Query: 58  KEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALK 117
           +  LE+ +    AHN++FE   LK   ++ I   RW CT+V     G P++L+ +GEAL 
Sbjct: 66  RRLLESQNYIKCAHNAHFEMECLKRALHIIIRPSRWECTMVKGMYRGYPASLEKMGEALD 125

Query: 118 L--SSQKMEEGKELIARFCK---------GETHECLYDRNKPNH-REAWRLFGEYCKGDV 165
           +     K+  GK LI  FCK         G T      RN P H  E W LF EYCK DV
Sbjct: 126 MPEDKAKLRTGKALINYFCKPCKPTKTNGGRT------RNLPKHASEKWELFREYCKRDV 179

Query: 166 TVTREIFKRLEPLSSKEQELWYLDQTINDRGYCVDVALAHTLNQI-VDVERTKLDQELES 224
            V REI K L  +       W  D  +N RG  VD AL      I  +V+   LD  ++ 
Sbjct: 180 EVAREIDKMLPDVPQGVHTEWMRDYLVNWRGIAVDEALVEAAIAIDGEVKSAHLDT-IKR 238

Query: 225 LTYGLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRAS 284
           +T   V + R   ++  WL       +  L   + + +L S+  LT  A  V        
Sbjct: 239 ITG--VDNPRSRAQVLDWLNDTLDEEITSLNAASVKALLESD--LTDDARAVLTAWQGLG 294

Query: 285 RSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIIT 344
           +++  K  TL  A   D R+RG LQF GASRTGRW+G +  P NLPR    +  L+Q   
Sbjct: 295 KTSTKKYETLRAAAQKDNRVRGLLQFYGASRTGRWAGRLVQPHNLPRGDVYN--LNQAGE 352

Query: 345 HLPTSITSDPDPLQ-----IISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKL 399
            +      D + L       +S  +R+C +  EG K V+ D + IEARVLAW+AGE W L
Sbjct: 353 LVKAGHKKDIELLHGSVPNTLSGLIRTCFVPREGCKFVICDYSAIEARVLAWLAGEHWVL 412

Query: 400 KAFETGEDLYVTTYARSFNVAPAQVTKDQ-----RAIGKVMELALGYQGGAKAFQKMAST 454
           + F+    +Y  T AR +N+  + + K       R  GK+  LALGYQG   A ++M ++
Sbjct: 413 EEFKGDGKIYEATAARMYNIDKSTIIKGHSNYAYRQKGKIATLALGYQGAVGALRQMGAS 472

Query: 455 TGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKH 514
                                                   ED F       + +AWR  +
Sbjct: 473 ----------------------------------------EDEFTDDELRGLVRAWRVAN 492

Query: 515 SRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKK----DKNNLILMLPSGRSLVY 570
             ++ELW       + T+ +     +     +P+ +       +  NL + LPSGR L Y
Sbjct: 493 PCIAELWRYTEMMAKSTVSD--EFYSGTNPMIPISFKSTLNAVNGINLAIGLPSGRELYY 550

Query: 571 RD---VGNNRSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATK----AGYD 623
            +   V     Y + T    T+E TYGGKL ENIVQA++RD+LA+ +   TK     G +
Sbjct: 551 HNPVIVDGAIYYTDYTHAGKTKEQTYGGKLVENIVQAIARDVLADAINRITKTLVVGGIN 610

Query: 624 --IVLTVHDEIVCET-PDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
             IVL VHDE+V E      E    +L  + ++ PSWA+GLPLK E + S  Y+K
Sbjct: 611 AHIVLHVHDEVVVEAEAGCAEKVQELLEGVFSTPPSWAEGLPLKGESFISDYYKK 665


>gi|329730633|gb|EGG67018.1| DNA-directed DNA polymerase [Staphylococcus aureus subsp. aureus
           21193]
          Length = 653

 Score =  311 bits (797), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 236/706 (33%), Positives = 336/706 (47%), Gaps = 85/706 (12%)

Query: 1   MATLFIDFETRSPIDLTKCGICKY--AEDVCVILFAFGFDDHPVELWDCVHDPVMP---- 54
           M  + ID ET S  D++KCG  KY  AED  +++ A+  D   +   D       P    
Sbjct: 1   MKFMNIDIETYSSNDISKCGAYKYTEAEDFEILIIAYSIDGGAISAIDMTKVDNEPFHAD 60

Query: 55  -QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVG 113
            +  K AL +  V   A N+ FERT L   FN  +P   WICT+V +   GLP++L  VG
Sbjct: 61  YETFKIALFDPAVKKYAFNANFERTCLAKHFNKQMPPEEWICTMVNSMRIGLPASLDKVG 120

Query: 114 EALKLSSQKMEEGKELIARF---CKGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTR 169
           E L+L +QK + GK LI  F   CK         RN P H  E W+ F +YC  DV V  
Sbjct: 121 EVLRLQNQKDKAGKNLIRYFSIPCKPTKVNGGRTRNLPEHDLEKWQQFIDYCIRDVEVEM 180

Query: 170 EIFKRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTY 227
            I  +++  P+++ EQ  W  DQ INDRG  +  +L    N +    + +L ++ + +T 
Sbjct: 181 TIAHKIKDFPVTAIEQTYWVFDQHINDRGIKLSKSLMLGANVLDKQSKEELLKQAKHIT- 239

Query: 228 GLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSA 287
           GL  +     +L  WL  E GL + +L + T Q  L   K+ T +A ++   R++ S+++
Sbjct: 240 GL-ENPNSPTQLLAWLKDEQGLDIPNLQKKTVQDYL---KEATGKAKKMLEIRLQMSKTS 295

Query: 288 VLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLP 347
           V K N + + M SD R+RG  QF GA  TGRW+G     QNL +   S  EL+     + 
Sbjct: 296 VKKYNKMHDMMCSDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTELEIARDLIK 354

Query: 348 TSITSDPD------PLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKA 401
                D D      P  ++S  VR+   A EG +L V+D + IEARV+AW A EQW+L  
Sbjct: 355 EQRFDDLDLLLNVHPQDLLSQLVRTTFTAEEGNELAVSDFSAIEARVIAWYAKEQWRLDV 414

Query: 402 FETGEDLYVTTYARSFNVAPAQVTKDQ--RAIGKVMELALGYQGGAKAFQKMAS-TTGLN 458
           F T   +Y  + ++ FNV    +TK    R  GKV ELALGYQGGA A + M +   G+ 
Sbjct: 415 FNTHGKIYEASASQMFNVPVESITKGDPLRQKGKVSELALGYQGGAGALKAMGALEMGIE 474

Query: 459 LNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVS 518
            N    LV +                                         WR  +  + 
Sbjct: 475 ENELQGLVDS-----------------------------------------WRNANPNIV 493

Query: 519 ELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVY--RDVGNN 576
             W    +A   T+++ K       R     YMK  K  L++ LPSGR+L Y    VG N
Sbjct: 494 NFWKACQEAAINTVKSRKTHHTHGLR----FYMK--KGFLMIELPSGRALAYPKASVGEN 547

Query: 577 R------SYLN-TTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVH 629
                   ++     R+ ++  TYGGKL ENIVQA +RD+LA  +     +G+ IV  VH
Sbjct: 548 SWGSQVVEFMGLDLNRKWSKLKTYGGKLVENIVQATARDLLAISIARLEASGFKIVGHVH 607

Query: 630 DEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           DE++ E P         +  +M     WAKGL L ++G+ S  Y K
Sbjct: 608 DEVIVEIPRGSN-GLKEIETIMNKPVDWAKGLNLNSDGFTSPFYMK 652


>gi|29028629|ref|NP_803318.1| DNA polymerase A domain [Staphylococcus phage phi 12]
 gi|88195276|ref|YP_500079.1| phage encoded DNA polymerase I [Staphylococcus aureus subsp. aureus
           NCTC 8325]
 gi|258428683|ref|ZP_05688217.1| phage encoded DNA polymerase I [Staphylococcus aureus A9299]
 gi|18920553|gb|AAL82293.1| DNA polymerase A domain [Staphylococcus phage phi 12]
 gi|87202834|gb|ABD30644.1| phage encoded DNA polymerase I [Staphylococcus aureus subsp. aureus
           NCTC 8325]
 gi|257849738|gb|EEV73702.1| phage encoded DNA polymerase I [Staphylococcus aureus A9299]
          Length = 650

 Score =  311 bits (797), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 236/701 (33%), Positives = 333/701 (47%), Gaps = 85/701 (12%)

Query: 6   IDFETRSPIDLTKCGICKY--AEDVCVILFAFGFDDHPVELWDCVHDPVMP-----QVLK 58
           ID ET S  D++KCG  KY  AED  +++ A+  D   +   D       P     +  K
Sbjct: 3   IDIETYSSNDISKCGAYKYTEAEDFEILIIAYSIDGGAISAIDMTKVDNEPFHADYETFK 62

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKL 118
            AL +  V   A N+ FERT L   FN  +P   WICT+V +   GLP++L  VGE L+L
Sbjct: 63  IALFDPAVKKYAFNANFERTCLAKHFNKQMPPEEWICTMVNSMRIGLPASLDKVGEVLRL 122

Query: 119 SSQKMEEGKELIARF---CKGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTREIFKR 174
            SQK + GK LI  F   CK         RN P H  E W+ F +YC  DV V   I  +
Sbjct: 123 QSQKDKAGKNLIRYFSIPCKPTKVNGGRTRNLPEHDLEKWQQFIDYCIRDVEVEMAIANK 182

Query: 175 LE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSS 232
           ++  P+++ EQ  W  DQ INDRG  +  +L    N +    + +L ++ + +T GL  +
Sbjct: 183 IKDFPVTAIEQTYWVFDQHINDRGIKLSKSLMLGANVLDKQSKEELLKQAKHIT-GL-EN 240

Query: 233 SRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLN 292
                +L  WL  E GL + +L + T Q  L   K+ T +A ++   R++ S+++V K N
Sbjct: 241 PNSPTQLLAWLKDEQGLDIPNLQKKTVQEYL---KEATGKAKKMLEIRLQMSKTSVKKYN 297

Query: 293 TLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITS 352
            + + M SD R+RG  QF GA  TGRW+G     QNL +   S  EL+     +      
Sbjct: 298 KMHDMMCSDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTELEIARDLIKEQRFD 356

Query: 353 DPD------PLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGE 406
           D D      P  ++S  VR+   A EG +L V+D + IEARV+AW A EQW+L  F T  
Sbjct: 357 DLDLLLNVHPQDLLSQLVRTTFTAEEGNELAVSDFSAIEARVIAWYAKEQWRLDVFNTHG 416

Query: 407 DLYVTTYARSFNVAPAQVTKDQ--RAIGKVMELALGYQGGAKAFQKMAS-TTGLNLNTFA 463
            +Y  + ++ FNV    +TK    R  GKV ELALGYQGGA A + M +   G+  N   
Sbjct: 417 KIYEASASQMFNVPVESITKGDPLRQKGKVSELALGYQGGAGALKAMGALEMGIEENELQ 476

Query: 464 HLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNE 523
            LV +                                         WR  +  +   W  
Sbjct: 477 GLVDS-----------------------------------------WRNANPNIVNFWKA 495

Query: 524 LHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRD--VGNNR---- 577
             +A   T+++ K       R     YMK  K  L++ LPSGR+L Y    VG N     
Sbjct: 496 CQEAAINTVKSRKTHHTHGLR----FYMK--KGFLMIELPSGRALAYPKALVGENSWGSQ 549

Query: 578 --SYLN-TTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVC 634
              ++     R+ ++  TYGGKL ENIVQA +RD+LA  +      G+ IV  VHDE++ 
Sbjct: 550 VVEFMGLDLNRKWSKLKTYGGKLVENIVQATARDLLAISIARLEALGFKIVGHVHDEVIV 609

Query: 635 ETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           E P         +  +M     WAKGL L ++G+ S  Y K
Sbjct: 610 EIPRGSN-GLKEIETIMNKPVDWAKGLNLNSDGFTSPFYMK 649


>gi|148267473|ref|YP_001246416.1| DNA-directed DNA polymerase [Staphylococcus aureus subsp. aureus
           JH9]
 gi|150393526|ref|YP_001316201.1| DNA-directed DNA polymerase [Staphylococcus aureus subsp. aureus
           JH1]
 gi|147740542|gb|ABQ48840.1| DNA-directed DNA polymerase [Staphylococcus aureus subsp. aureus
           JH9]
 gi|149945978|gb|ABR51914.1| DNA-directed DNA polymerase [Staphylococcus aureus subsp. aureus
           JH1]
          Length = 653

 Score =  310 bits (795), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 235/706 (33%), Positives = 335/706 (47%), Gaps = 85/706 (12%)

Query: 1   MATLFIDFETRSPIDLTKCGICKY--AEDVCVILFAFGFDDHPVELWDCVHDPVMP---- 54
           M  + ID ET S  D++KCG  KY  AED  +++ A+  D   +   D       P    
Sbjct: 1   MKFMNIDIETYSSNDISKCGAYKYTEAEDFEILIIAYSIDGGAISAIDMTKVDNEPFHAD 60

Query: 55  -QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVG 113
            +  K AL +  V   A N+ FERT L   FN  +P   WICT+V +   GLP++L  VG
Sbjct: 61  YETFKIALFDPAVKKYAFNANFERTCLAKHFNKQMPPEEWICTMVNSMRIGLPASLDKVG 120

Query: 114 EALKLSSQKMEEGKELIARF---CKGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTR 169
           E L+L +QK + GK LI  F   CK         RN P H  E W+ F +YC  DV V  
Sbjct: 121 EVLRLQNQKDKAGKNLIRYFSIPCKPTKVNGGRTRNLPEHDLEKWQQFIDYCIRDVEVEM 180

Query: 170 EIFKRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTY 227
            I  +++  P+++ EQ  W  DQ INDRG  +  +L    N +    + +L  + + +T 
Sbjct: 181 TIAHKIKDFPVTAIEQAYWVFDQHINDRGIKLSKSLMLGANVLDKQSKEELLNQAKHIT- 239

Query: 228 GLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSA 287
           GL  +     +L  WL  + GL + +L + T Q  L   K+ T +A ++   R++ S+++
Sbjct: 240 GL-ENPNSPTQLLAWLKDDQGLDIPNLQKKTVQEYL---KEATGKAKKMLEIRLQMSKTS 295

Query: 288 VLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLP 347
           V K N + + M SD R+RG  QF GA  TGRW+G     QNL +   S  EL+     + 
Sbjct: 296 VKKYNKMHDMMCSDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTELEIARDLIK 354

Query: 348 TSITSDPD------PLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKA 401
                D D      P  ++S  VR+   A EG +L V+D + IEARV+AW A EQW+L  
Sbjct: 355 EQRFDDLDLLLNVHPQDLLSQLVRTTFTAEEGNELAVSDFSAIEARVIAWYAKEQWRLDV 414

Query: 402 FETGEDLYVTTYARSFNVAPAQVTKDQ--RAIGKVMELALGYQGGAKAFQKMAS-TTGLN 458
           F T   +Y  + ++ FNV    +TK    R  GKV ELALGYQGGA A + M +   G+ 
Sbjct: 415 FNTHGKIYEASASQMFNVPVESITKGDPLRQKGKVSELALGYQGGAGALKAMGALEMGIE 474

Query: 459 LNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVS 518
            N    LV +                                         WR  +  + 
Sbjct: 475 ENELQGLVDS-----------------------------------------WRNANPNIV 493

Query: 519 ELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVY--RDVGNN 576
             W    +A   T+++ K       R     YMK  K  L++ LPSGR+L Y    VG N
Sbjct: 494 NFWKACQEAAINTVKSRKTHHTHGLR----FYMK--KGFLMIELPSGRALAYPKASVGEN 547

Query: 577 R------SYLN-TTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVH 629
                   ++     R+ ++  TYGGKL ENIVQA +RD+LA  +     +G+ IV  VH
Sbjct: 548 SWGSQVVEFMGLDLNRKWSKLKTYGGKLVENIVQATARDLLAISIARLEASGFKIVGHVH 607

Query: 630 DEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           DE++ E P         +  +M     WAKGL L ++G+ S  Y K
Sbjct: 608 DEVIVEIPRGSN-GLKEIETIMNKPVDWAKGLNLNSDGFTSPFYMK 652


>gi|288799805|ref|ZP_06405264.1| hypothetical protein HMPREF0669_00204 [Prevotella sp. oral taxon
           299 str. F0039]
 gi|288333053|gb|EFC71532.1| hypothetical protein HMPREF0669_00204 [Prevotella sp. oral taxon
           299 str. F0039]
          Length = 726

 Score =  310 bits (795), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 224/703 (31%), Positives = 348/703 (49%), Gaps = 85/703 (12%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           +  L ID ET S  ++T  G+  Y +  +  ++LFA+  D   V+L D      +P  + 
Sbjct: 80  IKILSIDIETYSDNEITN-GVHNYVDTPNFEILLFAYSCDGGSVQLVDLAQGEEIPAKIL 138

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKL 118
           +AL ++++   A N+ FER  +     L +   +W CT + A   GLP++L++ GE LKL
Sbjct: 139 DALTDSNIIKTAFNASFERVCIGKHLGLTLDPSQWHCTQIRALMLGLPASLQSCGEVLKL 198

Query: 119 SSQKMEEGKELIARF---CKGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTREIFKR 174
             +K+ EG ELI  F   CK         RN P H  + W  F  YC  DV V + I ++
Sbjct: 199 KHKKLREGAELIKYFSIPCKPTKSNGGRTRNLPEHAPDKWAQFKRYCIRDVEVEKAIQRK 258

Query: 175 -----LEPLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGL 229
                L P++  E+ L+  DQT+ND+G C+D  LA+   ++ D  + +L  E++ +T   
Sbjct: 259 VCNNTLNPVTPFERALYIFDQTMNDKGVCIDSELANNAIRMNDEAQDELFAEMQEITN-- 316

Query: 230 VSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVL 289
           + +     +LK WL  + G  ++ L +   + + +   +   + + +   R  +S+++V 
Sbjct: 317 LENPNSPVQLKQWLSSKLGRPIQSLAKEDAKELATGASEDVKRVLYL---RSMSSKTSVK 373

Query: 290 KLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTS 349
           K   +  A  SD +L   LQF GA +TGRW+G +    NLPR S     L + +      
Sbjct: 374 KYEAMTLAKCSDNKLHDLLQFYGA-KTGRWAGRIVQVHNLPRNSSKDLALARELVK---- 428

Query: 350 ITSDPDPLQ--------IISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKA 401
             +D + L+        I+S  +R+  IA E   L V D + IEARV+AW+AGE+W+LK 
Sbjct: 429 -KNDFELLELTFGNVCDILSQLIRTAFIAKENYTLCVCDFSAIEARVIAWLAGEEWRLKV 487

Query: 402 FETGEDLYVTTYARSFNVAPAQVTKDQ--RAIGKVMELALGYQGGAKAFQKMASTTGLNL 459
           F     +Y  + AR F V    +T D   R  GK+ ELALGY+GGA A + M +      
Sbjct: 488 FRGSGRIYEASAARMFGVDEKTITHDSPLRQKGKIAELALGYEGGANALKIMGADK---- 543

Query: 460 NTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSE 519
                                    M  + PE A           ++   WR     + +
Sbjct: 544 -------------------------MGLSDPEIA-----------QIVSGWRNSSPNIVK 567

Query: 520 LWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVY---RDVGNN 576
           LW ++ +A ++ I + + I   K +   L++ +K  N L + LPSGR L Y   + V N 
Sbjct: 568 LWRDVERAAKEAILSDRII---KLKQGGLIF-RKTSNILQIKLPSGRLLSYPLAKIVDNK 623

Query: 577 RSYL--NTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVC 634
             Y+  N TTRQ     TYGGKL ENIVQA++RD L E ++   K GY+I   VHDEI+ 
Sbjct: 624 ICYMSQNQTTRQWVDTETYGGKLVENIVQAIARDCLGETILRVDKKGYNICFHVHDEIIA 683

Query: 635 ETPDTDEFNASM--LYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           E P TDE   ++  + ++  +  ++A  LPLK EGY +  Y K
Sbjct: 684 EVP-TDESAKALQDIKNIFATPITFAPDLPLKGEGYITPYYLK 725


>gi|209363571|ref|YP_002267989.1| DNA polymerase [Staphylococcus phage phi2958PVL]
 gi|208973072|dbj|BAG74388.1| DNA polymerase [Staphylococcus phage phi2958PVL]
          Length = 650

 Score =  310 bits (794), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 234/701 (33%), Positives = 333/701 (47%), Gaps = 85/701 (12%)

Query: 6   IDFETRSPIDLTKCGICKY--AEDVCVILFAFGFDDHPVELWDCVHDPVMP-----QVLK 58
           ID ET S  D++KCG  KY  AED  +++ A+  D   +   D       P     +  K
Sbjct: 3   IDIETYSSNDISKCGAYKYTEAEDFEILIIAYSIDGGAISAIDMTKVDNEPFHADFETFK 62

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKL 118
            AL +  V   A N+ FERT L   FN  +P   WICT+V +   GLP++L  VGE L+L
Sbjct: 63  IALFDPAVKKYAFNANFERTCLAKHFNKQMPPEEWICTMVNSMRIGLPASLDKVGEVLRL 122

Query: 119 SSQKMEEGKELIARF---CKGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTREIFKR 174
            +QK + GK LI  F   CK         RN P H  E W+ F +YC  DV V   I  +
Sbjct: 123 QNQKDKAGKNLIRYFSIPCKPTKVNGGRTRNLPEHDLEKWQQFIDYCIRDVEVEMTIAHK 182

Query: 175 LE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSS 232
           ++  P+++ EQ  W  DQ INDRG  +  +L    N +    + +L  + + +T GL  +
Sbjct: 183 IKDFPVTAIEQAYWVFDQHINDRGIKLSKSLMLGANVLDKQSKEELLNQAKHIT-GL-EN 240

Query: 233 SRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLN 292
                +L  WL  + GL + +L + T Q  L   K+ T +A ++   R++ S+++V K N
Sbjct: 241 PNSPTQLLAWLKDDQGLDIPNLQKKTVQEYL---KEATGKAKKMLEIRLQMSKTSVKKYN 297

Query: 293 TLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITS 352
            + + M SD R+RG  QF GA  TGRW+G     QNL +   S  EL+     +      
Sbjct: 298 KMHDMMCSDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTELEIARDLIKEQRFD 356

Query: 353 DPD------PLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGE 406
           D D      P  ++S  VR+   A EG +L V+D + IEARV+AW A EQW+L  F T  
Sbjct: 357 DLDLLLNVHPQDLLSQLVRTTFTAEEGNELAVSDFSAIEARVIAWYAKEQWRLDVFNTHG 416

Query: 407 DLYVTTYARSFNVAPAQVTKDQ--RAIGKVMELALGYQGGAKAFQKMAS-TTGLNLNTFA 463
            +Y  + ++ FNV    +TK    R  GKV ELALGYQGGA A + M +   G+  N   
Sbjct: 417 KIYEASASQMFNVPVESITKGDPLRQKGKVSELALGYQGGAGALKAMGALEMGIEENELQ 476

Query: 464 HLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNE 523
            LV +                                         WR  +  +   W  
Sbjct: 477 GLVDS-----------------------------------------WRNANPNIVNFWKA 495

Query: 524 LHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVY--RDVGNNR---- 577
             +A   T+++ K       R     YMK  K  L++ LPSGR+L Y    VG N     
Sbjct: 496 CQEAAINTVKSRKTHHTHGLR----FYMK--KGFLMIELPSGRALAYPKASVGENSWGSQ 549

Query: 578 --SYLN-TTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVC 634
              ++     R+ ++  TYGGKL ENIVQA +RD+LA  +     +G+ IV  VHDE++ 
Sbjct: 550 VVEFMGLDLNRKWSKLKTYGGKLVENIVQATARDLLAISIARLEASGFKIVGHVHDEVIV 609

Query: 635 ETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           E P         +  +M     WAKGL L ++G+ S  Y K
Sbjct: 610 EIPRGSN-GLKEIETIMNKPADWAKGLNLNSDGFTSPFYMK 649


>gi|21283154|ref|NP_646242.1| DNA polymerase [Staphylococcus aureus subsp. aureus MW2]
 gi|300911890|ref|ZP_07129333.1| bacterophage DNA-directed DNA polymerase [Staphylococcus aureus
           subsp. aureus TCH70]
 gi|21204594|dbj|BAB95290.1| DNA polymerase [Staphylococcus aureus subsp. aureus MW2]
 gi|300886136|gb|EFK81338.1| bacterophage DNA-directed DNA polymerase [Staphylococcus aureus
           subsp. aureus TCH70]
 gi|315197712|gb|EFU28046.1| DNA polymerase [Staphylococcus aureus subsp. aureus CGS01]
          Length = 653

 Score =  310 bits (794), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 235/706 (33%), Positives = 335/706 (47%), Gaps = 85/706 (12%)

Query: 1   MATLFIDFETRSPIDLTKCGICKY--AEDVCVILFAFGFDDHPVELWDCVHDPVMP---- 54
           M  + ID ET S  D++KCG  KY  AED  +++ A+  D   +   D       P    
Sbjct: 1   MRFMNIDIETYSSNDISKCGAYKYTEAEDFEILIIAYSIDGGAISAIDMTKVDNEPFHAD 60

Query: 55  -QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVG 113
            +  K AL +  V   A N+ FERT L   FN  +P   WICT+V +   GLP++L  VG
Sbjct: 61  FETFKIALFDPAVKKYAFNANFERTCLAKHFNKQMPPEEWICTMVNSMRIGLPASLDKVG 120

Query: 114 EALKLSSQKMEEGKELIARF---CKGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTR 169
           E L+L +QK + GK LI  F   CK         RN P H  E W+ F +YC  DV V  
Sbjct: 121 EVLRLQNQKDKAGKNLIRYFSIPCKPTKVNGGRTRNLPEHDLEKWQQFIDYCIRDVEVEM 180

Query: 170 EIFKRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTY 227
            I  +++  P+++ EQ  W  DQ INDRG  +  +L    N +    + +L  + + +T 
Sbjct: 181 TIAHKIKDFPVTAIEQAYWVFDQHINDRGIKLSKSLMLGANVLDKQSKEELLNQAKHIT- 239

Query: 228 GLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSA 287
           GL  +     +L  WL  + GL + +L + T Q  L   K+ T +A ++   R++ S+++
Sbjct: 240 GL-ENPNSPTQLLAWLKDDQGLDIPNLQKKTVQEYL---KEATGKAKKMLEIRLQMSKTS 295

Query: 288 VLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLP 347
           V K N + + M SD R+RG  QF GA  TGRW+G     QNL +   S  EL+     + 
Sbjct: 296 VKKYNKMHDMMCSDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTELEIARDLIK 354

Query: 348 TSITSDPD------PLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKA 401
                D D      P  ++S  VR+   A EG +L V+D + IEARV+AW A EQW+L  
Sbjct: 355 EQRFDDLDLLLNVHPQDLLSQLVRTTFTAEEGNELAVSDFSAIEARVIAWYAKEQWRLDV 414

Query: 402 FETGEDLYVTTYARSFNVAPAQVTKDQ--RAIGKVMELALGYQGGAKAFQKMAS-TTGLN 458
           F T   +Y  + ++ FNV    +TK    R  GKV ELALGYQGGA A + M +   G+ 
Sbjct: 415 FNTHGKIYEASASQMFNVPVESITKGDPLRQKGKVSELALGYQGGAGALKAMGALEMGIE 474

Query: 459 LNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVS 518
            N    LV +                                         WR  +  + 
Sbjct: 475 ENELQGLVDS-----------------------------------------WRNANPNIV 493

Query: 519 ELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVY--RDVGNN 576
             W    +A   T+++ K       R     YMK  K  L++ LPSGR+L Y    VG N
Sbjct: 494 NFWKACQEAAINTVKSRKTHHTHGVR----FYMK--KGFLMIELPSGRALAYPKASVGEN 547

Query: 577 R------SYLN-TTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVH 629
                   ++     R+ ++  TYGGKL ENIVQA +RD+LA  +     +G+ IV  VH
Sbjct: 548 SWGSQVVEFMGLDLNRKWSKLKTYGGKLVENIVQATARDLLAISIARLEASGFKIVGHVH 607

Query: 630 DEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           DE++ E P         +  +M     WAKGL L ++G+ S  Y K
Sbjct: 608 DEVIVEIPRGSN-GLKEIETIMNKPVDWAKGLNLNSDGFTSPFYMK 652


>gi|257428253|ref|ZP_05604651.1| DNA polymerase [Staphylococcus aureus subsp. aureus 65-1322]
 gi|258419942|ref|ZP_05682901.1| DNA polymerase [Staphylococcus aureus A9719]
 gi|282905878|ref|ZP_06313733.1| DNA polymerase [Staphylococcus aureus subsp. aureus Btn1260]
 gi|282928293|ref|ZP_06335897.1| DNA polymerase bacteriophage-type [Staphylococcus aureus A9765]
 gi|257275094|gb|EEV06581.1| DNA polymerase [Staphylococcus aureus subsp. aureus 65-1322]
 gi|257844067|gb|EEV68457.1| DNA polymerase [Staphylococcus aureus A9719]
 gi|282331170|gb|EFB60684.1| DNA polymerase [Staphylococcus aureus subsp. aureus Btn1260]
 gi|282591964|gb|EFB96997.1| DNA polymerase bacteriophage-type [Staphylococcus aureus A9765]
          Length = 653

 Score =  310 bits (794), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 235/706 (33%), Positives = 335/706 (47%), Gaps = 85/706 (12%)

Query: 1   MATLFIDFETRSPIDLTKCGICKY--AEDVCVILFAFGFDDHPVELWDCVHDPVMP---- 54
           M  + ID ET S  D++KCG  KY  AED  +++ A+  D   +   D       P    
Sbjct: 1   MRFMNIDIETYSSNDISKCGAYKYTEAEDFEILIIAYSIDGGAISAIDMTKVDNEPFHAD 60

Query: 55  -QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVG 113
            +  K AL +  V   A N+ FERT L   FN  +P   WICT+V +   GLP++L  VG
Sbjct: 61  FETFKIALFDPAVKKYAFNANFERTCLAKHFNKQMPPEEWICTMVNSMRIGLPASLDKVG 120

Query: 114 EALKLSSQKMEEGKELIARF---CKGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTR 169
           E L+L +QK + GK LI  F   CK         RN P H  E W+ F +YC  DV V  
Sbjct: 121 EVLRLQNQKDKAGKNLIRYFSIPCKPTKVNGGRTRNLPEHDLEKWQQFIDYCIRDVEVEM 180

Query: 170 EIFKRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTY 227
            I  +++  P+++ EQ  W  DQ INDRG  +  +L    N +    + +L  + + +T 
Sbjct: 181 TIAHKIKDFPVTAIEQAYWVFDQHINDRGIKLSKSLMLGANVLDKQSKEELLNQAKHIT- 239

Query: 228 GLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSA 287
           GL  +     +L  WL  + GL + +L + T Q  L   K+ T +A ++   R++ S+++
Sbjct: 240 GL-ENPNSPTQLLAWLKDDQGLDIPNLQKKTVQEYL---KEATGKAKKMLEIRLQMSKTS 295

Query: 288 VLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLP 347
           V K N + + M SD R+RG  QF GA  TGRW+G     QNL +   S  EL+     + 
Sbjct: 296 VKKYNKMHDMMCSDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTELEIARDLIK 354

Query: 348 TSITSDPD------PLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKA 401
                D D      P  ++S  VR+   A EG +L V+D + IEARV+AW A EQW+L  
Sbjct: 355 EQRFDDLDLLLNVHPQDLLSQLVRTTFTAEEGNELAVSDFSAIEARVIAWYAKEQWRLDV 414

Query: 402 FETGEDLYVTTYARSFNVAPAQVTKDQ--RAIGKVMELALGYQGGAKAFQKMAS-TTGLN 458
           F T   +Y  + ++ FNV    +TK    R  GKV ELALGYQGGA A + M +   G+ 
Sbjct: 415 FNTHGKIYEASASQMFNVPVESITKGDPLRQKGKVSELALGYQGGAGALKAMGALEMGIE 474

Query: 459 LNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVS 518
            N    LV +                                         WR  +  + 
Sbjct: 475 ENELQGLVDS-----------------------------------------WRNANPNIV 493

Query: 519 ELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVY--RDVGNN 576
             W    +A   T+++ K       R     YMK  K  L++ LPSGR+L Y    VG N
Sbjct: 494 NFWKACQEAAINTVKSRKTHHTHGLR----FYMK--KGFLMIELPSGRALAYPKASVGEN 547

Query: 577 R------SYLN-TTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVH 629
                   ++     R+ ++  TYGGKL ENIVQA +RD+LA  +     +G+ IV  VH
Sbjct: 548 SWGSQVVEFMGLDLNRKWSKLKTYGGKLVENIVQATARDLLAISIARLEASGFKIVGHVH 607

Query: 630 DEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           DE++ E P         +  +M     WAKGL L ++G+ S  Y K
Sbjct: 608 DEVIVEIPRGSN-GLKEIETIMNKPVDWAKGLNLNSDGFTSPFYMK 652


>gi|257432437|ref|ZP_05608800.1| DNA polymerase [Staphylococcus aureus subsp. aureus E1410]
 gi|257283316|gb|EEV13448.1| DNA polymerase [Staphylococcus aureus subsp. aureus E1410]
          Length = 653

 Score =  310 bits (793), Expect = 6e-82,   Method: Compositional matrix adjust.
 Identities = 235/706 (33%), Positives = 335/706 (47%), Gaps = 85/706 (12%)

Query: 1   MATLFIDFETRSPIDLTKCGICKY--AEDVCVILFAFGFDDHPVELWDCVHDPVMP---- 54
           M  + ID ET S  D++KCG  KY  AED  +++ A+  D   +   D       P    
Sbjct: 1   MRFMNIDIETYSSNDISKCGAYKYTEAEDFEILIIAYSIDGGAISAIDMTKVDNEPFHAD 60

Query: 55  -QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVG 113
            +  K AL +  V   A N+ FERT L   FN  +P   WICT+V +   GLP++L  VG
Sbjct: 61  FETFKIALFDPAVKKYAFNANFERTCLAKHFNKQMPPEEWICTMVNSMRIGLPASLDKVG 120

Query: 114 EALKLSSQKMEEGKELIARF---CKGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTR 169
           E L+L +QK + GK LI  F   CK         RN P H  E W+ F +YC  DV V  
Sbjct: 121 EVLRLQNQKDKAGKNLIRYFSIPCKPTKVNGGRTRNLPEHDLEKWQQFIDYCIRDVEVEM 180

Query: 170 EIFKRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTY 227
            I  +++  P+++ EQ  W  DQ INDRG  +  +L    N +    + +L  + + +T 
Sbjct: 181 TIAHKIKDFPVTAIEQAYWVFDQHINDRGIKLSKSLMLGANVLDKQSKEELLNQAKHIT- 239

Query: 228 GLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSA 287
           GL  +     +L  WL  + GL + +L + T Q  L   K+ T +A ++   R++ S+++
Sbjct: 240 GL-ENPNSPTQLLAWLKNDQGLDIPNLQKKTVQEYL---KEATGKAKKMLEIRLQMSKTS 295

Query: 288 VLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLP 347
           V K N + + M SD R+RG  QF GA  TGRW+G     QNL +   S  EL+     + 
Sbjct: 296 VKKYNKMHDMMCSDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTELEIARDLIK 354

Query: 348 TSITSDPD------PLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKA 401
                D D      P  ++S  VR+   A EG +L V+D + IEARV+AW A EQW+L  
Sbjct: 355 EQRFDDLDLLLNVHPQDLLSQLVRTTFTAEEGNELAVSDFSAIEARVIAWYAKEQWRLDV 414

Query: 402 FETGEDLYVTTYARSFNVAPAQVTKDQ--RAIGKVMELALGYQGGAKAFQKMAS-TTGLN 458
           F T   +Y  + ++ FNV    +TK    R  GKV ELALGYQGGA A + M +   G+ 
Sbjct: 415 FNTHGKIYEASASQMFNVPVESITKGDPLRQKGKVSELALGYQGGAGALKAMGALEMGIE 474

Query: 459 LNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVS 518
            N    LV +                                         WR  +  + 
Sbjct: 475 ENELQGLVDS-----------------------------------------WRNANPNIV 493

Query: 519 ELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRD--VGNN 576
             W    +A   T+++ K       R     YMK  K  L++ LPSGR+L Y    VG N
Sbjct: 494 NFWKACQEAAINTVKSRKTHHTHGLR----FYMK--KGFLMIELPSGRALAYPKALVGEN 547

Query: 577 R------SYLN-TTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVH 629
                   ++     R+ ++  TYGGKL ENIVQA +RD+LA  +     +G+ IV  VH
Sbjct: 548 SWGSQVVEFMGLDLNRKWSKLKTYGGKLVENIVQATARDLLAISIARLEASGFKIVGHVH 607

Query: 630 DEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           DE++ E P         +  +M     WAKGL L ++G+ S  Y K
Sbjct: 608 DEVIVEIPRGSN-GLKEIETIMNKPVDWAKGLNLNSDGFTSPFYMK 652


>gi|323440323|gb|EGA98037.1| phage related DNA polymerase family A [Staphylococcus aureus O11]
          Length = 650

 Score =  310 bits (793), Expect = 6e-82,   Method: Compositional matrix adjust.
 Identities = 236/701 (33%), Positives = 335/701 (47%), Gaps = 85/701 (12%)

Query: 6   IDFETRSPIDLTKCGICKY--AEDVCVILFAFGFDDHPVELWDCV---HDPVMP--QVLK 58
           ID ET S  D++KCG  KY  AED  +++ A+  D   +   D     ++PV    +  K
Sbjct: 3   IDIETYSSNDISKCGAYKYTEAEDFEILIIAYSIDGGAISAIDMTKVDNEPVHADYETFK 62

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKL 118
            AL +  V   A N+ FERT L   FN  +P   WICT+V +   GLP++L  VGE L+L
Sbjct: 63  IALFDPAVKKYAFNANFERTCLAKHFNKQMPPEEWICTMVNSMRIGLPASLDKVGEVLRL 122

Query: 119 SSQKMEEGKELIARF---CKGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTREIFKR 174
            SQK + GK LI  F   CK         RN P H  E W+ F +YC  DV V   I  +
Sbjct: 123 QSQKDKAGKNLIRYFSMPCKPTKVNGGRTRNLPEHDPEKWQQFIDYCIRDVEVEMTIANK 182

Query: 175 LE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSS 232
           ++  P++  EQ  W  DQ INDRG  +  +L    N +    + +L ++ + +T GL  +
Sbjct: 183 IKDFPVTEIEQAYWVFDQHINDRGIKLSKSLMLGANVLDKQSKEELLKQAKHIT-GL-EN 240

Query: 233 SRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLN 292
                +L  WL  E GL + +L + T Q  L   K+ T +A ++   R++ S+++V K N
Sbjct: 241 PNSPTQLLAWLKDEQGLDIPNLQKKTVQDYL---KEATGKAKKMLEIRLQMSKTSVKKYN 297

Query: 293 TLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITS 352
            + + M SD R+RG  QF GA  TGRW+G     QNL +   S  EL+     +      
Sbjct: 298 KMHDMMCSDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTELEIARDLIKEQRFD 356

Query: 353 DPD------PLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGE 406
           D D      P  ++S  VR+   A EG +L V+D + IEARV+AW A EQW+L  F T  
Sbjct: 357 DLDLLLNVHPQDLLSQLVRTTFTAEEGNELAVSDFSAIEARVIAWYAKEQWRLDVFNTHG 416

Query: 407 DLYVTTYARSFNVAPAQVTKDQ--RAIGKVMELALGYQGGAKAFQKMAS-TTGLNLNTFA 463
            +Y  + ++ FNV    +TK    R  GKV ELALGYQGGA A + M +   G+  N   
Sbjct: 417 KIYEASASQMFNVPVESITKGDPLRQKGKVSELALGYQGGAGALKAMGALEMGIEENELQ 476

Query: 464 HLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNE 523
            LV +                                         WR  +  +   W  
Sbjct: 477 GLVDS-----------------------------------------WRNANPNIVNFWKA 495

Query: 524 LHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVY--RDVGNNR---- 577
             +A   T+++ K       R     YMK  K  L++ LPSGR+L Y    VG N     
Sbjct: 496 CQEAAINTVKSRKTHHTHGLR----FYMK--KGFLMIELPSGRALAYPKASVGENSWGSQ 549

Query: 578 --SYLN-TTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVC 634
              ++     R+ ++  TYGGKL ENIVQA +RD+LA  +     + + IV  VHDE++ 
Sbjct: 550 VVEFMGLDLNRKWSKLKTYGGKLVENIVQATARDLLAISIARLEASVFKIVGHVHDEVIV 609

Query: 635 ETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           E P         +  +M     WAKGL L ++G+ S  Y K
Sbjct: 610 EIPRGSN-GLKEIETIMNKPVDWAKGLNLNSDGFTSPFYMK 649


>gi|258448861|ref|ZP_05696971.1| DNA polymerase [Staphylococcus aureus A6224]
 gi|257857898|gb|EEV80789.1| DNA polymerase [Staphylococcus aureus A6224]
          Length = 653

 Score =  310 bits (793), Expect = 6e-82,   Method: Compositional matrix adjust.
 Identities = 234/706 (33%), Positives = 335/706 (47%), Gaps = 85/706 (12%)

Query: 1   MATLFIDFETRSPIDLTKCGICKY--AEDVCVILFAFGFDDHPVELWDCVHDPVMP---- 54
           M  + ID ET S  D++KCG  KY  AED  +++ A+  D   +   D       P    
Sbjct: 1   MRFMNIDIETYSSNDISKCGAYKYTEAEDFEILIIAYSIDGGAISAIDMTKVDNEPFHAD 60

Query: 55  -QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVG 113
            +  K AL +  V   A N+ FERT L   FN  +P   WICT++ +   GLP++L  VG
Sbjct: 61  FETFKIALFDPAVKKYAFNANFERTCLAKHFNKQMPPEEWICTMINSMRIGLPASLDKVG 120

Query: 114 EALKLSSQKMEEGKELIARF---CKGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTR 169
           E L+L +QK + GK LI  F   CK         RN P H  E W+ F +YC  DV V  
Sbjct: 121 EVLRLQNQKDKAGKNLIRYFSIPCKPTKVNGGRTRNLPEHDLEKWQQFIDYCIRDVEVEM 180

Query: 170 EIFKRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTY 227
            I  +++  P+++ EQ  W  DQ INDRG  +  +L    N +    + +L  + + +T 
Sbjct: 181 TIAHKIKDFPVTAIEQAYWVFDQHINDRGIKLSKSLMLGANVLDKQSKEELLNQAKHIT- 239

Query: 228 GLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSA 287
           GL  +     +L  WL  + GL + +L + T Q  L   K+ T +A ++   R++ S+++
Sbjct: 240 GL-ENPNSPTQLLAWLKDDQGLDIPNLQKKTVQEYL---KEATGKAKKMLEIRLQMSKTS 295

Query: 288 VLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLP 347
           V K N + + M SD R+RG  QF GA  TGRW+G     QNL +   S  EL+     + 
Sbjct: 296 VKKYNKMHDMMCSDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTELEIARDLIK 354

Query: 348 TSITSDPD------PLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKA 401
                D D      P  ++S  VR+   A EG +L V+D + IEARV+AW A EQW+L  
Sbjct: 355 EQRFDDLDLLLNVHPQDLLSQLVRTTFTAEEGNELAVSDFSAIEARVIAWYAKEQWRLDV 414

Query: 402 FETGEDLYVTTYARSFNVAPAQVTKDQ--RAIGKVMELALGYQGGAKAFQKMAS-TTGLN 458
           F T   +Y  + ++ FNV    +TK    R  GKV ELALGYQGGA A + M +   G+ 
Sbjct: 415 FNTHGKIYEASASQMFNVPVESITKGDPLRQKGKVSELALGYQGGAGALKAMGALEMGIE 474

Query: 459 LNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVS 518
            N    LV +                                         WR  +  + 
Sbjct: 475 ENELQGLVDS-----------------------------------------WRNANPNIV 493

Query: 519 ELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVY--RDVGNN 576
             W    +A   T+++ K       R     YMK  K  L++ LPSGR+L Y    VG N
Sbjct: 494 NFWKACQEAAINTVKSRKTHHTHGLR----FYMK--KGFLMIELPSGRALAYPKASVGEN 547

Query: 577 R------SYLN-TTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVH 629
                   ++     R+ ++  TYGGKL ENIVQA +RD+LA  +     +G+ IV  VH
Sbjct: 548 SWGSQVVEFMGLDLNRKWSKLKTYGGKLVENIVQATARDLLAISIARLEASGFKIVGHVH 607

Query: 630 DEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           DE++ E P         +  +M     WAKGL L ++G+ S  Y K
Sbjct: 608 DEVIVEIPRGSN-GLKEIETIMNKPVDWAKGLNLNSDGFTSPFYMK 652


>gi|295407651|ref|ZP_06817440.1| DNA polymerase bacteriophage-type [Staphylococcus aureus A8819]
 gi|297246752|ref|ZP_06930567.1| DNA polymerase bacteriophage-type [Staphylococcus aureus A8796]
 gi|294967465|gb|EFG43505.1| DNA polymerase bacteriophage-type [Staphylococcus aureus A8819]
 gi|297176378|gb|EFH35651.1| DNA polymerase bacteriophage-type [Staphylococcus aureus A8796]
          Length = 650

 Score =  309 bits (792), Expect = 9e-82,   Method: Compositional matrix adjust.
 Identities = 234/701 (33%), Positives = 333/701 (47%), Gaps = 85/701 (12%)

Query: 6   IDFETRSPIDLTKCGICKY--AEDVCVILFAFGFDDHPVELWDCVHDPVMP-----QVLK 58
           ID ET S  D++KCG  KY  AED  +++ A+  D   +   D       P     +  K
Sbjct: 3   IDIETYSSNDISKCGAYKYTEAEDFEILIIAYSIDGGAISAIDMTKVDNEPFHADFETFK 62

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKL 118
            AL +  V   A N+ FERT L   FN  +P   WICT+V +   GLP++L  VGE L+L
Sbjct: 63  IALFDPAVKKYAFNANFERTCLAKHFNKQMPPEEWICTMVNSMRIGLPASLDKVGEVLRL 122

Query: 119 SSQKMEEGKELIARF---CKGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTREIFKR 174
            +QK + GK LI  F   CK         RN P H  E W+ F +YC  DV V   I  +
Sbjct: 123 QNQKDKAGKNLIRYFSIPCKPTKVNGGRTRNLPEHDLEKWQQFIDYCIRDVEVEMTIAHK 182

Query: 175 LE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSS 232
           ++  P+++ EQ  W  DQ INDRG  +  +L    N +    + +L  + + +T GL  +
Sbjct: 183 IKDFPVTAIEQAYWVFDQHINDRGIKLSKSLMLGANVLDKQSKEELLNQAKHIT-GL-EN 240

Query: 233 SRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLN 292
                +L  WL  + GL + +L + T Q  L   K+ T +A ++   R++ S+++V K N
Sbjct: 241 PNSPTQLLAWLKDDQGLDIPNLQKKTVQEYL---KEATGKAKKMLEIRLQMSKTSVKKYN 297

Query: 293 TLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITS 352
            + + M SD R+RG  QF GA  TGRW+G     QNL +   S  EL+     +      
Sbjct: 298 KMHDMMCSDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTELEIARDLIKEQRFD 356

Query: 353 DPD------PLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGE 406
           D D      P  ++S  VR+   A EG +L V+D + IEARV+AW A EQW+L  F T  
Sbjct: 357 DLDLLLNVHPQDLLSQLVRTTFTAEEGNELAVSDFSAIEARVIAWYAKEQWRLDVFNTHG 416

Query: 407 DLYVTTYARSFNVAPAQVTKDQ--RAIGKVMELALGYQGGAKAFQKMAS-TTGLNLNTFA 463
            +Y  + ++ FNV    +TK    R  GKV ELALGYQGGA A + M +   G+  N   
Sbjct: 417 KIYEASASQMFNVPVESITKGDPLRQKGKVSELALGYQGGAGALKAMGALEMGIEENELQ 476

Query: 464 HLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNE 523
            LV +                                         WR  +  +   W  
Sbjct: 477 GLVDS-----------------------------------------WRNANPNIVNFWKA 495

Query: 524 LHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVY--RDVGNNR---- 577
             +A   T+++ K       R     YMK  K  L++ LPSGR+L Y    VG N     
Sbjct: 496 CQEAAINTVKSRKTHHTHGLR----FYMK--KGFLMIELPSGRALAYPKASVGENSWGSQ 549

Query: 578 --SYLN-TTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVC 634
              ++     R+ ++  TYGGKL ENIVQA +RD+LA  +     +G+ IV  VHDE++ 
Sbjct: 550 VVEFMGLDLNRKWSKLKTYGGKLVENIVQATARDLLAISIARLEASGFKIVGHVHDEVIV 609

Query: 635 ETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           E P         +  +M     WAKGL L ++G+ S  Y K
Sbjct: 610 EIPRGSN-GLKEIETIMNKPVDWAKGLNLNSDGFTSPFYMK 649


>gi|87161801|ref|YP_494120.1| phage related DNA polymerase family A [Staphylococcus aureus subsp.
           aureus USA300_FPR3757]
 gi|161509702|ref|YP_001575361.1| bacterophage DNA-directed DNA polymerase [Staphylococcus aureus
           subsp. aureus USA300_TCH1516]
 gi|294848501|ref|ZP_06789247.1| DNA polymerase bacteriophage-type [Staphylococcus aureus A9754]
 gi|87127775|gb|ABD22289.1| phage related DNA polymerase, family A [Staphylococcus aureus
           subsp. aureus USA300_FPR3757]
 gi|160368511|gb|ABX29482.1| bacterophage DNA-directed DNA polymerase [Staphylococcus aureus
           subsp. aureus USA300_TCH1516]
 gi|294824527|gb|EFG40950.1| DNA polymerase bacteriophage-type [Staphylococcus aureus A9754]
 gi|302333141|gb|ADL23334.1| bacterophage DNA-directed DNA polymerase [Staphylococcus aureus
           subsp. aureus JKD6159]
 gi|320140648|gb|EFW32502.1| DNA-directed DNA polymerase [Staphylococcus aureus subsp. aureus
           MRSA131]
 gi|320142780|gb|EFW34583.1| DNA-directed DNA polymerase [Staphylococcus aureus subsp. aureus
           MRSA177]
          Length = 650

 Score =  309 bits (791), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 234/701 (33%), Positives = 333/701 (47%), Gaps = 85/701 (12%)

Query: 6   IDFETRSPIDLTKCGICKY--AEDVCVILFAFGFDDHPVELWDCVHDPVMP-----QVLK 58
           ID ET S  D++KCG  KY  AED  +++ A+  D   +   D       P     +  K
Sbjct: 3   IDIETYSSNDISKCGAYKYTEAEDFEILIIAYSIDGGAISAIDMTKVDNEPFHADFETFK 62

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKL 118
            AL +  V   A N+ FERT L   FN  +P   WICT+V +   GLP++L  VGE L+L
Sbjct: 63  IALFDPAVKKYAFNANFERTCLAKHFNKQMPPEEWICTMVNSMRIGLPASLDKVGEVLRL 122

Query: 119 SSQKMEEGKELIARF---CKGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTREIFKR 174
            +QK + GK LI  F   CK         RN P H  E W+ F +YC  DV V   I  +
Sbjct: 123 QNQKDKAGKNLIRYFSIPCKPTKVNGGRTRNLPEHDLEKWQQFIDYCIRDVEVEMTIAHK 182

Query: 175 LE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSS 232
           ++  P+++ EQ  W  DQ INDRG  +  +L    N +    + +L  + + +T GL  +
Sbjct: 183 IKDFPVTAIEQAYWVFDQHINDRGIKLSKSLMLGANVLDKQSKEELLNQAKHIT-GL-EN 240

Query: 233 SRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLN 292
                +L  WL  + GL + +L + T Q  L   K+ T +A ++   R++ S+++V K N
Sbjct: 241 PNSPTQLLAWLKDDQGLDIPNLQKKTVQEYL---KEATGKAKKMLEIRLQMSKTSVKKYN 297

Query: 293 TLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITS 352
            + + M SD R+RG  QF GA  TGRW+G     QNL +   S  EL+     +      
Sbjct: 298 KMHDMMCSDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTELEIARDLIKEQRFD 356

Query: 353 DPD------PLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGE 406
           D D      P  ++S  VR+   A EG +L V+D + IEARV+AW A EQW+L  F T  
Sbjct: 357 DLDLLLNVHPQDLLSQLVRTTFTAEEGNELAVSDFSAIEARVIAWYAKEQWRLDVFNTHG 416

Query: 407 DLYVTTYARSFNVAPAQVTKDQ--RAIGKVMELALGYQGGAKAFQKMAS-TTGLNLNTFA 463
            +Y  + ++ FNV    +TK    R  GKV ELALGYQGGA A + M +   G+  N   
Sbjct: 417 KIYEASASQMFNVPVESITKGDPLRQKGKVSELALGYQGGAGALKAMGALEMGIEENELQ 476

Query: 464 HLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNE 523
            LV +                                         WR  +  +   W  
Sbjct: 477 GLVDS-----------------------------------------WRNANPNIVNFWKA 495

Query: 524 LHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVY--RDVGNNR---- 577
             +A   T+++ K       R     YMK  K  L++ LPSGR+L Y    VG N     
Sbjct: 496 CQEAAINTVKSRKTHHTHGVR----FYMK--KGFLMIELPSGRALAYPKASVGENSWGSQ 549

Query: 578 --SYLN-TTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVC 634
              ++     R+ ++  TYGGKL ENIVQA +RD+LA  +     +G+ IV  VHDE++ 
Sbjct: 550 VVEFMGLDLNRKWSKLKTYGGKLVENIVQATARDLLAISIARLEASGFKIVGHVHDEVIV 609

Query: 635 ETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           E P         +  +M     WAKGL L ++G+ S  Y K
Sbjct: 610 EIPRGSN-GLKEIETIMNKPVDWAKGLNLNSDGFTSPFYMK 649


>gi|297590990|ref|ZP_06949628.1| prophage LambdaSa04 DNA-directed DNA polymerase [Staphylococcus
           aureus subsp. aureus MN8]
 gi|297575876|gb|EFH94592.1| prophage LambdaSa04 DNA-directed DNA polymerase [Staphylococcus
           aureus subsp. aureus MN8]
          Length = 653

 Score =  308 bits (790), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 234/706 (33%), Positives = 335/706 (47%), Gaps = 85/706 (12%)

Query: 1   MATLFIDFETRSPIDLTKCGICKY--AEDVCVILFAFGFDDHPVELWDCVHDPVMP---- 54
           M  + ID ET S  D++KCG  KY  AE+  +++ A+  D   +   D       P    
Sbjct: 1   MRFMNIDIETYSSNDISKCGAYKYTEAEEFEILIIAYSIDGGAISAIDMTKVDNEPFHAD 60

Query: 55  -QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVG 113
            +  K AL +  V   A N+ FERT L   FN  +P   WICT+V +   GLP++L  VG
Sbjct: 61  FETFKIALFDPAVKKYAFNANFERTCLAKHFNKQMPPEEWICTMVNSMRIGLPASLDKVG 120

Query: 114 EALKLSSQKMEEGKELIARF---CKGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTR 169
           E L+L +QK + GK LI  F   CK         RN P H  E W+ F +YC  DV V  
Sbjct: 121 EVLRLQNQKDKAGKNLIRYFSIPCKPTKVNGGRTRNLPEHDLEKWQQFIDYCIRDVEVEM 180

Query: 170 EIFKRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTY 227
            I  +++  P+++ EQ  W  DQ INDRG  +  +L    N +    + +L  + + +T 
Sbjct: 181 TIAHKIKDFPVTAIEQAYWVFDQHINDRGIKLSKSLMLGANVLDKQSKEELLNQAKHIT- 239

Query: 228 GLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSA 287
           GL  +     +L  WL  + GL + +L + T Q  L   K+ T +A ++   R++ S+++
Sbjct: 240 GL-ENPNSPTQLLAWLNNDQGLDIPNLQKKTVQEYL---KEATGKAKKMLEIRLQMSKTS 295

Query: 288 VLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLP 347
           V K N + + M SD R+RG  QF GA  TGRW+G     QNL +   S  EL+     + 
Sbjct: 296 VKKYNKMHDMMCSDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTELEIARDLIK 354

Query: 348 TSITSDPD------PLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKA 401
                D D      P  ++S  VR+   A EG +L V+D + IEARV+AW A EQW+L  
Sbjct: 355 EQRFDDLDLLLNVHPQDLLSQLVRTTFTAEEGNELAVSDFSAIEARVIAWYAKEQWRLDV 414

Query: 402 FETGEDLYVTTYARSFNVAPAQVTKDQ--RAIGKVMELALGYQGGAKAFQKMAS-TTGLN 458
           F T   +Y  + ++ FNV    +TK    R  GKV ELALGYQGGA A + M +   G+ 
Sbjct: 415 FNTHGKIYEASASQMFNVPVESITKGDPLRQKGKVSELALGYQGGAGALKAMGALEMGIE 474

Query: 459 LNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVS 518
            N    LV +                                         WR  +  + 
Sbjct: 475 ENELQGLVDS-----------------------------------------WRNANPNIV 493

Query: 519 ELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVY--RDVGNN 576
             W    +A   T+++ K       R     YMK  K  L++ LPSGR+L Y    VG N
Sbjct: 494 NFWKACQEAAINTVKSRKTHHTHGLR----FYMK--KGFLMIELPSGRALAYPKASVGEN 547

Query: 577 R------SYLN-TTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVH 629
                   ++     R+ ++  TYGGKL ENIVQA +RD+LA  +     +G+ IV  VH
Sbjct: 548 SWGSQVVEFMGLDLNRKWSKLKTYGGKLVENIVQATARDLLAISIARLEASGFKIVGHVH 607

Query: 630 DEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           DE++ E P         +  +M     WAKGL L ++G+ S  Y K
Sbjct: 608 DEVIVEIPRGSN-GLKEIETIMNKPVDWAKGLNLNSDGFTSPFYMK 652


>gi|258445211|ref|ZP_05693406.1| DNA-directed DNA polymerase [Staphylococcus aureus A6300]
 gi|257855972|gb|EEV78892.1| DNA-directed DNA polymerase [Staphylococcus aureus A6300]
          Length = 653

 Score =  308 bits (790), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 234/706 (33%), Positives = 336/706 (47%), Gaps = 85/706 (12%)

Query: 1   MATLFIDFETRSPIDLTKCGICKY--AEDVCVILFAFGFDDHPVELWDCVHDPVMP---- 54
           M  + ID ET S  D++KCG  KY  AED  +++ A+  D   +   D       P    
Sbjct: 1   MKFMNIDIETYSSNDISKCGAYKYTEAEDFEILIIAYSIDGGAISAIDMTKVDNEPFHAD 60

Query: 55  -QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVG 113
            +  K AL +  V   A N+ FERT L   FN  +P   WICT+V +   GLP++L  VG
Sbjct: 61  YETFKIALFDPAVKKYAFNANFERTCLAKHFNKQMPPEEWICTMVNSMRIGLPASLDKVG 120

Query: 114 EALKLSSQKMEEGKELIARF---CKGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTR 169
           E L+L +QK + GK LI  F   CK         RN P H  E W+ F +YC  DV V  
Sbjct: 121 EVLRLQNQKDKAGKNLIRYFSIPCKPTKVNGGRTRNLPEHDLEKWQQFIDYCIRDVEVEM 180

Query: 170 EIFKRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTY 227
            I  +++  P+++ EQ  W  DQ INDRG  +  +L    N +    + +L ++ + +T 
Sbjct: 181 TIAHKIKDFPVTAIEQAYWVFDQHINDRGIKLSKSLMLGANVLDKQSKEELLKQAKHIT- 239

Query: 228 GLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSA 287
           GL  +     +L  WL  E GL + +L + T Q  L   K+ T +A ++   R++ S+++
Sbjct: 240 GL-ENPNSPTQLLAWLKDEQGLDIPNLQKKTVQDYL---KEATGKAKKMLEIRLQMSKTS 295

Query: 288 VLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLP 347
           V K N + + M SD R+RG  QF GA  TGRW+G     QNL +   S  EL+     + 
Sbjct: 296 VKKYNKMHDMMCSDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTELEIARDLIK 354

Query: 348 TSITSDPD------PLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKA 401
                D D      P  ++S  VR+   + EG +L V+D + IEARV+AW A EQW+L  
Sbjct: 355 EQRFDDLDLLLNVHPQDLLSQLVRTTFTSEEGNELAVSDFSAIEARVIAWYAKEQWRLDV 414

Query: 402 FETGEDLYVTTYARSFNVAPAQVTKDQ--RAIGKVMELALGYQGGAKAFQKMAS-TTGLN 458
           F T   +Y  + ++ FNV    +TK    R  GKV ELALGYQGGA A + M +   G+ 
Sbjct: 415 FNTHGKIYEASASQMFNVPVESITKGDPLRQKGKVSELALGYQGGAGALKAMGALEMGIE 474

Query: 459 LNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVS 518
            N    LV +                                         WR  +  + 
Sbjct: 475 ENELQGLVDS-----------------------------------------WRNANPNIV 493

Query: 519 ELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVY--RDVGNN 576
             W    +A   T+++ K       R     YMK  K  L++ LPSGR+L Y    VG N
Sbjct: 494 NFWKACQEAAINTVKSRKTHHTHGLR----FYMK--KGFLMIELPSGRALAYPKASVGEN 547

Query: 577 R------SYLN-TTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVH 629
                   ++     R+ ++  TYGGKL ENIVQA +R++LA  +     +G+ IV  VH
Sbjct: 548 SWGSQVVEFMGLDLNRKWSKLKTYGGKLVENIVQATARELLAISIARLEASGFKIVGHVH 607

Query: 630 DEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           DE++ E P         +  +M     WAKGL L ++G+ S  Y K
Sbjct: 608 DEVIVEIPRGSN-GLKEIETIMNKPVDWAKGLNLNSDGFTSPFYMK 652


>gi|227875067|ref|ZP_03993212.1| DNA-directed DNA polymerase [Mobiluncus mulieris ATCC 35243]
 gi|304390310|ref|ZP_07372263.1| DNA-directed DNA polymerase [Mobiluncus curtisii subsp. curtisii
           ATCC 35241]
 gi|306817354|ref|ZP_07451099.1| DNA-directed DNA polymerase [Mobiluncus mulieris ATCC 35239]
 gi|227844345|gb|EEJ54509.1| DNA-directed DNA polymerase [Mobiluncus mulieris ATCC 35243]
 gi|304326066|gb|EFL93311.1| DNA-directed DNA polymerase [Mobiluncus curtisii subsp. curtisii
           ATCC 35241]
 gi|304649795|gb|EFM47075.1| DNA-directed DNA polymerase [Mobiluncus mulieris ATCC 35239]
          Length = 655

 Score =  308 bits (790), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 243/713 (34%), Positives = 336/713 (47%), Gaps = 97/713 (13%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M TLF D E+ S   L K G+  YAE  D  ++LF +  D  P+E+ D  +   +P  + 
Sbjct: 1   MRTLFCDIESFSLAQLAKTGVYPYAEHPDFELLLFGYSIDGGPIEVVDLANGQSIPDEVL 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIP---------IHRWICTLVLARSNGLPSAL 109
            AL +  V   AHN+ FER  L A      P           +W CT++ +   GLP +L
Sbjct: 61  AALVDPSVVKWAHNAAFERVCLSAWLRTHHPELLADGFLGPRQWRCTMIWSAYLGLPMSL 120

Query: 110 KAVGEALKLSSQKMEEGKELIARFCKGETHECLYD---RNKPNHRE-AWRLFGEYCKGDV 165
            AV   LKL  QK   GK+LI +FC   T   L     RN P+     W  F +Y + DV
Sbjct: 121 DAVATVLKLDVQKDTVGKKLIKQFCTPATPSVLNGGKRRNPPSADPTGWARFIDYNRRDV 180

Query: 166 TVTREIFKRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELE 223
            V   I  RL   P+   E + + LDQ IND G  +D  L      + +  R       +
Sbjct: 181 EVELAIHDRLACFPMPESEWDTYTLDQRINDAGILLDHTLVDNAVGVDEHHRNATLARAQ 240

Query: 224 SLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRA 283
           +LT GL + +  ++ LK WL    G  L+ L +      L +    T    +V   R   
Sbjct: 241 TLT-GLENPNSPIQ-LKQWL-ASRGCVLDSLAKAEVDAALDTA---TGTVKEVLGLRGDL 294

Query: 284 SRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQII 343
           ++S+V K   +     SDGR RG +QF GA RTGR++G +   QNLPR      +LDQ  
Sbjct: 295 AKSSVKKYQAMQNVAGSDGRARGLIQFYGAGRTGRFAGRLVQVQNLPR--NYLPDLDQAR 352

Query: 344 THLPTSIT--------SDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGE 395
           T + T           S PD L   S  +R+  I S G + +VAD + IEARV+AW+AGE
Sbjct: 353 TLVRTGNLEALELLHESVPDTL---SQLIRTAFIPSPGHRFIVADFSAIEARVIAWLAGE 409

Query: 396 QWKLKAFETGEDLYVTTYARSFNVAPAQ---VTKDQRAIGKVMELALGYQGGAKAFQKMA 452
              L+AF  G+DLY  T +R F V P +   V  + R  GK+  LA G+ G   A ++M 
Sbjct: 410 TTTLQAFREGKDLYCETASRMFGV-PVEKHGVNGELRQKGKLAVLACGFGGSTGALERMG 468

Query: 453 S-TTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWR 511
           + T GL                                 EH ++ +           AWR
Sbjct: 469 ALTMGL--------------------------------AEHELKPIV---------DAWR 487

Query: 512 QKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYR 571
             +  +  LW  + +A    I + ++I  R  R         +   L + LPSGR L Y 
Sbjct: 488 AANPHIVALWAGVEEAAIAAIASRQSIRLRNLR------FSVEAGILFIELPSGRRLAYV 541

Query: 572 D--VGNNR-------SYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGY 622
              +G NR           TT R+  +  TYGGKLTENIVQA++RD+L  GM    KAG+
Sbjct: 542 KPRLGENRWGGTSITYTGTTTARRWGQLETYGGKLTENIVQAIARDLLVTGMHAVAKAGH 601

Query: 623 DIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
            IV+ VHDEIV + P+   F A+    LM++ P+WA+GLPL A+GYE   YRK
Sbjct: 602 QIVMHVHDEIVIDEPENSGFTATGACELMSTLPAWAEGLPLDADGYECAYYRK 654


>gi|282926447|ref|ZP_06334079.1| DNA polymerase bacteriophage-type [Staphylococcus aureus A10102]
 gi|282591776|gb|EFB96847.1| DNA polymerase bacteriophage-type [Staphylococcus aureus A10102]
          Length = 653

 Score =  308 bits (790), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 234/706 (33%), Positives = 335/706 (47%), Gaps = 85/706 (12%)

Query: 1   MATLFIDFETRSPIDLTKCGICKY--AEDVCVILFAFGFDDHPVELWDCVHDPVMP---- 54
           M  + ID ET S  D++KCG  KY  AED  +++ A+  D   +   D       P    
Sbjct: 1   MRFMNIDIETYSSNDISKCGAYKYTEAEDFEILIIAYSIDGGAISAIDMTKVDNEPFHAD 60

Query: 55  -QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVG 113
            +  K AL +  V   A N+ FERT L   FN  +P   WICT+V +   GLP++L  VG
Sbjct: 61  FETFKIALFDPAVKKYAFNANFERTCLAKHFNKQMPPEEWICTMVNSMRIGLPASLDKVG 120

Query: 114 EALKLSSQKMEEGKELIARF---CKGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTR 169
           E L+L +QK + GK LI  F   CK         RN P H  E W+ F +YC  DV V  
Sbjct: 121 EVLRLQNQKDKAGKNLIRYFSIPCKPTKVNGGRTRNLPEHDLEKWQQFIDYCIRDVEVEM 180

Query: 170 EIFKRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTY 227
            I  +++  P+++ EQ  W  DQ INDRG  +  +L    N +    + +L  + + +T 
Sbjct: 181 TIAHKIKDFPVTAIEQAYWVFDQHINDRGIKLSKSLMLGANVLDKQSKEELLNQAKHIT- 239

Query: 228 GLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSA 287
           GL  +     +L  WL  + GL + +L + T Q  L   K+ T +A ++   R++ S+++
Sbjct: 240 GL-ENPNSPTQLLAWLKDDQGLDIPNLQKKTVQEYL---KEATGKAKKMLEIRLQMSKTS 295

Query: 288 VLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLP 347
           V K N + + M SD R+RG  QF GA  TGRW+G     QNL +   S  EL+     + 
Sbjct: 296 VKKYNKMHDMMCSDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTELEIARDLIK 354

Query: 348 TSITSDPD------PLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKA 401
                D D      P  ++S  VR+   A EG +L V+D + IEARV+AW A EQW+L  
Sbjct: 355 EQRFDDLDLLLNVHPQDLLSQLVRTTFTAEEGNELAVSDFSAIEARVIAWYAKEQWRLDV 414

Query: 402 FETGEDLYVTTYARSFNVAPAQVTKDQ--RAIGKVMELALGYQGGAKAFQKMAS-TTGLN 458
           F T   +Y  + ++ FNV    +TK    R  GKV ELALGYQGGA A + M +   G+ 
Sbjct: 415 FNTHGKIYEASASQMFNVPVESITKGDPLRQKGKVSELALGYQGGAGALKAMGALEMGIE 474

Query: 459 LNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVS 518
            N    LV +                                         WR  +  + 
Sbjct: 475 ENELQGLVDS-----------------------------------------WRNANPNIV 493

Query: 519 ELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVY--RDVGNN 576
             W    +A   T+++ K       R     YMK  K  L++ LPSGR+L Y    VG N
Sbjct: 494 NFWKACQEAAINTVKSRKTHHTHGLR----FYMK--KGFLMIELPSGRALAYPKASVGEN 547

Query: 577 R------SYLN-TTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVH 629
                   ++     R+ ++  TYGGKL ENIVQA +RD+LA  +     +G+ IV  VH
Sbjct: 548 SWGSQVVEFMGLDLNRKWSKLKTYGGKLVENIVQATARDLLAISIARLEASGFKIVGHVH 607

Query: 630 DEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           DE++ E P         +  +M     WA+GL L ++G+ S  Y K
Sbjct: 608 DEVIVEIPRGSN-GLKEIETIMNKPVEWAEGLNLNSDGFTSPFYMK 652


>gi|262053228|ref|ZP_06025380.1| putative DNA polymerase [Staphylococcus aureus 930918-3]
 gi|259158878|gb|EEW43970.1| putative DNA polymerase [Staphylococcus aureus 930918-3]
          Length = 653

 Score =  308 bits (790), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 234/706 (33%), Positives = 335/706 (47%), Gaps = 85/706 (12%)

Query: 1   MATLFIDFETRSPIDLTKCGICKY--AEDVCVILFAFGFDDHPVELWDCVHDPVMP---- 54
           M  + ID ET S  D++KCG  KY  AED  +++ A+  D   +   D       P    
Sbjct: 1   MRFMNIDIETYSSNDISKCGAYKYTEAEDFEILIIAYSIDGGAISAIDMTKVDNEPFHAD 60

Query: 55  -QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVG 113
            +  K AL +  V   A N+ FERT L   FN  +P   WICT+V +   GLP++L  VG
Sbjct: 61  FETFKIALFDPAVKKYAFNANFERTCLAKHFNKQMPPEEWICTMVNSMRIGLPASLDKVG 120

Query: 114 EALKLSSQKMEEGKELIARF---CKGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTR 169
           E L+L +QK + GK LI  F   CK         RN P H  E W+ F +YC  DV V  
Sbjct: 121 EVLRLQNQKDKAGKNLIRYFSIPCKPTKVNGGRTRNLPEHDLEKWQQFIDYCIRDVEVEM 180

Query: 170 EIFKRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTY 227
            I  +++  P+++ EQ  W  DQ INDRG  +  +L    N +    + +L  + + +T 
Sbjct: 181 TIAHKIKDFPVTAIEQAYWVFDQHINDRGIKLSKSLMLGANVLDKQSKEELLNQAKHIT- 239

Query: 228 GLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSA 287
           GL  +     +L  WL  + GL + +L + T Q  L   K+ T +A ++   R++ S+++
Sbjct: 240 GL-ENPNSPTQLLAWLKDDQGLDIPNLQKKTVQEYL---KEATGKAKKMLEIRLQMSKTS 295

Query: 288 VLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLP 347
           V K N + + M SD R+RG  QF GA  TGRW+G     QNL +   S  EL+     + 
Sbjct: 296 VKKYNKMHDMMCSDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTELEIARDLIK 354

Query: 348 TSITSDPD------PLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKA 401
                D D      P  ++S  VR+   A EG +L V+D + IEARV+AW A EQW+L  
Sbjct: 355 EQRFDDLDLLLNVHPQDLLSQLVRTTFTAEEGNELAVSDFSAIEARVIAWYAKEQWRLDV 414

Query: 402 FETGEDLYVTTYARSFNVAPAQVTKDQ--RAIGKVMELALGYQGGAKAFQKMAS-TTGLN 458
           F T   +Y  + ++ FNV    +TK    R  GKV ELALGYQGGA A + M +   G+ 
Sbjct: 415 FNTHGKIYEASASQMFNVPVESITKGDPLRQKGKVSELALGYQGGAGALKAMGALEMGIE 474

Query: 459 LNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVS 518
            N    LV +                                         WR  +  + 
Sbjct: 475 ENELQGLVDS-----------------------------------------WRNANPNIV 493

Query: 519 ELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVY--RDVGNN 576
             W    +A   T+++ K       R     Y+K  K  L++ LPSGR+L Y    VG N
Sbjct: 494 NFWKACQEAAINTVKSRKTHHTHGLR----FYIK--KGFLMIELPSGRALAYPKASVGEN 547

Query: 577 R------SYLN-TTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVH 629
                   ++     R+ ++  TYGGKL ENIVQA +RD+LA  +     +G+ IV  VH
Sbjct: 548 SWGSQVVEFMGLDLNRKWSKLKTYGGKLVENIVQATARDLLAISIARLEASGFKIVGHVH 607

Query: 630 DEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           DE++ E P         +  +M     WAKGL L ++G+ S  Y K
Sbjct: 608 DEVIVEIPRGSN-GLKEIETIMNKPVDWAKGLNLNSDGFTSPFYMK 652


>gi|49483719|ref|YP_040943.1| DNA polymerase [Staphylococcus aureus subsp. aureus MRSA252]
 gi|49241848|emb|CAG40540.1| putative DNA polymerase [Staphylococcus aureus subsp. aureus
           MRSA252]
          Length = 653

 Score =  308 bits (790), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 234/706 (33%), Positives = 335/706 (47%), Gaps = 85/706 (12%)

Query: 1   MATLFIDFETRSPIDLTKCGICKY--AEDVCVILFAFGFDDHPVELWDCVHDPVMP---- 54
           M  + ID ET S  D++KCG  KY  AE+  +++ A+  D   +   D       P    
Sbjct: 1   MRFMNIDIETYSSNDISKCGAYKYTEAEEFEILIIAYSIDGGAISAIDMTKVDNEPFHAD 60

Query: 55  -QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVG 113
            +  K AL +  V   A N+ FERT L   FN  +P   WICT+V +   GLP++L  VG
Sbjct: 61  FETFKIALFDPAVKKYAFNANFERTCLAKHFNKQMPPEEWICTMVNSMRIGLPASLDKVG 120

Query: 114 EALKLSSQKMEEGKELIARF---CKGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTR 169
           E L+L +QK + GK LI  F   CK         RN P H  E W+ F +YC  DV V  
Sbjct: 121 EVLRLQNQKDKAGKNLIRYFSIPCKPTKVNGGRTRNLPEHDLEKWQQFIDYCIRDVEVEM 180

Query: 170 EIFKRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTY 227
            I  +++  P+++ EQ  W  DQ INDRG  +  +L    N +    + +L  + + +T 
Sbjct: 181 TIAHKIKDFPVTAIEQAYWVFDQHINDRGIKLSKSLMLGANVLDKQSKEELLNQAKHIT- 239

Query: 228 GLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSA 287
           GL  +     +L  WL  + GL + +L + T Q  L   K+ T +A ++   R++ S+++
Sbjct: 240 GL-ENPNSPTQLLAWLKNDQGLDIPNLQKKTVQEYL---KEATGKAKKMLEIRLQMSKTS 295

Query: 288 VLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLP 347
           V K N + + M SD R+RG  QF GA  TGRW+G     QNL +   S  EL+     + 
Sbjct: 296 VKKYNKMHDMMCSDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTELEIARDLIK 354

Query: 348 TSITSDPD------PLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKA 401
                D D      P  ++S  VR+   A EG +L V+D + IEARV+AW A EQW+L  
Sbjct: 355 EQRFDDLDLLLNVHPQDLLSQLVRTTFTAEEGNELAVSDFSAIEARVIAWYAKEQWRLDV 414

Query: 402 FETGEDLYVTTYARSFNVAPAQVTKDQ--RAIGKVMELALGYQGGAKAFQKMAS-TTGLN 458
           F T   +Y  + ++ FNV    +TK    R  GKV ELALGYQGGA A + M +   G+ 
Sbjct: 415 FNTHGKIYEASASQMFNVPVESITKGDPLRQKGKVSELALGYQGGAGALKAMGALEMGIE 474

Query: 459 LNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVS 518
            N    LV +                                         WR  +  + 
Sbjct: 475 ENELQGLVDS-----------------------------------------WRNANPNIV 493

Query: 519 ELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVY--RDVGNN 576
             W    +A   T+++ K       R     YMK  K  L++ LPSGR+L Y    VG N
Sbjct: 494 NFWKACQEAAINTVKSRKTHHTHGLR----FYMK--KGFLMIELPSGRALAYPKASVGEN 547

Query: 577 R------SYLN-TTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVH 629
                   ++     R+ ++  TYGGKL ENIVQA +RD+LA  +     +G+ IV  VH
Sbjct: 548 SWGSQVVEFMGLDLNRKWSKLKTYGGKLVENIVQATARDLLAISIARLEASGFKIVGHVH 607

Query: 630 DEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           DE++ E P         +  +M     WAKGL L ++G+ S  Y K
Sbjct: 608 DEVIVEIPRGSN-GLKEIETIMNKPVDWAKGLNLNSDGFTSPFYMK 652


>gi|315128370|gb|EFT84381.1| DNA-directed DNA polymerase [Staphylococcus aureus subsp. aureus
           CGS03]
          Length = 653

 Score =  308 bits (790), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 234/706 (33%), Positives = 336/706 (47%), Gaps = 85/706 (12%)

Query: 1   MATLFIDFETRSPIDLTKCGICKY--AEDVCVILFAFGFDDHPVELWDCVHDPVMP---- 54
           M  + ID ET S  D++KCG  KY  AED  +++ A+  D   +   D       P    
Sbjct: 1   MKFMNIDIETYSSNDISKCGAYKYTEAEDFEILIIAYSIDGGAISAIDMTKVDDEPFHAD 60

Query: 55  -QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVG 113
            +  K AL +  V   A N+ FERT L   FN  +P   WICT+V +   GLP++L  VG
Sbjct: 61  YETFKIALFDPAVKKYAFNANFERTCLAKHFNKQMPPEEWICTMVNSMRIGLPASLDKVG 120

Query: 114 EALKLSSQKMEEGKELIARF---CKGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTR 169
           E L+L +QK + GK LI  F   CK         RN P H  E W+ F +YC  DV V  
Sbjct: 121 EVLRLQNQKDKAGKNLIRYFSIPCKPTKVNGGRTRNLPEHDLEKWQQFIDYCIRDVEVEM 180

Query: 170 EIFKRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTY 227
            I  +++  P+++ EQ  W  DQ INDRG  +  +L    N +    + +L ++ + +T 
Sbjct: 181 TIAHKIKDFPVTAIEQAYWVFDQHINDRGIKLSKSLMLGANVLDKQSKEELLKQAKHIT- 239

Query: 228 GLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSA 287
           GL  +     +L  WL  E GL + +L + T Q  L   K+ T +A ++   R++ S+++
Sbjct: 240 GL-ENPNSPTQLLAWLKDEQGLDIPNLQKKTVQDYL---KEATGKAKKMLEIRLQMSKTS 295

Query: 288 VLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLP 347
           V K N + + M SD R+RG  QF GA  TGRW+G     QNL +   S  EL+     + 
Sbjct: 296 VKKYNKMHDMMCSDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTELEIARDLIK 354

Query: 348 TSITSDPD------PLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKA 401
                D D      P  ++S  VR+   + EG +L V+D + IEARV+AW A E+W+L  
Sbjct: 355 EQRFDDLDLLLNVHPQDLLSQLVRTTFTSEEGNELAVSDFSAIEARVIAWYAKERWRLDV 414

Query: 402 FETGEDLYVTTYARSFNVAPAQVTKDQ--RAIGKVMELALGYQGGAKAFQKMAS-TTGLN 458
           F T   +Y  + ++ FNV    +TK    R  GKV ELALGYQGGA A + M +   G+ 
Sbjct: 415 FNTHGKIYEASASQMFNVPVESITKGDPLRQKGKVSELALGYQGGAGALKAMGALEMGIE 474

Query: 459 LNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVS 518
            N    LV +                                         WR  +  + 
Sbjct: 475 ENELQGLVDS-----------------------------------------WRNANPNIV 493

Query: 519 ELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVY--RDVGNN 576
             W    +A   T+++ K       R     YMK  K  L++ LPSGR+L Y    VG N
Sbjct: 494 NFWKACQEAAINTVKSRKTHHTHGLR----FYMK--KGFLMIELPSGRALAYPKASVGEN 547

Query: 577 R------SYLN-TTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVH 629
                   ++     R+ ++  TYGGKL ENIVQA +RD+LA  +     +G+ IV  VH
Sbjct: 548 SWGSQVVEFMGLDLNRKWSKLKTYGGKLVENIVQATARDLLAISIARLEASGFKIVGHVH 607

Query: 630 DEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           DE++ E P         +  +M     WAKGL L ++G+ S  Y K
Sbjct: 608 DEVIVEIPRGSN-GLKEIETIMNKPVDWAKGLNLNSDGFTSPFYMK 652


>gi|332088061|gb|EGI93186.1| DNA-directed DNA polymerase [Shigella boydii 5216-82]
          Length = 975

 Score =  307 bits (787), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 180/448 (40%), Positives = 257/448 (57%), Gaps = 15/448 (3%)

Query: 4   LFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHDPVMPQVLKEALEN 63
           L+ D ET   I +T  G   YAE V V+LFA+  +D PV +WD      +P  L EA+  
Sbjct: 6   LWGDLETYCEIPITN-GTHAYAEGVEVMLFAWAINDGPVNVWDITAGGGIPHGLYEAIAA 64

Query: 64  TDVTIVAHNSYFERTVLK-ACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKLSSQK 122
            +  +  HNS+F+RTVL+ A   L  P+ RW  T+V A ++GLP +L  + E L +   K
Sbjct: 65  PETLLYFHNSHFDRTVLRYAMPRLAPPVERWRDTMVQALAHGLPGSLGELCEILGVPQDK 124

Query: 123 ME--EGKELIARFCKGETHECLYDR-NKPNHREAWRLFGEYCKGDVTVTREIFKRLEPLS 179
            +  EGK LI  FCK         R     H E WR F  Y   D+   RE++KRL   +
Sbjct: 125 AKDKEGKALIQLFCKPRPKNSKLRRATSKTHPEEWRRFVAYAGLDIEAMREVYKRLPKWN 184

Query: 180 SKEQEL--WYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSSSRCLE 237
            +  EL  W+ DQ INDRG C+D+ LA    + VD E+ +L +  + +T G V ++   +
Sbjct: 185 YQGTELALWHRDQQINDRGVCMDIQLARAAIEAVDQEQKRLAKRTQEMTDGEVQAATQRD 244

Query: 238 KLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLNTLVEA 297
            L   +    G+ L D+  +T +R ++ +  L     ++   R +AS ++  K   L++ 
Sbjct: 245 ALIKHIVESYGVELPDMQRSTLERRIA-DPDLPSAVKELLAIRQQASTTSTSKYKALMKG 303

Query: 298 MNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITS--DPD 355
           ++ DGRLRGTLQF GASRTGRW+G +F PQNLPRPS   E++D+ I  L          +
Sbjct: 304 VSHDGRLRGTLQFCGASRTGRWAGRLFQPQNLPRPSLKQEQIDEGIEALKAGCADLLFDN 363

Query: 356 PLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFE-----TGEDLYV 410
            +++ S  +R C+IA  GKKLVV+DL+ IE R+LAW+AGE+WKL AF      TG DLY 
Sbjct: 364 IMELTSSALRGCIIAPTGKKLVVSDLSNIEGRMLAWLAGEEWKLNAFREYDAGTGPDLYK 423

Query: 411 TTYARSFNVAPAQVTKDQRAIGKVMELA 438
             YA+++ +   +VTKDQR IGKV+ELA
Sbjct: 424 LAYAKAYGIEVERVTKDQRQIGKVLELA 451



 Score =  141 bits (355), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 88/244 (36%), Positives = 134/244 (54%), Gaps = 17/244 (6%)

Query: 440 GYQGGAKAFQKMASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAI-EDLF 498
           GY GG  AF   A    L+L+  A+    N   +   +A+++     +    + + E +F
Sbjct: 740 GYGGGVSAFITFALVYSLDLDELANAALPNIPRDVIREAKSWYYESVKRKSTYGLSERVF 799

Query: 499 IGTACERVKKAWRQKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMK--KDKN 556
           I  AC+ +K+ WR+ H    + W EL    E+T+   +  IA  ++ +   Y+K  +D  
Sbjct: 800 I--ACDSLKRLWRRAHPATCDFWYEL----ERTV---RTAIATPQKTLYCGYLKIRRDGA 850

Query: 557 NLILMLPSGRSLVYRDV---GNNRSYL--NTTTRQLTREYTYGGKLTENIVQAVSRDILA 611
            L + LPSGR++ Y        N +Y+  N+ +R+  R  TYGGKL EN+ QA +RD+LA
Sbjct: 851 WLRIQLPSGRAVCYPSPVIEKGNITYMGVNSYSRKWQRLKTYGGKLVENVTQAAARDVLA 910

Query: 612 EGMMNATKAGYDIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESK 671
             M     AGY IVLTVHDEI+ E PD+ +++A  +  L+ + P WA  +PL A G+ES 
Sbjct: 911 GNMPLIEDAGYSIVLTVHDEIISEAPDSPDYSAEHVSQLLATVPDWATSIPLNAGGFESY 970

Query: 672 RYRK 675
           RYRK
Sbjct: 971 RYRK 974


>gi|238018841|ref|ZP_04599267.1| hypothetical protein VEIDISOL_00701 [Veillonella dispar ATCC 17748]
 gi|237864607|gb|EEP65897.1| hypothetical protein VEIDISOL_00701 [Veillonella dispar ATCC 17748]
          Length = 644

 Score =  305 bits (782), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 236/698 (33%), Positives = 329/698 (47%), Gaps = 83/698 (11%)

Query: 4   LFIDFETRS--PIDLTKCGICKYAEDVC--VILFAFGFDDHPVELWDCVHDPVMPQVLKE 59
           L ID ET S  PI   K G  +Y +D    ++LFA+ FDD PVE+ D   DP +P+ + +
Sbjct: 3   LSIDVETYSDCPI---KYGAQRYVDDTTFEILLFAYSFDDEPVEVIDMTKDP-LPERVVD 58

Query: 60  ALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKLS 119
           AL N ++T  A N+ FE   LK  F  D     W CT VLA    LP++L  V +AL+L 
Sbjct: 59  ALYNKEITKTAFNAAFEMLCLKKYFP-DADYTNWECTSVLALYCSLPASLDNVSKALRLG 117

Query: 120 SQKMEEGKELIARFC--KGETHECLYDRNKP-NHREAWRLFGEYCKGDVTVTREIFKRLE 176
             K   GK LI  F   +  T      RN P +  E W  + EY + DV V R I KRL 
Sbjct: 118 EAKDARGKRLIQFFSVPRKPTKTNPKTRNMPEDAPEKWAEYIEYNRQDVVVERAIRKRLL 177

Query: 177 PLS--SKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSSSR 234
            L   + E E W LDQ IN RG  VD+ L        D E  +   E   +  GL + + 
Sbjct: 178 SLKPPAIEHEYWLLDQDINWRGVKVDMELVDAALACND-EIVEEATESSKILTGLENPNS 236

Query: 235 CLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLNTL 294
            ++ LK WL    G  LE + +     +L+ +  +     +V  NR     S++ K   +
Sbjct: 237 TMQ-LKEWLTARLGYDLETMRKDDVSNLLAQD--IPSDVRKVLQNRQVLGNSSIKKYLAM 293

Query: 295 VEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITSDP 354
             A+ SDGR+ G LQF GA R+GRW+G V   QNLPR     E+LD     L +      
Sbjct: 294 KNAVCSDGRIHGMLQFYGAMRSGRWAGRVVQLQNLPR--NYLEDLDTARDVLKSRDVEML 351

Query: 355 D-----PLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLY 409
           D     P  +I   +R+ ++A +G + +VAD + IEARV+AW+A E+W+   F  G D+Y
Sbjct: 352 DLLYGNPGDVIKQLIRTALVAEDGHRFIVADFSAIEARVIAWLAHEKWRQDVFAQGGDIY 411

Query: 410 VTTYARSFNVAPAQ--VTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVK 467
             + +  F+V   +  V    R  GKV ELALGY GG  A + M S   +          
Sbjct: 412 CASASSMFHVPVEKHGVNGHLRQKGKVAELALGYGGGVGAMKAMDSKGEI---------- 461

Query: 468 TNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELHQA 527
                                 PE  +  +          +AWRQ   R+++ W +   A
Sbjct: 462 ----------------------PEKELPGII---------EAWRQASPRITKFWKDADSA 490

Query: 528 FEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYR--DVGNNR-------- 577
            +Q +  G+ +    R     +   K K  L + LPSGR L Y    +G N+        
Sbjct: 491 AKQVVRTGEPV----RIIQGNIKFFKSKGFLFIELPSGRRLAYARPRLGLNQFGSESIEY 546

Query: 578 SYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETP 637
             ++       R  TYGGKL ENIVQAV+RD LA  M+  +KAGY IV  +HDE+V E P
Sbjct: 547 DGMDQVKNTWGRVETYGGKLVENIVQAVARDCLAASMLRLSKAGYKIVAHIHDEVVIEAP 606

Query: 638 DTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
                +   +  +M     W +GL L A G+E+  Y K
Sbjct: 607 -IGVGSLEEVIDIMCEPEPWNEGLILNAAGFENPYYMK 643


>gi|237738628|ref|ZP_04569109.1| DNA polymerase [Fusobacterium sp. 2_1_31]
 gi|229424111|gb|EEO39158.1| DNA polymerase [Fusobacterium sp. 2_1_31]
          Length = 656

 Score =  305 bits (782), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 234/718 (32%), Positives = 342/718 (47%), Gaps = 106/718 (14%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYA--EDVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M TL ID ET S +D+ K G  KYA  +D  ++LFA+  D   V++ D      +P  + 
Sbjct: 1   MRTLNIDIETFSSVDIGKSGAYKYAMSDDFQILLFAYSVDGQDVKIIDLAQGEAIPGEVL 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKL 118
           + L++      A+N+ FE   L     ++ P+ +W CT+V     G  + L A+G A+ L
Sbjct: 61  DLLKDETCIKYAYNAVFEWWCLNMA-GIETPLEQWHCTMVHGLYCGYTAGLAAIGNAMGL 119

Query: 119 --SSQKMEEGKELIARFC------KGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTR 169
               +K+  G  LI  FC      K   +     RN P+H  E W LF EYC  DV    
Sbjct: 120 PQDKKKLTTGSALIRYFCIPCNPTKSNGNRT---RNLPHHAPEKWELFKEYCIQDVVTEM 176

Query: 170 EIFKRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTY 227
           EI +RL   P+  +E +LW LD  +N  G  VD  L +    I  + R  L +E   +T 
Sbjct: 177 EIGRRLSAFPVPEREWKLWVLDTFMNAYGVRVDSELVNGALYIDALSRANLLEEARDITK 236

Query: 228 GLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSA 287
             + +     +L  WL  E G  +E+L + T  +++ +      +A +V   R   S+++
Sbjct: 237 --LDNPNSTSQLLNWL-EEAGEEVENLQKATVGKMIDTLDD--GKAKRVLEIRQELSKTS 291

Query: 288 VLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELD------- 340
           V K   + EAM  D R+RG LQF GA+RTGR++G +   QNLPR     E LD       
Sbjct: 292 VKKYKAMDEAMCKDERVRGLLQFYGANRTGRYAGRLVQVQNLPR--NYIETLDVARDVIK 349

Query: 341 ----QIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQ 396
               +++  L  +I   PD L   S  +R+  I SEG   VV+D + IEARV+AW+AGE+
Sbjct: 350 KGDGELLEMLYGNI---PDTL---SQLIRTAFIPSEGNHFVVSDFSAIEARVIAWLAGEE 403

Query: 397 WKLKAFETGEDLYVTTYARSFNVAPAQVTKDQ-----RAIGKVMELALGYQGGAKAFQKM 451
           W+++ F+T   +Y  + ++ F V    + K +     RA GKV ELALGYQG   A   M
Sbjct: 404 WRMEVFKTHGKIYEASASQMFGVPINTIAKGEENYHLRAKGKVAELALGYQGSVGALTAM 463

Query: 452 -ASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAW 510
            A+  GL               EE +D                            +   W
Sbjct: 464 GAADMGLT-------------DEEMKD----------------------------IVDRW 482

Query: 511 RQKHSRVSELWNELHQAFEQTIENGKAII---ARKRRDVPLVYMKKDKNNLILMLPSGRS 567
           R+   R+ ELW  L  A  + +E G+  I    +  ++   +Y    ++   + LPSGR 
Sbjct: 483 RKSSKRIVELWYALENAAVEVLETGEPQIVKCVKLAKEYDFIY---GQDFFTIELPSGRK 539

Query: 568 LVY-------RDVGNNRSY---LNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNA 617
           L Y          G  + +   +N TT++     TYGGKLTENIVQA++RD LAE ++  
Sbjct: 540 LFYPKPFLKENQFGQMQMHYMGINQTTKKWEVIPTYGGKLTENIVQAIARDCLAETLLRV 599

Query: 618 TKAGYDIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
              G+ IV  VHDEI+ + P + E    +    MT   SWAKGL L A G+    Y K
Sbjct: 600 KAKGWPIVFHVHDEIILDVPKSVELEEVI--KTMTEEISWAKGLILNAAGFTGSYYMK 655


>gi|290466795|gb|ADD25725.1| putative DNA polymerase [Lactococcus phage 1358]
          Length = 653

 Score =  305 bits (781), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 235/702 (33%), Positives = 336/702 (47%), Gaps = 84/702 (11%)

Query: 4   LFIDFETRSPIDLTKCGICKYAEDVC--VILFAFGFDDHPVELWDCVHDPVMPQVLKEAL 61
           L ID ET S +DL  CG+ +YA      + LF++ F D PV   D     V+P  +  AL
Sbjct: 5   LHIDIETFSDVDLAGCGVYRYAASPAFYIQLFSYRFGDEPVTRLDLQQGDVIPSKVLRAL 64

Query: 62  ENTDVTIVAHNSYFERTVLKACFNLD---IPIHRWICTLVLARSNGLPSALKAVGEALKL 118
            +     VAHN+ FER  +   + LD   +    W CT+V     GLP +L  +G+AL L
Sbjct: 65  RDPKRIKVAHNAQFERVCI--GYELDGRPLDPTNWRCTMVWGSCLGLPQSLDGMGKALGL 122

Query: 119 SSQKMEEGKELIARF---CKGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTREIFKR 174
             QK +EGK LI  F   CK         +N P H  E W  +G+Y + DV V   I  +
Sbjct: 123 DVQKDKEGKRLIQYFSKPCKPTKANGGRTQNLPEHAPEDWEHYGKYNEIDVEVETGISDK 182

Query: 175 LEP---LSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVS 231
           L     L + E   +  DQ IND G  VDV       ++ D  + +   +L  LT   V 
Sbjct: 183 LAAIYELPADEWRGYENDQRINDAGVPVDVPFVRQAIKLKDKLKKRSSMKLRRLTG--VE 240

Query: 232 SSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNK--KLTPQAIQVFNNRMRASRSAVL 289
           S   +++LK W   + G  +E L +  C+  L+  +  +  P+  ++      A  +AV 
Sbjct: 241 SVTKVQQLKAWAAAQ-GYPVESLDKQHCEDYLNDPELHQDFPEVYRMIELYQEAGGAAVA 299

Query: 290 KLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELD---QIITHL 346
           K + ++  +  DG ++G L+F GA  T RW+G     QNLPR     ++L+   QI+   
Sbjct: 300 KYDKIMAQLMPDGTIKGQLRFCGAGATARWAGKGVQVQNLPRVYLKADKLEAARQIVAKG 359

Query: 347 PT-SITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETG 405
            T  +    +P+ +I+  VR+ +      +  V+D + IEARV+AW AGE W LKAFE G
Sbjct: 360 KTVGLKKFGNPIDVITQLVRTSLKPPTDYEFGVSDYSAIEARVVAWFAGESWVLKAFEDG 419

Query: 406 EDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHL 465
           ED+YV T ++ ++V   +  +  R  GK   LALGYQGGA A   M +            
Sbjct: 420 EDIYVATASKMYHVT-GEEAEAMRQKGKQATLALGYQGGANALIVMGA------------ 466

Query: 466 VKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELH 525
                              ++   PE  + +L          + WR+ +  +  LW+ + 
Sbjct: 467 -------------------LRAGIPEEELPELV---------QLWRKANPNIVNLWHTVD 498

Query: 526 QAFEQTIENGKA---IIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDV---GNNRSY 579
           +A    I NG A   ++A  +    ++  K D++ L + LPSGR L Y D     N  SY
Sbjct: 499 KAARMAINNGGAKRYVLADGKL---VISYKGDEHVLQVQLPSGRKLNYFDCKIRDNKISY 555

Query: 580 LNTTTRQLTREY--TYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDE---IVC 634
           L       +R Y  TYGGKLTEN+VQA SRD+L   +M    AG   V  VHDE   IV 
Sbjct: 556 LKGVRGDGSRFYADTYGGKLTENLVQATSRDLLLAALMRIEAAGIQTVFHVHDETINIVP 615

Query: 635 ETPDTDEFNASMLYHLMTS-NPSWAKGLPLKAEGYESKRYRK 675
           E    +E N     +LMTS  P WA GLPL +EG   K YRK
Sbjct: 616 EGTKIEEIN-----NLMTSPAPEWADGLPLDSEGDVIKYYRK 652


>gi|300933386|ref|ZP_07148642.1| DNA-directed DNA polymerase [Corynebacterium resistens DSM 45100]
          Length = 653

 Score =  304 bits (779), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 244/711 (34%), Positives = 328/711 (46%), Gaps = 95/711 (13%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M  LF+D ET SP++LTK G+  YAE  D  V+LF +  D +PV++ D      +P  + 
Sbjct: 1   MHELFVDLETFSPVNLTKSGVYPYAEHPDFDVLLFGYSIDGNPVKVVDVASSEQLPAEVV 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIP----------IHRWICTLVLARSNGLPSA 108
           EAL +  VT  A N+ FER  L A      P            +W CT+V +   GLP +
Sbjct: 61  EALVDPGVTKWAFNAAFERVCLSAWLARHHPDLIAGRNFLDPAQWRCTMVWSAYLGLPMS 120

Query: 109 LKAVGEALKLSSQKMEEGKELIARFCKGETHECLYD---RNKP-NHREAWRLFGEYCKGD 164
           L+ V   L L  +K   GK+LI RFC       L     RN P +  + W  F  Y + D
Sbjct: 121 LEQVATVLDLPVRKDSAGKKLITRFCTPARPSVLNQGEMRNLPASDPDGWEQFISYNRRD 180

Query: 165 VTVTREIFKRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQEL 222
           V V   I  RL   P+   E   + LDQ IND G  +D  L     Q     R       
Sbjct: 181 VEVELAIHDRLAGFPMPEAEWATYALDQNINDTGIRLDRVLVDHAVQCDRQHRATTLARA 240

Query: 223 ESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMR 282
           + LT GL + +  ++ LK WL    G  L+ LT+      L +    T +  +V   R  
Sbjct: 241 QELT-GLENPNSPIQ-LKDWLTAH-GTPLQSLTKDEVAAALDTA---TGEVREVLQLRGE 294

Query: 283 ASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSH--EELD 340
            ++S+V K  T+      DGR RG LQF GA RTGR++G +   QNLPR       E  D
Sbjct: 295 LAKSSVKKYETMQHVAGRDGRGRGFLQFYGAGRTGRFAGRLVQVQNLPRNYLPDLCEARD 354

Query: 341 QIITHLPTSI----TSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQ 396
            + T    ++     S PD L   S  +R+  + ++G + VVAD + IEARV+AW+AGE 
Sbjct: 355 LVRTGEFEAVELLYDSVPDTL---SQLIRTAFVPADGHRFVVADFSAIEARVIAWLAGEA 411

Query: 397 WKLKAFETGEDLYVTTYARSFNVAPAQ--VTKDQRAIGKVMELALGYQGGAKAFQKMAST 454
             L+AF  G+DLY  T +R F V   +     + R  GK+  LA GYQGG  A + M + 
Sbjct: 412 TTLQAFRDGKDLYCETASRMFGVPVDKHGANAELRQKGKIAVLACGYQGGVGALKAMGAL 471

Query: 455 -TGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQK 513
             GL  +    LV                                          AWR  
Sbjct: 472 RMGLAESELQPLV-----------------------------------------DAWRAA 490

Query: 514 HSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVY--R 571
           +  V +LW +++ A    IE   AI  R+   V  +    +   + + LPSGR L Y   
Sbjct: 491 NPNVVQLWADINAA---AIE---AISTRQPTGVGALTFTVESGIMFVRLPSGRRLAYVKP 544

Query: 572 DVGNNRSYLNTTT-------RQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDI 624
            +G NR      T       R+  +  TYGGKLTENIVQAV+RD+L  GM    +AGY I
Sbjct: 545 KLGENRFGGTAITHEGIATGRKWGQLETYGGKLTENIVQAVARDLLTFGMHQVDRAGYRI 604

Query: 625 VLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           V+ VHDEIV ET          +  LM + P WA GLPL A+GY    Y K
Sbjct: 605 VMHVHDEIVVETATA---TVDEICELMATAPDWAAGLPLAADGYACDFYMK 652


>gi|227497454|ref|ZP_03927686.1| DNA-directed DNA polymerase [Actinomyces urogenitalis DSM 15434]
 gi|226833079|gb|EEH65462.1| DNA-directed DNA polymerase [Actinomyces urogenitalis DSM 15434]
          Length = 649

 Score =  301 bits (770), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 230/716 (32%), Positives = 337/716 (47%), Gaps = 109/716 (15%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAEDVC--VILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M +L +D ET SP +L   G+ +YAED    ++LF +  D  P ++ D      +P  + 
Sbjct: 1   MRSLSLDLETFSPTNLATAGVYRYAEDEAFRILLFGYSIDGAPAKVIDLARGEPIPPGIL 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIP---------IHRWICTLVLARSNGLPSAL 109
           +AL +  VT  A N+ FER  + A      P            W CT+V A S GLP +L
Sbjct: 61  QALTDPTVTKSAFNASFERVCMSAYLRRHHPDLLAEGFLGPRGWRCTMVWAASLGLPMSL 120

Query: 110 KAVGEALKLSSQKMEEGKELIARFC-KGETHECLYDRNKPNHREAWRLFGEYCKGDVTVT 168
               +AL+L  +K   G++LI RF   G+    +   + P     W+ +  Y + DV V 
Sbjct: 121 DGAAKALRLPIEKDPAGQKLIRRFSIPGKDGIRVLPSDDP---VGWQQYISYNRRDVDVE 177

Query: 169 REIFKRL--EPLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLT 226
            ++  RL   P+   E E ++LDQ IND G  +D  LA    ++    R       + LT
Sbjct: 178 VQLASRLARNPMLEAEWETYWLDQRINDTGVRIDTQLAAHAVEVDSRHRDTCLARAQQLT 237

Query: 227 YGLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRS 286
            GL + +  ++ LK WL    G  LE LT+T  +  L +   +T    +V   R   SRS
Sbjct: 238 -GLENPNSPIQ-LKDWLAAH-GCELESLTKTEVEAALET---VTGDVAEVLRLRQDLSRS 291

Query: 287 AVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPR-------PSRS---- 335
           +V K   ++    SD R RG +Q++GA RTGR++G +   QNLPR        +RS    
Sbjct: 292 SVKKYQAMLTVAGSDDRARGLIQYMGAGRTGRFAGRLIQVQNLPRNHMPDLASARSLLNA 351

Query: 336 --HEELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMA 393
              + L+ + + LP ++          S  +R+  I S+  + +VAD + IEARVLAW+A
Sbjct: 352 GNSDALELLYSPLPDTL----------SQLIRTAFIPSKDHRFIVADFSAIEARVLAWLA 401

Query: 394 GEQWKLKAFETGEDLYVTTYARSFNVAPAQ---VTKDQRAIGKVMELALGYQGGAKAFQK 450
           GE+  L+AF  G+DLY  T +R F V P +      + R  GK+  LA GY G   A + 
Sbjct: 402 GEEGTLQAFREGKDLYCQTASRMFGV-PVEKHGANSELRQKGKIAVLACGYGGSVGALKA 460

Query: 451 MAST-TGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKA 509
           M +   GL+ +    LV                                          A
Sbjct: 461 MGALRMGLDESELKPLV-----------------------------------------DA 479

Query: 510 WRQKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLV 569
           WR  +  V + W+++ QA   T+E       R    V  +++      L + LPS R L 
Sbjct: 480 WRDANPMVVQFWHDIEQAAITTVET------RTPTQVGRIHLSYRSGCLFIALPSRRELC 533

Query: 570 Y--RDVGNNR--------SYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATK 619
           Y    +G NR          ++ TTR+     TYGGKLTEN+VQA +RD+L   M +   
Sbjct: 534 YPRPRLGENRFGMTSILFDGVDGTTRKWGPIETYGGKLTENLVQATARDLLTHAMHHVDA 593

Query: 620 AGYDIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           AG+ IV+ +HDEIV + P TD  +   +  LMT  P+WA GLPL A+GYE   Y K
Sbjct: 594 AGHRIVMHIHDEIVVDEP-TDGASVEDIVTLMTRLPTWADGLPLDADGYECGFYMK 648


>gi|296277208|ref|ZP_06859715.1| phage encoded DNA polymerase I [Staphylococcus aureus subsp. aureus
           MR1]
          Length = 631

 Score =  300 bits (767), Expect = 6e-79,   Method: Compositional matrix adjust.
 Identities = 226/668 (33%), Positives = 319/668 (47%), Gaps = 84/668 (12%)

Query: 1   MATLFIDFETRSPIDLTKCGICKY--AEDVCVILFAFGFDDHPVELWDCVHDPVMP---- 54
           M  + ID ET S  D++KCG  KY  AED  +++ A+  D   +   D       P    
Sbjct: 1   MKFMNIDIETYSSNDISKCGAYKYTEAEDFEILIIAYSIDGGAISAIDMTKVDNEPFHAD 60

Query: 55  -QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVG 113
            +  K AL +  V   A N+ FERT L   FN  +P   WICT+V +   GLP++L  VG
Sbjct: 61  YETFKIALFDPAVKKYAFNANFERTCLAKHFNKQMPPEEWICTMVNSMRIGLPASLDKVG 120

Query: 114 EALKLSSQKMEEGKELIARF---CKGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTR 169
           E L+L SQK + GK LI  F   CK         RN P H  E W+ F +YC  DV V  
Sbjct: 121 EVLRLQSQKDKAGKNLIRYFSIPCKPTKVNGGRTRNLPEHDLEKWQQFIDYCIRDVEVEM 180

Query: 170 EIFKRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTY 227
            I  +++  P+++ EQ  W  DQ INDRG  +  +L    N +    + +L ++ + +T 
Sbjct: 181 AIANKIKDFPVTAIEQTYWVFDQHINDRGIKLSKSLMLGANVLDKQSKEELLKQAKHIT- 239

Query: 228 GLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSA 287
           GL  +     +L  WL  E GL + +L + T Q  L   K+ T +A ++   R++ S+++
Sbjct: 240 GL-ENPNSPTQLLAWLKDEQGLDIPNLQKKTVQEYL---KEATGKAKKMLEIRLQMSKTS 295

Query: 288 VLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLP 347
           V K N + + M SD R+RG  QF GA  TGRW+G     QNL +   S  EL+     + 
Sbjct: 296 VKKYNKMHDMMCSDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTELEIARDLIK 354

Query: 348 TSITSDPD------PLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKA 401
                D D      P  ++S  VR+   A EG +L V+D + IEARV+AW A EQW+L  
Sbjct: 355 EQRFDDLDLLLNVHPQDLLSQLVRTTFTAEEGNELAVSDFSAIEARVIAWYAKEQWRLDV 414

Query: 402 FETGEDLYVTTYARSFNVAPAQVTKDQ--RAIGKVMELALGYQGGAKAFQKMAS-TTGLN 458
           F T   +Y  + ++ FNV    +TK    R  GKV ELALGYQGGA A + M +   G+ 
Sbjct: 415 FNTHGKIYEASASQMFNVPVESITKGDPLRQKGKVSELALGYQGGAGALKAMGALEMGIE 474

Query: 459 LNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVS 518
            N    LV +                                         WR  +  + 
Sbjct: 475 ENELQGLVDS-----------------------------------------WRNANPNIV 493

Query: 519 ELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRD--VGNN 576
             W    +A   T+++ K       R     YMK  K  L++ LPSGR+L Y    VG N
Sbjct: 494 NFWKACQEAAINTVKSRKTHHTHGLR----FYMK--KGFLMIELPSGRALAYPKALVGEN 547

Query: 577 R------SYLN-TTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVH 629
                   ++     R+ ++  TYGGKL ENIVQA +RD+LA  +      G+ IV  VH
Sbjct: 548 SWGSQVVEFMGLDLNRKWSKLKTYGGKLVENIVQATARDLLAISIARLEALGFKIVGHVH 607

Query: 630 DEIVCETP 637
           DE++ E P
Sbjct: 608 DEVIVEIP 615


>gi|225573258|ref|ZP_03782013.1| hypothetical protein RUMHYD_01449 [Blautia hydrogenotrophica DSM
           10507]
 gi|225039390|gb|EEG49636.1| hypothetical protein RUMHYD_01449 [Blautia hydrogenotrophica DSM
           10507]
          Length = 645

 Score =  299 bits (766), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 225/715 (31%), Positives = 343/715 (47%), Gaps = 114/715 (15%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAEDVC--VILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M TL ID ET S +DL+KCG+ KYA      V+LF +  D   V + D      +P+ + 
Sbjct: 4   MRTLSIDIETYSDVDLSKCGVYKYASSPAFEVLLFGYTADGGDVRVVDLACGEQIPEEVI 63

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKL 118
            AL +T VT  A N+ FER  L       +    W CT+V + + GLP +L++ G AL L
Sbjct: 64  SALSDTSVTKWAFNAMFERVCLSNFLGEWLEPEGWHCTMVWSATLGLPLSLESAGAALGL 123

Query: 119 SSQKMEEGKELIARFC---KGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTREIFKR 174
             QK+ EGK+LI  FC   +         RN+P H  E W  F  Y   DV    +I KR
Sbjct: 124 EKQKLTEGKDLIRYFCVPCRPTKANGGRTRNRPEHDPEKWERFKAYNLRDVETEMQIQKR 183

Query: 175 LE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSS 232
           L   P+     E ++LDQ INDRG  VD+ L      +    R +L   L+ LT GL  +
Sbjct: 184 LSNFPVPDAIWEEYHLDQEINDRGIGVDMELVRQAIAMDARSREQLTDALQELT-GL-DN 241

Query: 233 SRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQ-VFNNRMRASRSAVLKL 291
              ++++K WL  + GL     T+T  ++V++   +  P+ ++ V + R + ++S+V K 
Sbjct: 242 PNSVQQMKQWL-ADHGLE----TDTLGKKVVAELVRSAPEPLKTVLSLRQQLAKSSVKKY 296

Query: 292 NTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRS-------------HEE 338
             +  A+ +DGR  G  QF GA+RTGR+SG +   QNLP+   S             +E 
Sbjct: 297 AAMENAVCADGRAHGMFQFYGANRTGRFSGRLIQLQNLPQNHMSDLAQARALMRGGNYEA 356

Query: 339 LDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWK 398
           +  +   +P ++          S  +R+  +  +G+K +VAD + IEARV+AW AGE+W+
Sbjct: 357 ISMLYEDIPDTL----------SQLIRTAFVPQDGRKFIVADFSAIEARVIAWFAGERWR 406

Query: 399 LKAFETGEDLYVTTYARSFNVAPAQ--VTKDQRAIGKVMELALGYQGGAKAFQKMASTTG 456
           LK FE G+D+Y  + ++ F+V   +  V    R  GK+ ELALGY G   A + M +   
Sbjct: 407 LKVFEDGDDIYSASASQMFHVPVEKHGVNGHLRQKGKIAELALGYGGSVGALKSMGA--- 463

Query: 457 LNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVK---KAWRQK 513
                                                   L +G A E ++    AWR  
Sbjct: 464 ----------------------------------------LEMGLAEEELQPLVDAWRTS 483

Query: 514 HSRVSELWNELHQAFEQTIENGKAIIARKRRDVPL----VYMKKDKNNLILMLPSGRSLV 569
           +  +++ W ++ +A ++ +          ++ VP+    ++       L + LPSGR L 
Sbjct: 484 NPMITQFWWDVDRAVKECV----------KKRVPMESHGLHFDYRSAMLFITLPSGRRLA 533

Query: 570 YRD--VGNNR------SYLNTT-TRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKA 620
           Y    +G N+      +Y+  +  ++  R  +YG K  ENIVQ  +RDIL   M      
Sbjct: 534 YVKPRIGENQFGRESVTYMGVSGAKKWERLESYGPKFVENIVQGTARDILCYAMRTLRNC 593

Query: 621 GYDIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
              IV  VHDEI+ E       + S +   M   PSWAKGL L+A+GYE + Y+K
Sbjct: 594 A--IVAHVHDEIIIEA--DRRMSLSAVCEQMGRTPSWAKGLKLRADGYECEFYQK 644


>gi|167039879|ref|YP_001662864.1| DNA-directed DNA polymerase [Thermoanaerobacter sp. X514]
 gi|300915307|ref|ZP_07132621.1| DNA-directed DNA polymerase [Thermoanaerobacter sp. X561]
 gi|307724797|ref|YP_003904548.1| DNA-directed DNA polymerase [Thermoanaerobacter sp. X513]
 gi|166854119|gb|ABY92528.1| DNA-directed DNA polymerase [Thermoanaerobacter sp. X514]
 gi|300888583|gb|EFK83731.1| DNA-directed DNA polymerase [Thermoanaerobacter sp. X561]
 gi|307581858|gb|ADN55257.1| DNA-directed DNA polymerase [Thermoanaerobacter sp. X513]
          Length = 644

 Score =  299 bits (765), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 225/700 (32%), Positives = 340/700 (48%), Gaps = 82/700 (11%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M TL ID ET S +DL K G+ +YAE  D  ++LF +  D  PV++ D      +P+ ++
Sbjct: 1   MRTLSIDIETFSSVDLAKSGVYRYAEAPDFEILLFGYSVDAGPVQVVDFACGEKIPKEIQ 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKL 118
           +A+ + +VT  A N+ FER  L   F + +    W CT+V +   GLP +L+        
Sbjct: 61  QAILDNNVTKWAFNAQFERICLSKYFGIHLAPDSWRCTMVWSAYLGLPLSLEGAAIVTGA 120

Query: 119 SSQKMEEGKELIARF---CKGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTREIFKR 174
             +K+ +GKELI  F   CK         RN P H  E W  F  Y   DV V   I ++
Sbjct: 121 DKKKLTKGKELIRYFSVPCKPTVTNGGRTRNLPEHAPEKWNSFKAYNLRDVEVELSIQEK 180

Query: 175 LE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSS 232
           L+  P+  +E   + LDQ INDRG  +D+ L     Q  +  R +L   L+ LT   + +
Sbjct: 181 LQKFPMPEEEWNNYILDQQINDRGIQLDLELVKKAIQCDEKVREELTSRLKELTD--LDN 238

Query: 233 SRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAI-QVFNNRMRASRSAVLKL 291
              + ++K+WL  E GL  + L + + + +L    K  P+ + +V   R   ++S+V K 
Sbjct: 239 PNSVVQMKSWLS-EKGLETDSLDKASVKALL----KEAPEHLSEVLELRQLLAKSSVKKY 293

Query: 292 NTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIIT---HLPT 348
             +  A+ +DGR RG LQF GA+RTGR++G +   QNLP+   S  E  + +    H   
Sbjct: 294 TAMENAVCTDGRARGLLQFYGANRTGRFAGRLIQVQNLPQNHLSDLEQARRLVRGGHFDA 353

Query: 349 -SITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGED 407
             I  D  P  ++S+ +R+  +  +G K +VAD + IEARV+AW+AGE W+ + F T   
Sbjct: 354 LEILYDSIP-GVLSELIRTAFVPKKGYKFIVADFSAIEARVIAWLAGETWRNEVFATHGK 412

Query: 408 LYVTTYARSFNVAPAQVTKDQ--RAIGKVMELALGYQGGAKAFQKMAS-TTGLNLNTFAH 464
           +Y  + ++ F V   +VTK    R  GK+ ELALGY G   A + M +   GL       
Sbjct: 413 IYEASASQMFKVPLEEVTKGSPLRQKGKIAELALGYGGSVGALKAMGALDMGLTEEELKP 472

Query: 465 LVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNEL 524
           LV                                          AWR  +  +  LW ++
Sbjct: 473 LV-----------------------------------------YAWRNANPNIVRLWWDV 491

Query: 525 HQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRD--VGNNR----- 577
            +A ++      A+  R R +   +  +     L++ LPSGR L Y    +G N      
Sbjct: 492 DRAVKE------AVTERCRTETHRIRFEYRSGMLLIWLPSGRQLTYVKPRMGINSFGSEA 545

Query: 578 -SYLNT-TTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCE 635
            +Y     T++  R  +YG K  ENIVQA+SRD+L   M N  ++G +IV+ VHDE+V E
Sbjct: 546 VTYEGVGATKKWERIESYGPKFVENIVQAISRDLLCHSMRNLDESGLNIVMHVHDEVVLE 605

Query: 636 TPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
            P   E     +  LM   P WA GL L+A+G+E   Y+K
Sbjct: 606 VP--LEICVQDVCVLMGQVPPWAHGLLLRADGFECDFYKK 643


>gi|300909464|ref|ZP_07126925.1| DNA-directed DNA polymerase [Lactobacillus reuteri SD2112]
 gi|300893329|gb|EFK86688.1| DNA-directed DNA polymerase [Lactobacillus reuteri SD2112]
          Length = 644

 Score =  298 bits (764), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 222/703 (31%), Positives = 339/703 (48%), Gaps = 88/703 (12%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M  + ID ET S  +L + G+ +YA+  D  ++LF +  D  PV++ D      +P  + 
Sbjct: 1   MKQISIDIETYSSTNLNQTGVYRYADSDDFELLLFGYATDFGPVKVVDLTQGEKIPPQII 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKL 118
           E L+N ++   A N+ FER  L       +    W C+ V + + GLP +L+ +G  L L
Sbjct: 61  EVLDNPNIIKSAFNAQFERVCLSRFVGHRLKPTGWHCSRVWSATLGLPLSLRDIGSVLGL 120

Query: 119 SSQKMEEGKELIARF---CKGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTREIFKR 174
             QK+  GKEL+  F   CK         RN P H  + W+ F +Y + DV V  EI ++
Sbjct: 121 PRQKITAGKELVRYFCTPCKPTKANQNRTRNFPYHAPDKWQQFKQYNQRDVEVEMEITQK 180

Query: 175 LE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSS 232
           LE  P+   E E +++DQ INDRG  +D  L +   +  +V   +  Q  + LT GL + 
Sbjct: 181 LECFPVPQNEWENYWMDQDINDRGIRIDQQLVNNAIKCQNVFHDQYLQTAKELT-GLANP 239

Query: 233 SRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLN 292
           +  L+ LK WL  + G+    L++ +  ++L +    T    QV   R   S+S+V K  
Sbjct: 240 NSPLQ-LKDWL-QQQGIKTNSLSKASVAQLLQTT---TGTVHQVLALRQLLSKSSVKKYQ 294

Query: 293 TLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSH-EELDQIITH-----L 346
            + +AM  DGR+ G LQF GA+RTGRW+G +   QNLPR S    EE  +++       L
Sbjct: 295 AMQKAMCQDGRVHGLLQFYGANRTGRWAGRLVQVQNLPRNSMPDLEEARELVKQGNVPAL 354

Query: 347 PTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGE 406
                S PD   ++S  +R+  I S+     VAD + +EARV+AW++ E+W+ ++F   E
Sbjct: 355 AMLYDSVPD---VLSQLIRTAFIPSKNHHFYVADFSAVEARVIAWLSNEKWRQESFAKNE 411

Query: 407 DLYVTTYARSFNVAPAQ--VTKDQRAIGKVMELALGYQGGAKAFQKMASTT-GLNLNTFA 463
           D+Y  + ++ F V   +  +  + R  GK+ ELALGY G   A + M +T  GL  +   
Sbjct: 412 DIYCASASQMFGVPVVKHGINGELRQKGKIAELALGYGGSIGALKAMGATKLGLTDDELP 471

Query: 464 HLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNE 523
            LV+                                          WR     + + W +
Sbjct: 472 PLVQM-----------------------------------------WRNASPHIVQFWWD 490

Query: 524 LHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRD--VGNNR---- 577
           + +A ++ I   K  + +    +  +Y       + L L SGR L Y    +G NR    
Sbjct: 491 VDKAAKECI---KTHLPQTTHGMKFIYR---SGCMFLRLRSGRYLCYPQPKIGINRFGSE 544

Query: 578 --SYLN-TTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVC 634
             +++   T ++  R  TYG KL ENIVQA SRD+LAE M      G  +V+ +HDE V 
Sbjct: 545 SITFMGINTVKKWDRIETYGAKLVENIVQATSRDLLAEAMRRLEATGNTVVMHIHDEAVI 604

Query: 635 ETPDTDEFNASM--LYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           + P    FN S+  +  LMT  P WA GL L A G+ S  Y+K
Sbjct: 605 DAP----FNRSLDTMVQLMTKVPDWANGLILNAAGFVSDFYKK 643


>gi|300853539|ref|YP_003778523.1| phage related DNA polymerase [Clostridium ljungdahlii DSM 13528]
 gi|300433654|gb|ADK13421.1| phage related DNA polymerase [Clostridium ljungdahlii DSM 13528]
          Length = 649

 Score =  298 bits (763), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 216/720 (30%), Positives = 338/720 (46%), Gaps = 117/720 (16%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M  + ID ET S ++L K G+ +YAE  D  ++LF +  D   V++ D      +P  + 
Sbjct: 1   MKFISIDIETFSSVNLQKSGVYRYAESEDFDILLFGYSVDGGEVKVIDLARGEKIPIEII 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIH----RWICTLVLARSNGLPSALKAVGE 114
            AL +  V   A N+ FER  L     +    +     W CT++ A + GLP +L+ VG 
Sbjct: 61  NALTDDSVIKWAFNAQFERICLSKWLGMKAGTYLSPKSWQCTMIWAATLGLPLSLEGVGA 120

Query: 115 ALKLSSQKMEEGKELIARFC---------KGETHECLYDRNKPNHR-EAWRLFGEYCKGD 164
            L    QK+ +GK LI  FC          G T      RN P+H  E W++F  Y K D
Sbjct: 121 VLGFKKQKLSQGKNLIKYFCIPCSPTKSNGGRT------RNLPHHDIEKWKMFTFYNKRD 174

Query: 165 VTVTREIFKRLE--PLSSKEQELWYLDQTINDRGYCVD---VALAHTLNQIVDVERTKLD 219
           V     I  +L   P+S  E + ++LDQ IND G  +D   V  A + ++    E  K  
Sbjct: 175 VETEMAIQNKLSKFPVSKTEWQNYHLDQIINDGGINLDMDFVRQAISCDEKFKAENIKKA 234

Query: 220 QELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNN 279
           +EL  L      +     +LK WL L+ G+  + L++     +L  +     +A+ +   
Sbjct: 235 KELTGL-----ENPNSPAQLKDWL-LKQGMKTDSLSKAVVSELLQDSDGEIHEALSI--- 285

Query: 280 RMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPR-------- 331
           R + ++S+V K  ++   + SD R RG +QF GA+RTGR+SG +   QNLP+        
Sbjct: 286 RQQLAKSSVKKYTSMENVVCSDSRARGLIQFYGANRTGRYSGRLIQVQNLPQNHLPDLKQ 345

Query: 332 -----PSRSHEELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEA 386
                 S +   LD +   +P+          ++S+ +R+  I   G + +VAD + IEA
Sbjct: 346 ARSLVKSGNFTALDLLYDSIPS----------VLSELIRTAFIPRYGSRFIVADFSAIEA 395

Query: 387 RVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQ--VTKDQRAIGKVMELALGYQGG 444
           RV+AW+AGE+W++  F  G D+Y  + ++ FNV   +  +    R  GK+ ELALGY G 
Sbjct: 396 RVIAWLAGERWRIDVFAGGGDIYCASASQMFNVPVKKNGINGHLRQKGKIAELALGYGGS 455

Query: 445 AKAFQKMASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACE 504
             A + M                                         AI+   +    +
Sbjct: 456 VGALKAMG----------------------------------------AIQMGLVEDELK 475

Query: 505 RVKKAWRQKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPS 564
            +  AWR  +  ++ LW  + +A +  ++  + I      ++  + +      L + LPS
Sbjct: 476 PIVDAWRNSNPNITSLWWRIDRAVKTVVKTKQPI------EIYGIGIFYQSGILFIKLPS 529

Query: 565 GRSLVYRD--VGNNR------SYLNT-TTRQLTREYTYGGKLTENIVQAVSRDILAEGMM 615
           GR L Y    +G NR      +Y     T++  R  +YG K  ENIVQA+SRDILAE M+
Sbjct: 530 GRRLAYVKPLIGENRFGGESVTYEGVGGTKKWERIESYGPKFVENIVQAISRDILAEAML 589

Query: 616 NATKAGYDIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
                 + IV+ VHDE+V E P+    +   +  +M+  P+WAKGL L A+GYE + Y+K
Sbjct: 590 KLATHEFQIVMHVHDEVVIEAPNKVS-SVEEICRIMSETPAWAKGLILNADGYECEFYKK 648


>gi|168179450|ref|ZP_02614114.1| DNA polymerase [Clostridium botulinum NCTC 2916]
 gi|182669649|gb|EDT81625.1| DNA polymerase [Clostridium botulinum NCTC 2916]
          Length = 653

 Score =  298 bits (762), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 235/707 (33%), Positives = 345/707 (48%), Gaps = 87/707 (12%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAEDVC--VILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M TL ID ET   +D+   G  KY E     ++L A+ +DD PV++ D ++   +P+VL+
Sbjct: 1   MRTLAIDVETYCELDIKSVGAYKYCEHPSFEIMLLAYAYDDEPVKIIDIMNGEKIPEVLE 60

Query: 59  EAL--ENTDVTIVAHNSYFERTVLKACF-NLDIPIHRWICTLVLARSNGLPSALKAVGEA 115
             +    + V   A N+ FER  +KA F  L      W CT+V A + GLPS+L  VG+A
Sbjct: 61  FDIYEHYSKVLKTAFNANFERNAIKAHFKGLKCHPGDWECTMVKALTLGLPSSLDMVGKA 120

Query: 116 LKL--SSQKMEEGKELIARFCKG---ETHECLYDRNKPNH-REAWRLFGEYCKGDVTVTR 169
           LK     QKM+EGK LI  FCK            RN P H  E W  F EYCK DV V R
Sbjct: 121 LKFEEDKQKMKEGKALIQYFCKPCKPTKTNGKRTRNLPEHDMEKWETFKEYCKRDVEVER 180

Query: 170 EIFKRLEPLSS--KEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTY 227
           EI   L    +  KE+ELW LDQ INDRG  VD+ L     +  +  + +L +E  +LT 
Sbjct: 181 EIRNLLNRYKTTIKEKELWQLDQHINDRGVRVDLVLVENAIKCDESYQERLKEEAINLT- 239

Query: 228 GLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSA 287
           GL ++     +LK W+    G  +  LT+ +   ++  +K    +  ++   R   ++++
Sbjct: 240 GL-NNPNSPTQLKKWISERVGHEVTSLTKDSIPILIEESKDKNVK--KILELRQLMAKTS 296

Query: 288 VLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSH-EELDQIITH- 345
           + K  T++ A   D R+RG LQF GA+RTGRW+G +   QNLP+      EE   ++ + 
Sbjct: 297 IKKYQTMLNARCDDERVRGLLQFYGANRTGRWAGRLVQVQNLPQNHLPDLEEARNLLRNG 356

Query: 346 ----LPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKA 401
               +     S PD L   S  +R+  I ++G + +VAD + IEARV+A++A EQW+L  
Sbjct: 357 DFETIEFLFDSIPDTL---SQLIRTAFIPTDGNRFIVADFSAIEARVIAYLANEQWRLDV 413

Query: 402 FETGEDLYVTTYARSFNVAPAQ--VTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNL 459
           F+ G D+Y  + ++ F V   +  +    RA GK+ ELALGY G   A +          
Sbjct: 414 FKEGGDIYCASASKMFKVPVEKHGINGHLRAKGKIAELALGYGGAGGAIRAFD------- 466

Query: 460 NTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSE 519
                  KT S P+                     EDL       ++   WR+    +++
Sbjct: 467 -------KTGSIPD---------------------EDL------PKLVSDWRKASPHITQ 492

Query: 520 LWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVY--------- 570
            W  + +A ++ I     +       +  +Y   D   L + LPSGR L Y         
Sbjct: 493 FWWNVDKAAKKAITEKTTVAL--HHGIKFIY---DPGVLFIQLPSGRKLSYLRPKIEEGK 547

Query: 571 --RDVGNNRSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTV 628
              DV      +  T++Q  R  TYG KL ENIVQA +RD LAE M    K G+ +V+ V
Sbjct: 548 FGSDVITYEG-MEQTSKQWKRIETYGPKLVENIVQAFARDCLAETMARVEKKGFKVVMHV 606

Query: 629 HDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           HDE+V +    +  +   +  +   +  WA GLPLKA+GYE   Y K
Sbjct: 607 HDELVLDV-SKEIGSVEEICSIFAESIEWAPGLPLKADGYECNYYMK 652


>gi|256617076|ref|ZP_05473922.1| DNA polymerase I [Enterococcus faecalis ATCC 4200]
 gi|257088361|ref|ZP_05582722.1| DNA polymerase I [Enterococcus faecalis D6]
 gi|256596603|gb|EEU15779.1| DNA polymerase I [Enterococcus faecalis ATCC 4200]
 gi|256996391|gb|EEU83693.1| DNA polymerase I [Enterococcus faecalis D6]
          Length = 645

 Score =  296 bits (757), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 222/709 (31%), Positives = 348/709 (49%), Gaps = 99/709 (13%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M  L ID E+ S  D++KCG  KY+E  D  ++LFA+  D  PVE+ D      +P+ + 
Sbjct: 1   MKHLSIDIESFSSADISKCGAYKYSESSDFEILLFAYSVDGQPVEVVDLAQGETIPEDVI 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLD--IPIHRWICTLVLARSNGLPSALKAVGEAL 116
           ++L +  V   A N+ FER  L     L+  +    W CT+V A + GLP +L  VG  L
Sbjct: 61  KSLSDETVIKHAFNANFERVCLSRFLGLNGFLNPRGWHCTMVWAATLGLPLSLAGVGAVL 120

Query: 117 KLSSQKMEEGKELIARFC---------KGETHECLYDRNKPNHR-EAWRLFGEYCKGDVT 166
            L  QK+ EGK+L+  FC         +G T      RN P H  + WR F  Y   DV 
Sbjct: 121 GLDKQKLSEGKDLVRYFCMPCNATKVNQGRT------RNLPRHSLDKWRDFVAYNIRDVE 174

Query: 167 VTREIFKRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELES 224
           V   I ++L   P++ +  E ++LDQ INDRG  +D+ LA +   + +V + +++++L+ 
Sbjct: 175 VEVAIQQKLSNFPVTQEIWEEYWLDQEINDRGIEIDMILADSAVNLDEVSKNEINEQLKK 234

Query: 225 LTYGLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVL--SSNKKLTPQAIQVFNNRMR 282
           LT GL + +  L+ +++WL  + GL +E L +   + ++  +++ KL     +V   R +
Sbjct: 235 LT-GLENPNSVLQ-MRSWLS-QHGLEVESLGKAAVKELIEQTNDDKLK----EVLLLRQQ 287

Query: 283 ASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSH----EE 338
            ++S+V K   +      D R RG  QF GA+RTGR++G     QNLP+   S      E
Sbjct: 288 LAKSSVRKYQAMQNYACLDNRARGLFQFYGANRTGRFAGRGIQLQNLPQNHMSDLAEARE 347

Query: 339 LDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWK 398
           L +   +   ++  D  P +++S+ +R+  I   G K +V+D + IEARV+AW+AGE+W+
Sbjct: 348 LVRNGEYELLALLYDNVP-EVLSELIRTAFIPKPGMKFIVSDFSAIEARVIAWLAGEKWR 406

Query: 399 LKAFETGEDLYVTTYARSFNVAPAQ--VTKDQRAIGKVMELALGYQGGAKAFQKMAS-TT 455
            + F  G D+Y  + ++ F V   +  V    R  GK+ ELALGY G   A   M +   
Sbjct: 407 KEVFRNGGDIYCASASQMFGVPVEKHGVNGHLRQKGKIAELALGYGGSVGALTAMGALNM 466

Query: 456 GLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHS 515
           GL  +    LV +                                         WR+ + 
Sbjct: 467 GLTEDELQPLVAS-----------------------------------------WRETNP 485

Query: 516 RVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRD--V 573
            +++LW ++  A +  +  G       + +   +  +     + + L SGR L Y    +
Sbjct: 486 AITKLWWDIDSAAKGCVSVG------AKTETHGITFEYKSGFMFIQLLSGRRLAYVKPRI 539

Query: 574 GNNR------SYLNT-TTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVL 626
           G NR      +Y    TT++  R  +YG K  ENIVQA++RDIL   M N     Y IV 
Sbjct: 540 GQNRFGGAAVTYEGVGTTKKWERLESYGPKFVENIVQAMARDILCFAMQNLKD--YRIVG 597

Query: 627 TVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
            VHDE++ E P   E     +  +M+  P+WAKGL L A+GYE   Y+K
Sbjct: 598 HVHDEVIIEVP--KEVTVEEVNSIMSQTPNWAKGLLLNADGYECDFYQK 644


>gi|153955279|ref|YP_001396044.1| Phage-related DNA polymerase [Clostridium kluyveri DSM 555]
 gi|219855702|ref|YP_002472824.1| hypothetical protein CKR_2359 [Clostridium kluyveri NBRC 12016]
 gi|146348137|gb|EDK34673.1| Phage-related DNA polymerase [Clostridium kluyveri DSM 555]
 gi|219569426|dbj|BAH07410.1| hypothetical protein [Clostridium kluyveri NBRC 12016]
          Length = 644

 Score =  295 bits (754), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 217/701 (30%), Positives = 332/701 (47%), Gaps = 84/701 (11%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M ++ ID ET S  +L KCG+ +YAE  D  ++LF +  D   V++ D      +P  + 
Sbjct: 1   MNSISIDIETFSSANLQKCGVYRYAESDDFEILLFGYSVDGGAVQVVDLACGEKIPNEII 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLD--IPIHRWICTLVLARSNGLPSALKAVGEAL 116
            AL +  VT  A N+ FER  L    NL   +    W C++V +   GLP +L+ VG  L
Sbjct: 61  NALMDNSVTKWAFNAMFERVCLSKWLNLTDYLDPTSWKCSMVWSAYMGLPLSLEGVGAVL 120

Query: 117 KLSSQKMEEGKELIARFC---KGETHECLYDRNKPNH-REAWRLFGEYCKGDVTVTREIF 172
            L  QK+ EGK+LI  FC             RN P H  + W  F  Y   DV     I 
Sbjct: 121 GLEKQKLTEGKDLIKYFCTPCSPTKSNGGRVRNLPKHDMDKWERFKAYNIRDVEAEMSIQ 180

Query: 173 KRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLV 230
           +RL   P+       ++LDQ INDRG  +D+A      ++ +  R KL   ++ +T   +
Sbjct: 181 QRLSKFPIPENIWSEYHLDQKINDRGIAIDMAFVKQAVKMDEQSREKLMALMQDITN--L 238

Query: 231 SSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAI-QVFNNRMRASRSAVL 289
            +   ++++K WL  + GL  + L +     +L    K  P+ +  V   R + ++S++ 
Sbjct: 239 ENPNSIQQMKEWL-ADNGLETDSLGKKAVAEML----KTAPEPLGTVLELRQQLAKSSIK 293

Query: 290 KLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPT- 348
           K   +  A+ +DGR RG  QF GA+RTGR+SG +   QNLP+      E  + +      
Sbjct: 294 KYTAMENAVCNDGRARGMFQFYGANRTGRFSGRLIQLQNLPQNHMPDLEQARALVRSGNF 353

Query: 349 ---SITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETG 405
              ++  D  P +++S+ +R+  +  EG K +VAD + IEARV+AW+AGE+W++  F+ G
Sbjct: 354 DALTLIYDSIP-EVLSELIRTAFVPQEGMKFIVADFSAIEARVIAWLAGEKWRIDVFQNG 412

Query: 406 EDLYVTTYARSFNVAPAQ--VTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFA 463
            D+Y  + ++ FNV   +  V    R  GK+ ELALGY G   A + M +          
Sbjct: 413 GDIYCASASQMFNVPVEKNGVNGHLRQKGKIAELALGYGGSVGALKSMGAL--------- 463

Query: 464 HLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNE 523
                                      E  IE+       + +  AWRQ +  +++LW +
Sbjct: 464 ---------------------------EMGIEE----EELQPLVTAWRQSNPNITKLWWD 492

Query: 524 LHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDV--------GN 575
           +  A +  +   K  I  +   +  +Y       L ++LPSGR L Y           G 
Sbjct: 493 VDHAVKTCV---KQKIPTETHGIKFIY---QSGMLFIVLPSGRRLSYVKPRMGENVFGGE 546

Query: 576 NRSYLNT-TTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVC 634
           + +Y     T++  R  +YG K  ENIVQA+SRDIL   M   T     IV  VHDEI+ 
Sbjct: 547 SVTYEGVGGTKKWERIESYGPKFVENIVQAISRDILCHAMQ--TLKNCSIVAHVHDEIII 604

Query: 635 ETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           E       + S +   M   P+WA GL L A+GYE + Y+K
Sbjct: 605 EA--DMRMSLSTICEQMARTPTWANGLLLSADGYECQFYQK 643


>gi|256847832|ref|ZP_05553277.1| DNA polymerase I [Lactobacillus coleohominis 101-4-CHN]
 gi|256715521|gb|EEU30497.1| DNA polymerase I [Lactobacillus coleohominis 101-4-CHN]
          Length = 644

 Score =  295 bits (754), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 223/702 (31%), Positives = 343/702 (48%), Gaps = 86/702 (12%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVH-DPVMPQVL 57
           M  L ID ET S  +L + G+ +YA+  D  ++LF +  D  PV++ D    + + PQV+
Sbjct: 1   MKQLSIDIETYSNTNLNQTGVYRYADSKDFELLLFGYAIDFGPVKVIDLTQGESIPPQVI 60

Query: 58  KEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALK 117
           K AL++  +   A N+ FER  L    +  +    W C+ V + + GLP +L+ VG  L 
Sbjct: 61  K-ALDDPTIIKSAFNAQFERVCLSRFVSHRLKPAGWHCSRVWSATLGLPLSLRDVGTVLG 119

Query: 118 LSSQKMEEGKELIARF---CKGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTREIFK 173
           L  QK+  GKEL+  F   CK         RN P H  + W+ F +Y + DV V  EI +
Sbjct: 120 LPRQKITAGKELVRYFCTPCKPTKANQNRTRNFPYHAPDKWQQFKQYNQRDVEVEMEITQ 179

Query: 174 RLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVS 231
           +LE  P+   E E +++DQ INDRG  +D  L +   +  +V   +  Q  + LT GL +
Sbjct: 180 KLECFPVPQNEWENYWMDQDINDRGIRIDQQLVNNAIKCQNVFHDQYLQTAKKLT-GLAN 238

Query: 232 SSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKL 291
            +  L+ LK WL  + G+  + L++ +  ++L +    T    QV   R   S+S++ K 
Sbjct: 239 PNSPLQ-LKDWLH-QQGIKTDSLSKASVAQLLQTT---TGTVHQVLALRQLLSKSSIKKY 293

Query: 292 NTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSH-EELDQIITH----- 345
             + +AM  DGR+ G LQF GA+RTGRW+G +   QNLPR S    EE  +++       
Sbjct: 294 QAMQKAMCQDGRVHGLLQFYGANRTGRWAGRLVQVQNLPRNSMPDLEEARELVKQGNVPA 353

Query: 346 LPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETG 405
           L     S PD   ++S  +R+  I S+     VAD + +EARV+AW++ E+W+ ++F   
Sbjct: 354 LAMLYDSVPD---VLSQLIRTAFIPSKNHHFYVADFSAVEARVIAWLSNEKWRQESFAKN 410

Query: 406 EDLYVTTYARSFNVAPAQ--VTKDQRAIGKVMELALGYQGGAKAFQKMASTT-GLNLNTF 462
           ED+Y  + ++ F V   +  +  + R  GK+ ELALGY G   A + M +T  GL  +  
Sbjct: 411 EDIYCASASQMFGVPVVKHGINGELRQKGKIAELALGYGGSIGALKAMGATNLGLTDDEL 470

Query: 463 AHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWN 522
             LV+                                          WR     + + W 
Sbjct: 471 PPLVQM-----------------------------------------WRNASPHIVQFWW 489

Query: 523 ELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRD--VGNNR--- 577
           ++ +A ++ I   K  + +    +  +Y       + L L SGR L Y    +G NR   
Sbjct: 490 DVDKAAKECI---KTHLPQTTHGMKFIYR---SGCMFLRLRSGRYLCYPQPKIGINRFGS 543

Query: 578 ---SYL-NTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIV 633
              +++ N T ++  R  TYG KL ENIVQA SRD+LA  M     AG  +V+ +HDE V
Sbjct: 544 ESITFMGNNTVKKWDRIETYGAKLVENIVQATSRDLLAGAMRRLETAGNPVVMHIHDEAV 603

Query: 634 CETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
            + P TD  +   +  +MT  P WA GL L A G+    Y+K
Sbjct: 604 IDAP-TDR-SLDTIVKIMTEVPDWADGLILNAAGFVGGFYKK 643


>gi|300764694|ref|ZP_07074685.1| hypothetical protein LMHG_11074 [Listeria monocytogenes FSL N1-017]
 gi|300514580|gb|EFK41636.1| hypothetical protein LMHG_11074 [Listeria monocytogenes FSL N1-017]
          Length = 645

 Score =  295 bits (754), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 229/717 (31%), Positives = 336/717 (46%), Gaps = 115/717 (16%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M  L +D ET S +DL+KCG+ KY+E  D  ++LFA+  D  PVE+ D   D  +P  + 
Sbjct: 1   MKHLSLDLETYSSVDLSKCGVYKYSESPDFEILLFAYSVDGGPVEVVDLKMDETIPAEIL 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLD--IPIHRWICTLVLARSNGLPSALKAVGEAL 116
            +L +  V   A N+ FER  L     LD  +    W CT+V   + GLP +L  VG  L
Sbjct: 61  TSLSDETVIKHAFNASFERVCLSRFLGLDGFLNPRGWQCTMVWGATLGLPLSLVGVGAVL 120

Query: 117 KLSSQKMEEGKELIARFC---------KGETHECLYDRNKPNHREA-WRLFGEYCKGDVT 166
            L  QK+ EGK+LI  FC          G T      RN P+H    W  F  Y   DV 
Sbjct: 121 GLDKQKLTEGKDLIRYFCVPCNPTKVNGGRT------RNLPHHAPTKWSAFKTYNSRDVE 174

Query: 167 VTREIFKRLEP---LSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELE 223
           V   I  +L     L S  +E W LDQ INDRG  +D        Q+ ++ +  L+Q+L+
Sbjct: 175 VEIAIQGKLSNFPVLDSVWKEYW-LDQEINDRGIEIDKDFVEAAVQLDELSKAGLNQQLQ 233

Query: 224 SLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRA 283
            LT GL + +  L+ ++ WL L+ GL  E L +     +L   + +     QV   R + 
Sbjct: 234 ELT-GLENPNSVLQ-MRGWL-LDHGLETESLGKKAVAELLE--QPIDENLKQVLVLRQQL 288

Query: 284 SRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRS-------- 335
           ++S+V K   +     SD R RG  QF GA+RTGR++G     QNLP+   S        
Sbjct: 289 AKSSVKKYQAMQNFACSDNRSRGLFQFYGANRTGRFAGRGIQLQNLPQNHMSDLSEARSL 348

Query: 336 -----HEELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLA 390
                 E L+ +  ++P           ++S+ +R+  +  EG K +V+D + IEARV+A
Sbjct: 349 VKQSNFEMLNILYGNVPN----------VLSELLRTAFVPREGMKFIVSDFSAIEARVIA 398

Query: 391 WMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQ--VTKDQRAIGKVMELALGYQGGAKAF 448
           W++GE+W+ + F+ G D+Y  + ++ F V   +  V    R  GK+ ELALGY G   A 
Sbjct: 399 WLSGEKWRQEVFKNGGDIYCASASQMFGVPVEKHGVNGHLRQKGKIAELALGYGGSVGAL 458

Query: 449 QKM-ASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVK 507
           + M A   GL  +    LV +                                       
Sbjct: 459 KAMDALEMGLTEDELQPLVNS--------------------------------------- 479

Query: 508 KAWRQKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRS 567
             WR  +  ++ELW  + +A +  ++       R+      +  +     L + L SGR 
Sbjct: 480 --WRDSNINITELWWAVDKAVKTCVKE------RRSTSTHGIKFEYKSGFLFIQLLSGRK 531

Query: 568 LVY--RDVGNNR------SYLNT-TTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNAT 618
           LVY    +G N+      +Y     T++  R  +YG K  ENIVQA++RDIL   M N  
Sbjct: 532 LVYVKPKIGENKFGGEAVTYEGVGATKKWERLESYGPKFVENIVQAIARDILCFAMENLR 591

Query: 619 KAGYDIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           K  Y IV  VHDE++ E P   E     +  LM+  P WA+GL L A+GYE + Y+K
Sbjct: 592 K--YRIVGHVHDEVIIEVP--MESKVEDICQLMSQTPKWAEGLLLNADGYECEFYQK 644


>gi|297583086|ref|YP_003698866.1| DNA-directed DNA polymerase [Bacillus selenitireducens MLS10]
 gi|297141543|gb|ADH98300.1| DNA-directed DNA polymerase [Bacillus selenitireducens MLS10]
          Length = 644

 Score =  295 bits (754), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 219/710 (30%), Positives = 323/710 (45%), Gaps = 102/710 (14%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M TL ID E+ S  DL K G+ +YAE  D  ++LFA+  D  PV + D      +P V++
Sbjct: 1   MKTLNIDIESYSRTDLAKSGVYRYAEAPDFDILLFAYSVDAGPVHVVDLAQGETIPDVVR 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKL 118
           +AL +  V   A N+ FERT L    N  I    W C++V +   GLP +L+        
Sbjct: 61  QALTDDGVIKWAFNAQFERTCLSRYLNTPIHPTSWRCSMVWSAYLGLPLSLEGAAIVTGA 120

Query: 119 SSQKMEEGKELIARFCKGETHECL---YDRNKPNHR-EAWRLFGEYCKGDVTVTREIFKR 174
             +K++EGK+LI  FCK      +    +RN P+H  E W  F  Y + DV   + I  +
Sbjct: 121 DKKKLQEGKDLIRYFCKPCKPTQVNGGRERNFPHHDPEKWVAFKRYNQRDVETEQAIQDK 180

Query: 175 LE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSS 232
           +   P+  +E   + LDQ INDRG  +D              R  L   L +LT   + +
Sbjct: 181 ISRYPVPEQEWGHYVLDQIINDRGILLDPVFVEAAIACDTATREALMNRLRTLTK--LEN 238

Query: 233 SRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLN 292
              + ++K WL  E G+    L +     +L S +       +V   R + ++S+V K  
Sbjct: 239 PNSVMQMKDWL-AEQGVETGALDKAAVHELLKSAQG---DVAEVLTIRQKLAKSSVKKYT 294

Query: 293 TLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRP-------------SRSHEEL 339
            + +    D R RG +QF GA+R+GR++G +   QNLP+              + + E L
Sbjct: 295 AMKQVAGKDDRARGLIQFYGANRSGRYAGRLIQVQNLPQNHVPDLKEARDLVRASNLEAL 354

Query: 340 DQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKL 399
           D +   +P           ++S+ +R+  I  E  + +VAD + IEARV+AW+AGE W+ 
Sbjct: 355 DMLYPSVP----------DLLSELIRTAFIPKEHHQFIVADFSAIEARVIAWLAGEAWRN 404

Query: 400 KAFETGEDLYVTTYARSFNVAPAQVTKDQ--RAIGKVMELALGYQGGAKAFQKMASTTGL 457
           + F T   +Y  + ++ FNV   ++ K    R  GK+ ELALGY G   A + M +    
Sbjct: 405 EVFATHGKIYEASASQMFNVPLEEIDKGSPLRQKGKISELALGYGGSVGALRAMGA---- 460

Query: 458 NLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVK---KAWRQKH 514
                                                  L +G   E +K   +AWRQ +
Sbjct: 461 ---------------------------------------LDMGVEEEELKPLVQAWRQAN 481

Query: 515 SRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVY---- 570
            ++ + W  + QA +      KA+  R       +        L++ LPSGR L Y    
Sbjct: 482 PKIVQFWWAVDQAAQ------KAVKQRTTTSTHGISFTYQSGLLLVGLPSGRHLSYVKPT 535

Query: 571 ---RDVGNNRSYLN--TTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIV 625
               D G           T++  R  TYG KL ENIVQAVSRD+LA  M    + GY IV
Sbjct: 536 IVLNDFGREGLCFEGIGATKKWERIDTYGPKLVENIVQAVSRDLLAHAMQRIEQEGYAIV 595

Query: 626 LTVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           + VHDE+V E         S +  LMT  P W+ GL LKAEGY    Y+K
Sbjct: 596 MHVHDEVVVEA--KQHVTVSDICALMTDQPDWSSGLNLKAEGYACMFYQK 643


>gi|306826828|ref|ZP_07460129.1| DNA-directed DNA polymerase [Streptococcus pyogenes ATCC 10782]
 gi|304430991|gb|EFM33999.1| DNA-directed DNA polymerase [Streptococcus pyogenes ATCC 10782]
          Length = 643

 Score =  294 bits (753), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 225/702 (32%), Positives = 335/702 (47%), Gaps = 96/702 (13%)

Query: 6   IDFETRSPIDLTKCGICKYA--EDVCVILFAFGFDDHPVELWDCVHDPVMPQVLKEALEN 63
           +D ET S  D+ K G+ KYA  ED  ++  ++  +   V L D   +   P+ LK  + N
Sbjct: 5   LDLETYSSNDI-KNGVYKYADAEDFDILFMSYSINFGDVVLVDLTKEE-FPEFLKNHILN 62

Query: 64  TDVTIVAHNSYFERTVLKACFNLD------IPIHRWICTLVLARSNGLPSALKAVGEALK 117
            D T  A N+ FER  L   F              W   +V A+  GLP++L+     L 
Sbjct: 63  ADATFWAWNTVFERICLSMYFQKKGWSKGYFDPKNWKDIMVHAQELGLPASLERCASYLG 122

Query: 118 LSSQKMEEGKELIARF---CKGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTREIFK 173
           L  QK   GK LI  F   CK         RN P H  E W  +GEY   DV     I +
Sbjct: 123 LEEQKDTRGKALIRYFSIPCKPTKANGGRTRNLPEHDPEKWEEYGEYNVQDVVTQMAIAE 182

Query: 174 RLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVS 231
           +LE  P+  +E + +  DQ INDRG  +D  L  +     DV+   L  EL+++T     
Sbjct: 183 KLESVPVHDREWDHYACDQRINDRGVALDKELVASALYCKDVKMESLSGELKAITGLANP 242

Query: 232 SSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKL 291
           +SR   +L  WL  E G     LT+   ++ L + +    + +++   +++ + S++ K 
Sbjct: 243 NSRA--QLLPWL-KEHGYSANGLTKADVEQELKTAEGELKRVLEL---KLQTAMSSLKKY 296

Query: 292 NTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSIT 351
             +  AM SDGR+ G LQF GASRTGRW+G V   QNL R     ++LD    ++     
Sbjct: 297 EAMERAMCSDGRVHGLLQFYGASRTGRWAGRVVQVQNLAR--NYIKDLDDARGYVKKR-- 352

Query: 352 SDPDPLQIISDC--------VRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFE 403
            D D ++I+ D         VR+ ++A +G    V+D + IEARV+AW AGEQW+L  F 
Sbjct: 353 -DIDAVEILYDSLNDTLKQLVRTALVAKDGCTFYVSDFSAIEARVIAWFAGEQWRLDVFS 411

Query: 404 TGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFA 463
           T   +Y  + ++ F +   ++ K+ R  GK+ ELALGYQGG  A ++M +   LN+    
Sbjct: 412 THGKIYEASASQMFGIPIEEIDKELRQKGKISELALGYQGGPGALKQMGA---LNMG--- 465

Query: 464 HLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNE 523
                                ++E   +  ++D             WR+ + ++ + W +
Sbjct: 466 ---------------------VKEEELQGLVDD-------------WRRANKKIVQFWKD 491

Query: 524 LHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYR-------DVGNN 576
           + +A  + I++   I   K R       +  K  L + LPSGR+L Y        D G+ 
Sbjct: 492 VQRAAIKAIKSRAPIKLGKLR------FRYRKGFLFITLPSGRNLAYARAKVEPGDYGDK 545

Query: 577 RSYLNTTTRQ-LTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCE 635
             Y     +   T + TYGGKL ENIVQA +RDILAE ++    AG+ +V  VHDE + E
Sbjct: 546 IIYEGQGDKAYFTAQETYGGKLVENIVQATARDILAEALLRIEAAGHGVVFHVHDEAIIE 605

Query: 636 TPD--TDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
                 +E N      LM   P WA+GLPL +EGY +K Y K
Sbjct: 606 GSGLTIEEVN-----DLMAQAPDWAEGLPLNSEGYVTKYYMK 642


>gi|332983347|ref|YP_004464788.1| DNA-directed DNA polymerase [Mahella australiensis 50-1 BON]
 gi|332701025|gb|AEE97966.1| DNA-directed DNA polymerase [Mahella australiensis 50-1 BON]
          Length = 657

 Score =  294 bits (752), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 224/717 (31%), Positives = 335/717 (46%), Gaps = 103/717 (14%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M  LFID ET S  DL K G+ +Y+E  D  V+LF +  DD  V + D      +P  + 
Sbjct: 1   MRELFIDIETYSGTDLGKSGVYRYSEAPDFEVLLFGYCADDDEVRVIDLASGEALPTEVL 60

Query: 59  EALENTDVTIVAHNSYFERTVL-----KACFNLD--------IPIHRWICTLVLARSNGL 105
           +AL +  V   AHN+ FER  L     +   NL         +    W CT+V +   GL
Sbjct: 61  DALTDETVVKWAHNAQFERVCLSRWLERQGINLKALNGNSNFLNPASWRCTMVWSAYLGL 120

Query: 106 PSALKAVGEALKLSSQKMEEGKELIARF---CKGETHECLYDRNKPNHR-EAWRLFGEYC 161
           P +L+          QK+ EGKELI  F   CK         RN P H  + W  + EY 
Sbjct: 121 PLSLEGAALVTGAEKQKLTEGKELIRYFSSPCKPTKSNGGRTRNLPVHAPDKWEKYKEYN 180

Query: 162 KGDVTVTREIFKRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLD 219
             DV     I KRL   P+   E + + LDQ INDRG C+D+ L     +     RT L 
Sbjct: 181 ARDVETEMAIMKRLSKFPVPEDEWKYYILDQEINDRGICLDMDLIREAIRCDRRSRTVLT 240

Query: 220 QELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAI-QVFN 278
           + +  +T   + +   + ++K W F E GL  E L +   + +L    K  P++  +V  
Sbjct: 241 EAVRDITD--LDNPNSVAQMKAW-FAENGLETETLGKAAVKELL----KTAPESFREVLA 293

Query: 279 NRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEE 338
            R   ++S+V K   +  A+ SDGR+RG LQF GA+RTGR++G +   QNLP        
Sbjct: 294 LRQDLAKSSVKKYTAMENAVCSDGRVRGLLQFYGANRTGRFAGRLIQVQNLP-----QNH 348

Query: 339 LDQIITHLPTSITSDPDPLQIISDCV--------RSCVIASEGKKLVVADLAGIEARVLA 390
           L  ++       + D D L+I+ D V        R+  +   G K +VAD + IEARV+A
Sbjct: 349 LPDLVQARQLVKSGDFDALEILYDSVPGVLSELIRTAFVPMPGYKFIVADFSAIEARVIA 408

Query: 391 WMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQ--RAIGKVMELALGYQGGAKAF 448
           W+AGEQW+ + F +   +Y  + ++ F V   ++TK    R  GK+ ELALGY G   A 
Sbjct: 409 WLAGEQWRNEVFASHGKIYEASASQMFRVPIEEITKGSPLRQKGKIAELALGYGGSVGAL 468

Query: 449 QKMAS-TTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVK 507
           + M +   GL  +    LV                                         
Sbjct: 469 KAMGALDMGLAEDELQPLV----------------------------------------- 487

Query: 508 KAWRQKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRS 567
            AWR  +  ++ LW ++ +A +  +   +   A +  ++   Y       L + LPSGR 
Sbjct: 488 TAWRAANPNITRLWWDVDRAAKTAV---REKTAEQTHNILFEYR---SGFLFITLPSGRK 541

Query: 568 LVYRD--VGNNRSYLNTTT-------RQLTREYTYGGKLTENIVQAVSRDILAEGMMNAT 618
           L Y    +  NR   ++ T       ++  R  +YG K  ENIVQA+SRDIL   M   +
Sbjct: 542 LAYVKPRIEANRFGSDSITYEGVGASKKWERIESYGPKFVENIVQAISRDILCYAMQRLS 601

Query: 619 KAGYDIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
             G+ IV+ +HDE+V ET  + + +  ++  +M+  P WA+GL L A+G+E + Y+K
Sbjct: 602 SMGFSIVMHIHDEVVIET--SCDVSPEIVCRIMSETPPWAEGLFLCADGFECQFYKK 656


>gi|227530261|ref|ZP_03960310.1| DNA-directed DNA polymerase [Lactobacillus vaginalis ATCC 49540]
 gi|227349815|gb|EEJ40106.1| DNA-directed DNA polymerase [Lactobacillus vaginalis ATCC 49540]
          Length = 644

 Score =  292 bits (748), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 220/702 (31%), Positives = 339/702 (48%), Gaps = 86/702 (12%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVH-DPVMPQVL 57
           M  + ID ET S  +L + G+ +YA+  D  ++LF +  D  PV++ D    + + PQV+
Sbjct: 1   MKQISIDIETYSSTNLNQTGVYRYADSKDFELLLFGYAIDFGPVKVIDLTQGESIPPQVI 60

Query: 58  KEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALK 117
           K AL++  +   A N+ FER  L    +  +    W C+ V + + GLP +L+ VG  L 
Sbjct: 61  K-ALDDPTIIKSAFNAQFERVCLSRFVSHRLKPAGWHCSRVWSATLGLPLSLRDVGSVLG 119

Query: 118 LSSQKMEEGKELIARF---CKGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTREIFK 173
           L  QK+  GKEL+  F   CK         RN P H  + W+ F +Y + DV V  EI +
Sbjct: 120 LPRQKITAGKELVRYFCTPCKPTKANQNRTRNFPYHAPDKWQQFKQYNQRDVEVEMEITQ 179

Query: 174 RLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVS 231
           +LE  P+   E E +++DQ INDRG  +D  L +   +  +V   +  Q  + LT GL +
Sbjct: 180 KLECFPVPQNEWENYWMDQDINDRGIRIDQQLVNNAIKCQNVFHDQYLQTAKELT-GLAN 238

Query: 232 SSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKL 291
            +  L+ LK WL  +  +    L++ +  ++L +    T    QV   R   S+S++ K 
Sbjct: 239 PNSPLQ-LKDWL-QQQDIKTNSLSKASVAQLLQTT---TGTVHQVLALRQLLSKSSIKKY 293

Query: 292 NTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSH-EELDQIITH----- 345
             + +AM  DGR+ G LQF GA+RTGRW+G +   QNLPR S    EE  +++       
Sbjct: 294 QAMQKAMCQDGRVHGLLQFYGANRTGRWAGRLVQVQNLPRNSMPDLEEARELVKQGNVPA 353

Query: 346 LPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETG 405
           L     S PD   ++S  +R+  I S+     VAD + +EARV+AW++ E+W+ ++F   
Sbjct: 354 LAMLYDSVPD---VLSQLIRTAFIPSKNHHFYVADFSAVEARVIAWLSNEKWRQESFAKN 410

Query: 406 EDLYVTTYARSFNVAPAQ--VTKDQRAIGKVMELALGYQGGAKAFQKMASTT-GLNLNTF 462
           ED+Y  + ++ F V   +  +  + R  GK+ ELALGY G   A + M +T  GL  +  
Sbjct: 411 EDIYCASASQMFGVPVVKHGINGELRQKGKIAELALGYGGSIGALKAMGATNLGLTDDEL 470

Query: 463 AHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWN 522
             LV+                                          WR     + + W 
Sbjct: 471 PPLVQM-----------------------------------------WRNASPHIVQFWW 489

Query: 523 ELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRD--VGNNR--- 577
           ++ +A ++ I   K  + +    +  +Y       + L L SGR L Y    +G NR   
Sbjct: 490 DVDKAAKECI---KTHLPQTTHGMKFIYR---SGCMFLRLRSGRYLCYPQPKIGINRFGS 543

Query: 578 ---SYL-NTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIV 633
              +++ N T ++  R  TYG KL ENIVQA SRD+LAE M         +V+ +HDE V
Sbjct: 544 ESITFMGNNTVKKWDRIETYGAKLVENIVQATSRDLLAEAMRRLEATENTVVMHIHDEAV 603

Query: 634 CETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
            + P     +   +  LMT  P WA GL L A G+ S  Y+K
Sbjct: 604 IDAPSNRSLDT--MVQLMTEVPDWANGLILNAAGFVSDFYKK 643


>gi|313895585|ref|ZP_07829141.1| DNA-directed DNA polymerase [Selenomonas sp. oral taxon 137 str.
           F0430]
 gi|312975711|gb|EFR41170.1| DNA-directed DNA polymerase [Selenomonas sp. oral taxon 137 str.
           F0430]
          Length = 645

 Score =  291 bits (745), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 228/706 (32%), Positives = 331/706 (46%), Gaps = 93/706 (13%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M ++ ID ET S + L K G+ KYAE  D  ++LF +  D   V++ D  +   +P+ + 
Sbjct: 1   MKSISIDVETFSSVPLAKAGVYKYAESEDFEILLFGYSVDGGEVQVVDLANGEEIPKEIL 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKL 118
            AL +  VT  A N+ FER  L     + +  + W C+++ A + GLP +LK VG  L L
Sbjct: 61  AALTDETVTKWAFNAMFERVCLSRHLGIHLKPNAWRCSMIWAATLGLPLSLKDVGAVLWL 120

Query: 119 SSQKMEEGKELIARF---CKGETHECLYDRNKP-NHREAWRLFGEYCKGDVTVTREIFKR 174
             QK+EEGK+LI  F   CK         RN P +  E W+LF EY K DV     I  R
Sbjct: 121 DRQKLEEGKDLIRYFCVPCKATRSNGGRTRNLPADAPEKWKLFTEYNKRDVETEMAIQAR 180

Query: 175 LE--PLSSKEQELWYLDQTINDRGYCVDVALAHTL------NQIVDVERTKLDQELESLT 226
           L+  P+   E E + +DQ INDRG  VD             ++ V +ER +   +LE+  
Sbjct: 181 LKKFPVPESEWENYVIDQEINDRGILVDTTFVTQAICCDERSKAVCLERAQNLTDLENPN 240

Query: 227 YGLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRS 286
             L        +L  WL    GL +E L ++   ++L   K  T    +V   R + S++
Sbjct: 241 SPL--------QLMDWLH-GKGLSVESLAKSEVTKML---KTATGDVREVLELRQQLSKT 288

Query: 287 AVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHL 346
           +V K   +     +D R RG  QF GA+RTGR++G +   QNLP+   +  +L ++ T +
Sbjct: 289 SVKKYMAMEAVTGADHRARGLFQFYGANRTGRFAGRLIQLQNLPQNHLA--QLKEVRTLV 346

Query: 347 PTSITSDPDPL-----QIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKA 401
                   D L      ++S  +R+  +     + VVAD A IEARVLAW+AGEQW L  
Sbjct: 347 KDGDFELLDMLYDSTSDVLSQLIRTSFVPHPACRFVVADYAAIEARVLAWLAGEQWVLDV 406

Query: 402 FETGEDLYVTTYARSFN--VAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMAST-TGLN 458
           F    D+Y  T +R F+  V       D R  GK   L+ GY G   A   M +  +G+ 
Sbjct: 407 FREHGDIYCETASRMFHCKVEKHGENADLRQKGKQAVLSCGYGGSVGALVAMGAVESGMK 466

Query: 459 LNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVS 518
                 LV                             DL            WR  +  + 
Sbjct: 467 EEELQPLV-----------------------------DL------------WRASNPHIV 485

Query: 519 ELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRD--VGNN 576
           + W ++ +A +  +   K  +  +   +  VY       L + LPSGR L Y    +G N
Sbjct: 486 QFWWDVDRAVKTCV---KRRVEVETHGIRCVY---KSGVLFIRLPSGRELAYAKPRIGEN 539

Query: 577 RSYLNTTTRQ---LTREY----TYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVH 629
           R    + T +   +T+++    T+GGKL ENI Q  +RD+L   M      G+DIV+ VH
Sbjct: 540 RFGGESVTYEGLGMTKKWERIETFGGKLVENITQGTARDLLVFAMKQLRNRGFDIVMHVH 599

Query: 630 DEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           DEIV E P     +   +  +M  NP WAKGLPLKA+GYE + YRK
Sbjct: 600 DEIVLEVP-YGVSSVEEICSIMAENPPWAKGLPLKADGYECEFYRK 644


>gi|167757895|ref|ZP_02430022.1| hypothetical protein CLOSCI_00226 [Clostridium scindens ATCC 35704]
 gi|167664549|gb|EDS08679.1| hypothetical protein CLOSCI_00226 [Clostridium scindens ATCC 35704]
          Length = 645

 Score =  290 bits (743), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 223/713 (31%), Positives = 335/713 (46%), Gaps = 110/713 (15%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAEDVC--VILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M TL ID ET S +DL+KCG+ KYA      V+LF +  D   V + D      +P+   
Sbjct: 4   MRTLSIDIETYSDVDLSKCGVYKYASSPAFEVLLFGYAADGGDVHVVDLACGEQIPEEAI 63

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKL 118
            AL +T VT    N+  ER  L       +    W CT+V + + GLP +L++ G AL L
Sbjct: 64  SALSDTSVTKWTFNAMLERVCLSNFLGEWLEPEGWYCTMVWSATLGLPLSLESAGAALGL 123

Query: 119 SSQKMEEGKELIARFC---KGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTREIFKR 174
             QK+ EGK+LI  FC   +         RN+P H  E W  F  Y   DV    +I KR
Sbjct: 124 EKQKLTEGKDLIRYFCVPCRPTKANGGRTRNRPEHAPEKWERFKAYNLRDVETEMQIQKR 183

Query: 175 LE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSS 232
           L   P+     E ++LDQ INDRG  VD+ L      I    R +L   +  LT   + +
Sbjct: 184 LSNFPVPDAIWEEYHLDQEINDRGIGVDMELVRQAIAIDTRSRERLTAAMRELTE--LEN 241

Query: 233 SRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAI-QVFNNRMRASRSAVLKL 291
               +++K WL  + GL     T+T  ++ ++   K  P+ + +V + R + ++S+V K 
Sbjct: 242 PNSAQQMKQWL-ADHGLE----TDTLGKKAVAELVKTAPEPLREVLSLRQQLAKSSVKKY 296

Query: 292 NTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRP-------------SRSHEE 338
             +  A+ +D R  G  QF GA+RTGR+SG +   QNLP+              S ++E 
Sbjct: 297 TAMENAVCADSRAHGMFQFYGANRTGRFSGRLIQLQNLPQNHMGDLAEARALVRSGNYEA 356

Query: 339 LDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWK 398
           L  +   +P ++          S  +R+  +  +G+K +VAD + IEARV+AW AGE+W+
Sbjct: 357 LSVLYEDIPDTL----------SQLIRTAYVPQDGRKFIVADFSAIEARVIAWFAGERWR 406

Query: 399 LKAFETGEDLYVTTYARSFNVAPAQ--VTKDQRAIGKVMELALGYQGGAKAFQKMASTTG 456
           LK FE G D+Y  + ++ F+V   +  V    R  GK+ ELALGY G   A + M +   
Sbjct: 407 LKVFEDGGDIYCASASQMFHVPVEKHGVNGHLRQKGKIAELALGYGGSVGALKSMGA--- 463

Query: 457 LNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVK---KAWRQK 513
                                                   L +G A E ++    AWR  
Sbjct: 464 ----------------------------------------LEMGLAEEELQPLVDAWRGS 483

Query: 514 HSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILM--LPSGRSLVYR 571
           +  +++ W ++ +A +  I        R+R       ++ D  + +L   LPSGR L Y 
Sbjct: 484 NPMITQFWWDVDRAVKDCI--------RQRIPTETHGLRFDYRSAMLFINLPSGRRLAYV 535

Query: 572 D--VGNNR------SYLNTT-TRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGY 622
              +G N+      +Y+  + T++  R  +YG K  ENIVQ  +RDIL   M   T    
Sbjct: 536 KPRIGENQFGGESVTYMGVSGTKKWERLESYGPKFVENIVQGTARDILCYAMQ--TLKNC 593

Query: 623 DIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
            IV  VHDEI+ E       + + +   M   P WAKGL L+A+GYE + Y+K
Sbjct: 594 SIVAHVHDEIIIEA--DRRMSVAAVCEQMGRTPPWAKGLKLRADGYECEFYQK 644


>gi|57234138|ref|YP_181815.1| family A DNA-dependent DNA polymerase [Dehalococcoides ethenogenes
           195]
 gi|57224586|gb|AAW39643.1| DNA-dependent DNA polymerase, family A [Dehalococcoides ethenogenes
           195]
          Length = 662

 Score =  290 bits (742), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 227/725 (31%), Positives = 342/725 (47%), Gaps = 114/725 (15%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M  + ID ET S IDL KCG+ KYAE  +  ++LF +  D   V++ D      +PQ + 
Sbjct: 1   MKNISIDIETFSDIDLNKCGVYKYAESPNFEILLFGYAVDGGKVQVIDLAQGEHIPQEII 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFN-----LDIPIHR----------------WICTL 97
           +AL + +VT  A N+ FER  L    +     LD P H                 W C++
Sbjct: 61  DALTDDEVTKWAFNANFERVCLSRYLSDLGVSLD-PFHDNHPLSTECARFLNPEGWRCSM 119

Query: 98  VLARSNGLPSALKAVGEALKLSSQKMEEGKELIARF---CKGETHECLYDRNKPNHR-EA 153
           V A + GLP +LK VG+ LKL  QKM+EGK LI  F   C          RN P H  E 
Sbjct: 120 VWAATMGLPLSLKGVGQVLKLEDQKMDEGKALIKYFSVPCAPTKANGGRTRNMPFHDPEK 179

Query: 154 WRLFGEYCKGDVTVTREIFKRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIV 211
           W  F  Y K DV V   I +RL   P+     + + +DQ INDRG  +D+ L     ++ 
Sbjct: 180 WETFKAYNKRDVEVEMAIQQRLTNFPVPDFVWDEYRIDQEINDRGVRLDMDLVAKAIEMD 239

Query: 212 DVERTKLDQELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTP 271
              RT+L   ++ +T   + +   ++++K WL  + GL     T++  ++V++   K  P
Sbjct: 240 TRSRTELTTAMKDITE--LDNPNSVQQMKQWLS-DNGLE----TDSLGKKVVAELIKTAP 292

Query: 272 QAIQ-VFNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLP 330
             +Q V   R + ++S+V K  T+  A+  DGR RG   F GA+RTGRW+G +   QNLP
Sbjct: 293 SELQTVLELRQQLAKSSVKKYQTMERAVCDDGRARGMFMFYGANRTGRWAGRLIQLQNLP 352

Query: 331 RPSRSHEELDQIITHLPTSITSDPDPLQII--------SDCVRSCVIASEGKKLVVADLA 382
           +       L+ +        + D D ++++        S  +R+  I  +G +L V+D +
Sbjct: 353 Q-----NHLEDLADARALVKSGDFDAVKLLYEDVPDTLSQLIRTAFIPKDGTQLYVSDFS 407

Query: 383 GIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQ--VTKDQRAIGKVMELALG 440
            IEARV+AW AGE W+ K F  G D+Y  + ++ F+V   +  V    R  GK+ ELALG
Sbjct: 408 AIEARVIAWYAGEMWRQKVFADGGDIYCASASQMFHVPVEKHGVNGHLRQKGKIAELALG 467

Query: 441 YQGGAKAFQKMAST-TGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFI 499
           Y G   A + M +   GL+ +    LV                                 
Sbjct: 468 YGGSVGALKAMGAIEMGLSEDELPPLV--------------------------------- 494

Query: 500 GTACERVKKAWRQKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLI 559
                    AWRQ +  + + W ++ +A  + +++     +       L +  +    L 
Sbjct: 495 --------DAWRQTNPHIVKFWWDVDRAVMEAVKHKHTTSSYG-----LTFSCR-SGMLF 540

Query: 560 LMLPSGRSLVY--RDVGNNR------SYLNT-TTRQLTREYTYGGKLTENIVQAVSRDIL 610
           + LPSGR+L Y    VG N+      +Y     T++  R  +YG K  ENIVQA SRDIL
Sbjct: 541 ITLPSGRNLAYVKPKVGTNKFGGECITYEGVGATKKWERLDSYGPKFVENIVQATSRDIL 600

Query: 611 AEGMMNATKAGYDIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYES 670
              M   T    +IV+ +HDE+V E       +  +L   M   P WA+GL L+A+GY +
Sbjct: 601 CYAM--KTLRNCEIVMHIHDELVIEA--DPHMSLDVLCEQMGRTPPWARGLQLRADGYTT 656

Query: 671 KRYRK 675
             Y+K
Sbjct: 657 PFYKK 661


>gi|220930221|ref|YP_002507130.1| DNA-directed DNA polymerase [Clostridium cellulolyticum H10]
 gi|220000549|gb|ACL77150.1| DNA-directed DNA polymerase [Clostridium cellulolyticum H10]
          Length = 647

 Score =  289 bits (740), Expect = 9e-76,   Method: Compositional matrix adjust.
 Identities = 218/700 (31%), Positives = 332/700 (47%), Gaps = 86/700 (12%)

Query: 3   TLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLKEA 60
           +L +D ET S ++L K G+ +YAE  D  ++LF +  D   V++ D      +P  +  A
Sbjct: 6   SLSLDLETYSSVNLQKSGVYRYAESDDFEILLFGYSVDSGEVQVVDLAGGEEIPDEIINA 65

Query: 61  LENTDVTIVAHNSYFERTVLKACFNLD--IPIHRWICTLVLARSNGLPSALKAVGEALKL 118
           L +  VT  A N+ FER  L    NL   +    W C++V +   GLP +L+ VG  L L
Sbjct: 66  LMDDSVTKWAFNAMFERVCLSKWLNLTEYLDPASWKCSMVWSAYMGLPLSLEGVGAVLGL 125

Query: 119 SSQKMEEGKELIARFC---KGETHECLYDRNKPNH-REAWRLFGEYCKGDVTVTREIFKR 174
             QK+ EGK+LI  FC             RN P H  + W  F  Y   DV     I +R
Sbjct: 126 EKQKLTEGKDLIKYFCTPCSPTKSNGGRVRNLPEHDMDKWERFKVYNIRDVESEMLIQQR 185

Query: 175 LEPLSSKEQELW---YLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVS 231
           L      E  +W   +LDQ INDRG  +D+       ++ +  R KL   ++ +T   + 
Sbjct: 186 LSKFQVPEN-IWKEYHLDQVINDRGIAIDMTFVKQAVEMDEHSREKLIALMQDITN--LE 242

Query: 232 SSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAI-QVFNNRMRASRSAVLK 290
           +   ++++K WL  + GL     T++  ++V++   K  P+ +  V   R + ++S+V K
Sbjct: 243 NPNSVQQMKDWL-ADNGLE----TDSLGKKVVAEMLKTAPEPLGTVLELRQQLAKSSVKK 297

Query: 291 LNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPT-- 348
              +  A+ SDGR RG  QF GA+RTGR+SG +   QNLP+      E  + +       
Sbjct: 298 YTAMENAVCSDGRARGMFQFYGANRTGRFSGRLIQLQNLPQNHMPDLEQARALVRSGNFD 357

Query: 349 --SITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGE 406
             ++  D  P +++S+ +R+  I  EG K +VAD + IEARV+AW+AGE+W+L  F+ G 
Sbjct: 358 ALTLLYDSIP-EVLSELIRTAFIPREGMKFIVADFSAIEARVIAWLAGEKWRLNVFQKGG 416

Query: 407 DLYVTTYARSFNVAPAQ--VTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAH 464
           D+Y  + ++ FNV   +  V    R  GK+ ELALGY G   A + M +           
Sbjct: 417 DIYCASASQMFNVPVEKHGVNGHLRQKGKIAELALGYGGAVGALKSMGAL---------- 466

Query: 465 LVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNEL 524
                                     E  IE+       + +  AWRQ +  +++LW ++
Sbjct: 467 --------------------------EMGIEE----EELQPLVTAWRQSNPNITKLWWDV 496

Query: 525 HQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRD--VGNNRSYLNT 582
            +A +  +   K         +  +Y       L ++LPSGR L Y    +G N     +
Sbjct: 497 DRAVKTCV---KQKTPTATHGIKFIY---QSGMLFIVLPSGRRLAYVKPRMGENMFGSES 550

Query: 583 T-------TRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCE 635
                   T++  R  +YG K  ENIVQA+SRDIL   M   T     IV  VHDEI+ E
Sbjct: 551 VTYEGVGGTKKWERIESYGPKFVENIVQAISRDILCHAMQ--TLKNCSIVAHVHDEIIIE 608

Query: 636 TPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
                  + S +   M   P+WA GL L A+GYE + Y+K
Sbjct: 609 ADMG--MSLSAICEQMAKTPTWANGLLLSADGYECQFYQK 646


>gi|300909419|ref|ZP_07126880.1| DNA-directed DNA polymerase [Lactobacillus reuteri SD2112]
 gi|300893284|gb|EFK86643.1| DNA-directed DNA polymerase [Lactobacillus reuteri SD2112]
          Length = 644

 Score =  289 bits (739), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 221/701 (31%), Positives = 333/701 (47%), Gaps = 84/701 (11%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M  L ID ET S  +L + G  +YA+  D  ++LF +  D  PV++ D      +P  + 
Sbjct: 1   MKQLSIDIETYSSTNLNQTGGYRYADSDDFELLLFGYAVDFGPVKVVDLTQGEKIPSQII 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKL 118
           +AL++  +   A N+ FER  L       +    W C+ V + + GLP +L+ VG  L L
Sbjct: 61  QALDDPAIIKSAFNAQFERVCLSRFVGHRLKPAGWHCSRVWSATLGLPLSLRDVGTVLGL 120

Query: 119 SSQKMEEGKELIARF---CKGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTREIFKR 174
             QK+  GKEL+  F   CK         RN P H  + W+ F +Y + DV V  EI ++
Sbjct: 121 PRQKITAGKELVRYFCTSCKPTKANQNRTRNFPYHAPDKWQQFKQYNQRDVEVEMEITQK 180

Query: 175 LE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSS 232
               P+   E E +++DQ INDRG  +D  L +   +       +  Q  + LT GL + 
Sbjct: 181 FSRFPVPQNEWENYWMDQDINDRGIRIDQQLVNNAIKCQKEFHAQYLQTSQQLT-GLANP 239

Query: 233 SRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLN 292
           +  L+ LK WL  + G+  + L + +  ++L +    T    QV   R   S+S+V K  
Sbjct: 240 NSPLQ-LKNWLH-QQGVETDSLAKASVAQLLQTT---TGTVHQVLALRQLLSKSSVKKYQ 294

Query: 293 TLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSH-EELDQII-----THL 346
            + +AM  DG + G LQF GA+RTGRW+G +   QNLPR S    EE   ++     T L
Sbjct: 295 AMQKAMCKDGCVHGLLQFYGANRTGRWAGRLVQVQNLPRNSMPDLEEARALVKQGNTTAL 354

Query: 347 PTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGE 406
                S PD   ++S  +R+  I S+G    VAD + +EARV+AW++GE+W+  AF   E
Sbjct: 355 AMLYESVPD---VLSQLIRTAFIPSKGHHFYVADFSAVEARVIAWLSGEEWRQAAFAKNE 411

Query: 407 DLYVTTYARSFNVAPAQ--VTKDQRAIGKVMELALGYQGGAKAFQKMASTT-GLNLNTFA 463
           D+Y  + ++ F V   +  +  + R  GK+ ELALGY G   A + M +T  GL  +   
Sbjct: 412 DIYCASASQMFGVPVVKHGINGELRQKGKIAELALGYGGSIGALKAMGATKLGLTDDELP 471

Query: 464 HLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNE 523
            LV+                                          WR     + + W +
Sbjct: 472 PLVQM-----------------------------------------WRNASPHIVQFWWD 490

Query: 524 LHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRD--VGNNR---- 577
           + +A ++ I   K  + +    +  +Y       + L L SGR L Y    +G NR    
Sbjct: 491 VDKAAKECI---KTHLPQTTHGMKFIYR---SGCMFLRLRSGRYLCYPQPKIGINRFGSE 544

Query: 578 --SYL-NTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVC 634
             +++ N T ++  R  TYG KL ENIVQA SRD+LA  M     AG  +V+ +HDE V 
Sbjct: 545 SITFMGNNTVKKWDRIETYGAKLVENIVQATSRDLLAGAMRRLETAGNPVVMHIHDEAVI 604

Query: 635 ETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           + P TD  +   +  +MT  P WA GL L A G+    Y+K
Sbjct: 605 DAP-TDR-SLDTIVKIMTEVPDWADGLILNAAGFVGGFYKK 643


>gi|260579057|ref|ZP_05846956.1| prophage LambdaSa04, DNA polymerase [Corynebacterium jeikeium ATCC
           43734]
 gi|258602808|gb|EEW16086.1| prophage LambdaSa04, DNA polymerase [Corynebacterium jeikeium ATCC
           43734]
          Length = 653

 Score =  286 bits (733), Expect = 7e-75,   Method: Compositional matrix adjust.
 Identities = 230/713 (32%), Positives = 321/713 (45%), Gaps = 99/713 (13%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M  LFID ET SP++L   G+  YA+     ++LF +  D  PVE+ D  +   +P+ + 
Sbjct: 1   MRELFIDIETFSPVNLANSGVYPYADHDGFELLLFGYSIDGGPVEVVDLANGHQLPEKVL 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIP----------IHRWICTLVLARSNGLPSA 108
            AL +  V   A N+ FER  L +      P            +W CT+V +   GLP +
Sbjct: 61  SALVDPLVVKWAFNATFERICLSSWLARQYPELMAGRRFLNPAQWRCTMVWSAYLGLPMS 120

Query: 109 LKAVGEALKLSSQKMEEGKELIARFCKGETHECLY---DRNKP-NHREAWRLFGEYCKGD 164
           L  V   L L  +K   GK+LI +FC   T         RN P +  + W  F  Y + D
Sbjct: 121 LDQVATVLHLPVRKDSAGKKLIRQFCTPGTPSVFNLGGMRNPPASDPDGWEQFISYNRRD 180

Query: 165 VTVTREIFKRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQEL 222
           V V   I  RL   PL + E + + LDQ +ND G  +D  L           R       
Sbjct: 181 VEVELAIHDRLADFPLPASEWDTYALDQNVNDTGIRLDRVLVDHAVACDRQHRATTLARA 240

Query: 223 ESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMR 282
           + LT GL + +  ++ LK WL      H   L   T   V ++    T Q  +V   R  
Sbjct: 241 QELT-GLENPNSPIQ-LKDWL----AAHGAPLQSLTKDEVAAALDTATGQVREVLLLRGE 294

Query: 283 ASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQI 342
            ++S+V K   +      DGR RG LQF GA RTGR++G +   QNLPR       L  +
Sbjct: 295 LAKSSVKKYEAMQHVTGRDGRGRGFLQFYGAGRTGRFAGRLVQVQNLPR-----NYLPDL 349

Query: 343 ITHLPTSITSDPDPLQIISDCV--------RSCVIASEGKKLVVADLAGIEARVLAWMAG 394
                   T D + ++++ D V        R+  I ++G + VVAD + IEARV+AW+AG
Sbjct: 350 AEARSLVRTGDFEAVELLYDSVPDTLSQLIRTAFIPADGHRFVVADFSAIEARVIAWLAG 409

Query: 395 EQWKLKAFETGEDLYVTTYARSFNVAPAQ--VTKDQRAIGKVMELALGYQGGAKAFQKMA 452
           E   L+AF  G+DLY  T +R F V   +     + R  GK+  LA GYQGG  A + M 
Sbjct: 410 ETTTLEAFRDGKDLYCETASRMFGVPVDKHGANAELRQKGKIAVLACGYQGGVGALKAMG 469

Query: 453 ST-TGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWR 511
           +   GL  +    LV                                          AWR
Sbjct: 470 ALRMGLAESELQPLV-----------------------------------------DAWR 488

Query: 512 QKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVY- 570
             +  V +LW +++ A  +TI        R+   V  +    +   + + LPSGR L Y 
Sbjct: 489 AANPSVVQLWADINAAAIETIST------RQPTSVGALTFTVESGIMFIRLPSGRRLAYV 542

Query: 571 -RDVGNNRSYLN-------TTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGY 622
              +G NR           TT R+  +  TYGGKLTENIVQAV+RD+L   M    +AG+
Sbjct: 543 KPKLGENRFGGTSITHEGITTGRKWGQLETYGGKLTENIVQAVARDLLTYAMHQVAEAGH 602

Query: 623 DIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
            IV+ VHDEIV ET          +  LM++ P WA GLPL+A+GY    Y K
Sbjct: 603 RIVMHVHDEIVVETATA---TVDEICKLMSTAPDWAAGLPLEADGYACDFYMK 652


>gi|300933484|ref|ZP_07148740.1| DNA-directed DNA polymerase [Corynebacterium resistens DSM 45100]
          Length = 653

 Score =  286 bits (732), Expect = 9e-75,   Method: Compositional matrix adjust.
 Identities = 233/709 (32%), Positives = 319/709 (44%), Gaps = 91/709 (12%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M  LFID ET SP++L   G+  YA+     ++LF +  D  PVE+ D  +   +P+ + 
Sbjct: 1   MRELFIDIETFSPVNLANSGVYPYADHDGFELLLFGYSIDGGPVEVVDLANGHQLPEKVL 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIP----------IHRWICTLVLARSNGLPSA 108
            AL +  V   A N+ FER  L +      P            +W CT+V +   GLP +
Sbjct: 61  SALVDPLVVKWAFNATFERICLSSWLARQYPELMAGRRFLNPAQWRCTMVWSAYLGLPMS 120

Query: 109 LKAVGEALKLSSQKMEEGKELIARFCKGETHECLY---DRNKP-NHREAWRLFGEYCKGD 164
           L  V   L L  +K   GK+LI +FC   T         RN P +  + W  F  Y + D
Sbjct: 121 LDQVATVLHLPVRKDSAGKKLIRQFCTPGTPSVFNLGGMRNPPASDPDGWEQFISYNRRD 180

Query: 165 VTVTREIFKRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQEL 222
           V V   I  RL   PL + E + + LDQ +ND G  +D  L           R       
Sbjct: 181 VEVELAIHDRLADFPLPASEWDTYALDQNVNDTGIRLDRVLVDHAVACDRQHRATTLARA 240

Query: 223 ESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMR 282
           + LT GL + +  ++ LK WL      H   L   T   V ++    T Q  +V   R  
Sbjct: 241 QELT-GLENPNSPIQ-LKDWL----AAHGAPLQSLTKDEVAAALDTATGQVREVLLLRGE 294

Query: 283 ASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPR---PSRSH-EE 338
            ++S+V K   +      DGR RG LQF GA RTGR++G +   QNLPR   P  +    
Sbjct: 295 LAKSSVKKYEAMQHVTGRDGRGRGFLQFYGAGRTGRFAGRLVQVQNLPRNYLPDLAEARS 354

Query: 339 LDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWK 398
           L +   +    +  D  P   +S  +R+  I ++G + VVAD + IEARV+AW+AGE   
Sbjct: 355 LVRTGNYDAVELLYDSVP-DTLSQLIRTAFIPADGHRFVVADFSAIEARVIAWLAGEATT 413

Query: 399 LKAFETGEDLYVTTYARSFNVAPAQ--VTKDQRAIGKVMELALGYQGGAKAFQKMAST-T 455
           L+AF  G+DLY  T +R F V   +     + R  GK+  LA GYQGG  A + M +   
Sbjct: 414 LEAFRDGKDLYCETASRMFGVPVDKHGANAELRQKGKIAVLACGYQGGVGALKAMGALRM 473

Query: 456 GLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHS 515
           GL  +    LV                                          AWR  + 
Sbjct: 474 GLAESELQPLV-----------------------------------------DAWRAANP 492

Query: 516 RVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVY--RDV 573
            V +LW +++ A    IE   AI  R    V  +    +   + + LPSGR L Y    +
Sbjct: 493 NVVQLWADINAA---AIE---AISTRLPTSVGALTFTVESGIMFIRLPSGRRLAYVKPKL 546

Query: 574 GNNRSYLN-------TTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVL 626
           G NR           TT R+  +  TYGGKLTENIVQAV+RD+L  GM    +AG+ IV+
Sbjct: 547 GENRFGGTAITHEGITTGRKWGQLETYGGKLTENIVQAVARDLLTFGMHQVDRAGHRIVM 606

Query: 627 TVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
            VHDEIV ET          +  LM   P WA GLPL A+GY    Y K
Sbjct: 607 HVHDEIVVETATA---TVDEICKLMAITPDWAAGLPLAADGYACDFYMK 652


>gi|266623807|ref|ZP_06116742.1| prophage LambdaSa04, DNA polymerase [Clostridium hathewayi DSM
           13479]
 gi|288864379|gb|EFC96677.1| prophage LambdaSa04, DNA polymerase [Clostridium hathewayi DSM
           13479]
          Length = 656

 Score =  285 bits (730), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 224/719 (31%), Positives = 334/719 (46%), Gaps = 108/719 (15%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M  L ID ETRS ID+ K G  KYA+  D  ++LFA+ +++ PV++ D  +   +P  L 
Sbjct: 1   MHHLSIDIETRSSIDIGKAGAYKYAQSPDFEILLFAYQWNNDPVKVIDLKNGEELPCWLM 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKL 118
           +AL + +V   A+N+ FE   L  C   + PI +W CT+      G  + L A G+A+ L
Sbjct: 61  QALADPNVIKHAYNAAFEWYCLN-CAGYETPIEQWRCTMAHGLYCGYTAGLDATGKAIGL 119

Query: 119 --SSQKMEEGKELIARFC---KGETHECLYDRNKPNH-REAWRLFGEYCKGDVTVTREIF 172
               QK+  GK LI  FC   K          N+P H  + W LF EYC  DV   REI 
Sbjct: 120 PQDKQKLTTGKALIRYFCVPCKPTKTNGSRTWNQPWHDTDKWELFKEYCLQDVVTEREIL 179

Query: 173 KRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLV 230
           KRL+  P+  +E+ LW +D  +N  G  VD  L      I  +   +L  E  SLT GL 
Sbjct: 180 KRLDLFPMPEEEEHLWQMDVLMNAYGVRVDTDLIEGALYIDQISTQRLTDEAISLT-GLQ 238

Query: 231 SSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQ-VFNNRMRASRSAVL 289
           + +   + L+ WL  + G   ++L + T   +L     + P  ++ +   R +  ++++ 
Sbjct: 239 NPNSAAQLLQ-WL-RDNGTEADNLQKATVAELLGG---INPNKVRRMLEIRQQLGKTSIK 293

Query: 290 KLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPR-------------PSRSH 336
           K   +  A     R+RG  Q+ GA+RTGRW+G +   QNLPR              ++++
Sbjct: 294 KYVAMDTARGEGDRVRGLTQYYGANRTGRWAGRLVQMQNLPRNYLKTLDYARNLVKAKNY 353

Query: 337 EELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQ 396
           + +  +  ++P ++          S  +R+  I S G K VVAD + IEARV+AW+AGEQ
Sbjct: 354 DGVRILYGNVPDTL----------SQLIRTAFIPSAGHKFVVADFSAIEARVIAWLAGEQ 403

Query: 397 WKLKAFETGEDLYVTTYARSFNVAPAQVTKDQ-----RAIGKVMELALGYQGGAKAFQKM 451
           W  + F T   +Y  T ++ F V   ++ K       R  GKV  LALGYQGG  A   M
Sbjct: 404 WVNEVFATHGKIYEATASQMFGVPVERIAKGNPEYSLRQKGKVATLALGYQGGTSALIAM 463

Query: 452 ASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWR 511
            +                               +Q    E  + D+          + WR
Sbjct: 464 GA-------------------------------LQMGLTEEELPDIV---------QRWR 483

Query: 512 QKHSRVSELWNELHQAFEQTIENGK-----AIIARKRRDVPLVYMKKDKNNLILMLPSGR 566
           Q + R+  LW  +  A    +E  +      +I     D+  +Y    ++ L + LPSGR
Sbjct: 484 QANPRIKGLWYAIENAALAVMETAQPQGINGLIFALEGDI--IY---GQSFLTVRLPSGR 538

Query: 567 SLVYRD--VGNNR----SYLNTTTRQLTREY----TYGGKLTENIVQAVSRDILAEGMMN 616
            L Y    +  NR    +    T  Q TR++    TYGGK+ ENIVQA++RD LA  +  
Sbjct: 539 KLFYPKPFLKENRFEKMAVHYYTVGQQTRKWEVTSTYGGKMVENIVQAIARDCLAVTLER 598

Query: 617 ATKAGYDIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
               G  +V  VHDE++ + P   E     +  LM     WA GL LK  G+ES  Y K
Sbjct: 599 IASKGLQVVFHVHDEVIIDAP--METTVEEICDLMAEPIPWAPGLVLKGAGFESSYYMK 655


>gi|167630957|ref|YP_001681456.1| DNA polymerase i, putative [Heliobacterium modesticaldum Ice1]
 gi|167593697|gb|ABZ85445.1| DNA polymerase i, putative [Heliobacterium modesticaldum Ice1]
          Length = 646

 Score =  284 bits (727), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 216/704 (30%), Positives = 330/704 (46%), Gaps = 88/704 (12%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M  L ID ET S +DL K G+ +Y E  D  ++LF +  D   V++ D +    +P  + 
Sbjct: 1   MRALNIDIETYSSVDLAKSGVYRYTESPDFAILLFGYSVDGGEVQVVDLMCSEAIPSKVV 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIH----RWICTLVLARSNGLPSALKAVGE 114
           +AL + DVT  A N+ FER  L     L    +     W CT+V +   GLP +L+  G 
Sbjct: 61  DALTDKDVTKWAFNAQFERICLSKWLGLPTGQYLDPMSWRCTMVWSAYMGLPLSLEGTGA 120

Query: 115 ALKLSSQKMEEGKELIARF---CKGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTRE 170
            L L  QK+ EGK+LI  F   CK         RN P H  + W  F  Y   DV     
Sbjct: 121 VLGLEKQKLTEGKDLIRHFSVPCKPTVSNEGRTRNLPIHAPDKWAAFKAYNLRDVETEMA 180

Query: 171 IFKRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYG 228
           I ++L   P+       ++LDQ INDRG  +D+ L     ++ +  R+KL   +  LT  
Sbjct: 181 IQQKLAKFPVPEGVWGEYHLDQEINDRGVALDMDLVRQAIEMDNRSRSKLTGMIRELTE- 239

Query: 229 LVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAV 288
            + +   + ++K WL  + GL  + L +     +L +  +   + +++   R   ++S+V
Sbjct: 240 -LENPNSVVQMKQWLS-DHGLETDTLGKKAVVELLKTASEPLGKVLEL---RQSLAKSSV 294

Query: 289 LKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPT 348
            K   +   + +DGR RG  QF GA+RTGRW+G +   QNLP+      +L+Q  + + +
Sbjct: 295 KKYTAMENVVCTDGRARGMFQFYGANRTGRWAGRLIQLQNLPQ--NHMPDLEQARSLVRS 352

Query: 349 S------ITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAF 402
                  +  D  P +++S+ +R+  +  +G K +VAD + IEARV+AW+AGE+W+ + F
Sbjct: 353 GNFAALEMLYDSVP-EVLSELIRTAFVPKKGCKFIVADFSAIEARVIAWLAGEKWRQEVF 411

Query: 403 ETGEDLYVTTYARSFNVAPAQ--VTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLN 460
           E+G D+Y  + ++ F+V   +  V    R  GK+ ELALGY G   A + M         
Sbjct: 412 ESGGDIYCASASQMFHVPVEKNGVNGHLRQKGKIAELALGYGGSVGALKAMG-------- 463

Query: 461 TFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSEL 520
                                           A+E        + +  AWR  + ++  L
Sbjct: 464 --------------------------------ALEMGLEEEELQPLVSAWRSSNPKIVRL 491

Query: 521 WNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRD--VGNNRS 578
           W ++ +A        KA+  R   +   +          + LPSGR L Y    +G NR 
Sbjct: 492 WWDIDRAAM------KAVRERTTTETHGIRFSYQSGMFFITLPSGRRLAYVKPRIGQNRF 545

Query: 579 YLNTTT-------RQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDE 631
             +  T       ++  R  +YG KLTENIVQA SRDIL   M N       IV+ VHDE
Sbjct: 546 GSDCITYEGVGGAKKWERIESYGPKLTENIVQATSRDILCYAMRNLRHC--SIVMHVHDE 603

Query: 632 IVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           IV E       +   +   M   P WAKGL L+A+GYE+  Y+K
Sbjct: 604 IVIEA--DRRMSTEAVCKQMGQTPPWAKGLLLRADGYETDFYKK 645


>gi|42779458|ref|NP_976705.1| DNA polymerase I [Bacillus cereus ATCC 10987]
 gi|42735374|gb|AAS39313.1| DNA polymerase I [Bacillus cereus ATCC 10987]
          Length = 644

 Score =  283 bits (725), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 215/701 (30%), Positives = 329/701 (46%), Gaps = 84/701 (11%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M ++ ID ET S  +L K G+ +YAE  D  ++LF +  D   V++ D      +P  + 
Sbjct: 1   MNSISIDIETFSGANLQKSGVYRYAESDDFEILLFGYSVDGGEVQVVDLACGEEIPDEII 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLD--IPIHRWICTLVLARSNGLPSALKAVGEAL 116
            AL +  VT  A N+ FER  L    NL   +    W C+++ +   GLP +L+ VG  L
Sbjct: 61  NALLDDSVTKWAFNAMFERVCLSKWLNLTEYLDPASWKCSMIWSAYMGLPLSLEGVGAVL 120

Query: 117 KLSSQKMEEGKELIARFC---KGETHECLYDRNKPNH-REAWRLFGEYCKGDVTVTREIF 172
            L  QK+ EGK+LI  FC             RN P H  + W  F  Y   DV     I 
Sbjct: 121 GLEKQKLTEGKDLIKYFCTPCSPTKSNGGRVRNLPEHDMDKWERFKAYNLRDVEAEMSIQ 180

Query: 173 KRLEPLSSKEQ--ELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLV 230
           +R       E   E ++LDQ INDRG  +D+        + +  R KL   ++ +T   +
Sbjct: 181 QRFSKFLVPENIWEEYHLDQEINDRGIAIDMTFVKQAVVMDEHSREKLMALMQDITN--L 238

Query: 231 SSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAI-QVFNNRMRASRSAVL 289
            +   ++++K WL  + GL     T+T  ++ ++   K  P+ +  V   R + ++S+V 
Sbjct: 239 ENPNSVQQMKDWL-ADNGLE----TDTLGKKAVAEMLKTAPEPLGTVLELRQQLAKSSVK 293

Query: 290 KLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPT- 348
           K   +  A+ +DGR RG  QF GA+RTGR+SG +   QNLP+      E  + +      
Sbjct: 294 KYTAMENAVCNDGRARGMFQFYGANRTGRFSGRLIQLQNLPQNHMPDLEQARALVRSGNF 353

Query: 349 ---SITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETG 405
              ++  D  P +++S+ +R+  I  EG K +VAD + IEARV+AW+AGE+W++  F+ G
Sbjct: 354 DALTLLYDSIP-EVLSELIRTAFIPREGMKFIVADFSAIEARVIAWLAGEKWRIDVFQNG 412

Query: 406 EDLYVTTYARSFNVAPAQ--VTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFA 463
            D+Y  + ++ FNV   +  V    R  GK+ ELALGY G   A + M +          
Sbjct: 413 GDIYCASASQMFNVPVEKHGVNGHLRQKGKIAELALGYGGSVGALKSMGAL--------- 463

Query: 464 HLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNE 523
                                      E  IE+       + +  AWRQ +  +++LW +
Sbjct: 464 ---------------------------EMGIEE----EELQPLVTAWRQSNPNITKLWWD 492

Query: 524 LHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDV--------GN 575
           + +A +  +   K     +   +  +Y       L + LPSGR L Y           G 
Sbjct: 493 VDRAVKTCV---KQKTPTETHGIKFIY---QSGMLFIALPSGRRLAYVKPRMGENMFGGE 546

Query: 576 NRSYLNT-TTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVC 634
           + +Y     T++  R  +YG K  ENIVQA+SRDIL   M   T     IV  VHDEI+ 
Sbjct: 547 SVTYEGVGGTKKWERIESYGPKFVENIVQAISRDILCHAMQ--TLKNCSIVAHVHDEIII 604

Query: 635 ETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           E       +A  +   M   P+WA GL L A+GYE + Y+K
Sbjct: 605 EADMGTSLSA--ICEQMAKMPTWANGLLLSADGYECQFYQK 643


>gi|291556513|emb|CBL33630.1| DNA polymerase I-3'-5' exonuclease and polymerase domains
           [Eubacterium siraeum V10Sc8a]
          Length = 660

 Score =  282 bits (722), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 228/737 (30%), Positives = 339/737 (45%), Gaps = 140/737 (18%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M TL ID ET S +DL KCG+ KY E  D  ++LF +  D  PV++ D      +PQ + 
Sbjct: 1   MKTLSIDIETYSSVDLAKCGVYKYTEATDFDILLFGYSTDGGPVQVVDLACGETIPQEVI 60

Query: 59  EALENTDVTIVAHNSYFERTVL-----------KACFNLD-------IPIHRWICTLVLA 100
            AL N +VT  A N+ FER  L            AC+++        +    W CT++ +
Sbjct: 61  AALTNDNVTKWAFNAQFERICLSRWLRDHGGFDNACYSIPEDTVGNYLDPASWKCTMIWS 120

Query: 101 RSNGLPSALKAVGEALKLSSQKMEEGKELIARFCK---------GETHECLYDRNKP-NH 150
              GLP +L+ VG  L L  QK+ EGKELI  FC+         G T      RN P N 
Sbjct: 121 AYMGLPLSLEGVGAVLGLGKQKLTEGKELIKYFCQPCAPTKANSGRT------RNLPENA 174

Query: 151 REAWRLFGEYCKGDVTVTREIFKRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLN 208
            + W  F  Y   DV V   I ++L   P+     E ++LDQ INDRG  +D+ L   + 
Sbjct: 175 PDKWASFKRYNARDVEVEMSIQEKLAKFPVPDVVWEQYHLDQEINDRGVALDMDL---VR 231

Query: 209 QIVDVE---RTKLDQELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSS 265
           Q +D++   R +L   ++ LT   + +   ++++K WL  + GL+++ L +     +L  
Sbjct: 232 QAIDMDTRSRAELTAAMKKLT--ALDNPNSVQQMKQWLS-DNGLNVDSLGKKEVAEML-- 286

Query: 266 NKKLTPQAIQVFNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFP 325
            K    +  QV   R + ++S+V K   + +A+ +DGR RG  QF GA+RTGRW+G +  
Sbjct: 287 -KTAPAELQQVLLLRQQLAKSSVKKYQAMEKAVCADGRARGMFQFYGANRTGRWAGRIIQ 345

Query: 326 PQNLPRPSRSHEELDQIITHLPTSITS-------DPDPLQII--------SDCVRSCVIA 370
            QNLP+             HLP    +       D D ++++        S  +R+  + 
Sbjct: 346 MQNLPQ------------NHLPDLAEARALVRCGDFDGVELLYEDVPDTLSQLIRTAFVP 393

Query: 371 SEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQ--VTKDQ 428
             G K +V+D + IEARVLAW AGE W+ + FE G D+Y  + ++ F V   +  V    
Sbjct: 394 RPGYKFIVSDFSAIEARVLAWFAGETWRQEVFEKGGDIYCASASQMFKVPVEKHGVNGHL 453

Query: 429 RAIGKVMELALGYQGGAKAFQKMAS-TTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQE 487
           R  GK+ ELALGY G   A + M +   GL+      LV                     
Sbjct: 454 RQKGKIAELALGYGGSVGALKAMGALEMGLSEGELQPLV--------------------- 492

Query: 488 NHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVP 547
                                AWR  +  + + W ++ +A         A+      ++ 
Sbjct: 493 --------------------TAWRNSNQNIVKFWWDIDRAAMN------AVKYHMDSEIC 526

Query: 548 LVYMKKDKNNLILMLPSGRSLVY--RDVGNNR------SYLNT-TTRQLTREYTYGGKLT 598
            +        L + LPSGR L Y    +G N+      +Y     T++  R  TYG KL 
Sbjct: 527 GIKFSYKSGMLFITLPSGRRLSYVKPKLGTNQFGGECITYEGIGGTKKWERLDTYGPKLV 586

Query: 599 ENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWA 658
           ENIVQA SRDIL   M   +     I + +HDE+V E   +   N   +   M   P+WA
Sbjct: 587 ENIVQATSRDILCYAMRTLSHCF--ITMHIHDELVIEA--SLGVNLKSICEQMGRTPTWA 642

Query: 659 KGLPLKAEGYESKRYRK 675
            GL L+A+GYE+  Y+K
Sbjct: 643 NGLKLRADGYETMFYKK 659


>gi|295114921|emb|CBL35768.1| DNA polymerase I-3'-5' exonuclease and polymerase domains
           [butyrate-producing bacterium SM4/1]
          Length = 646

 Score =  282 bits (721), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 220/708 (31%), Positives = 322/708 (45%), Gaps = 96/708 (13%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M TL ID ET S   L K G+ +Y E  D  ++LFA+  D  PV+  D      +P  + 
Sbjct: 1   MQTLSIDLETYSDQPLAKTGVYRYVESPDFEILLFAYSVDGAPVQQIDLACGEKIPSEIL 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLD----IPIHRWICTLVLARSNGLPSALKAVGE 114
            ALE+  VT  A N+ FER  L           +    W C++V A   GLP +L+  G 
Sbjct: 61  CALEDDKVTKWAFNANFERICLSRFLGYPTGDYLEPDSWKCSMVWAAYMGLPLSLEGAGA 120

Query: 115 ALKLSSQKMEEGKELIARFCKG---ETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTRE 170
            L L  QK+ EGK+LI  FC+            RN P H  + W  F +Y   DV     
Sbjct: 121 VLGLEKQKLAEGKDLIKYFCQPCAPTKSNGQRTRNLPKHSPDKWLAFKKYNIRDVETEMS 180

Query: 171 IFKRL--EPLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYG 228
           I  RL   P+     E ++LDQ INDRG  +D+ L     Q+    R++L Q ++ LT  
Sbjct: 181 IQARLLKYPVPDSVWEEYHLDQEINDRGVGLDMELVRQAIQMDGRSRSELTQAMKELTS- 239

Query: 229 LVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQ-VFNNRMRASRSA 287
            + +   ++++K WL  + G+     T+T  ++ ++   K  PQ +Q V   R + ++S+
Sbjct: 240 -LDNPNSVQQMKQWL-ADNGVE----TDTLGKKAVAELLKTAPQQLQKVLTLRQQLAKSS 293

Query: 288 VLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLP 347
           V K   +  A+ +DGR RG  QF GA+RTGRW+G +   QNLP        LD +     
Sbjct: 294 VKKYQAMETAVCADGRARGMFQFYGANRTGRWAGRIIQMQNLP-----QNHLDDLTEARG 348

Query: 348 TSITSDPDPLQII--------SDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKL 399
                  D L+++        S  +R+  +    +K +VAD + IEARV+AW+A E+W+ 
Sbjct: 349 LVRAGGFDALEMLYEDVPDTLSQLIRTAFVPQGNRKFIVADFSAIEARVIAWLADEKWRQ 408

Query: 400 KAFETGEDLYVTTYARSFNVAPAQ--VTKDQRAIGKVMELALGYQGGAKAFQKMAS-TTG 456
             F  G+D+Y  + ++ F V   +  V    R  GK+ ELALGY G   A + M +   G
Sbjct: 409 DVFAEGKDIYCASASQMFGVPVEKHGVNGHLRQKGKIAELALGYGGSVGALKAMGALEMG 468

Query: 457 LNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSR 516
           L+ +    LV                                          AWRQ + +
Sbjct: 469 LSEDELPALV-----------------------------------------SAWRQANPK 487

Query: 517 VSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVY--RDVG 574
           + + W  + +A         A+  +       +        L + LPSGRSL Y    +G
Sbjct: 488 IVQFWWAVDRAVMD------AVTRKTTTKTHGIIFSARNGMLFITLPSGRSLSYVKPKIG 541

Query: 575 NNR------SYLNT-TTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLT 627
            NR      +Y     T++  R  +YG K  ENIVQA SRDIL   M   T     IV+ 
Sbjct: 542 ENRFGGDCITYEGVGGTKKWERIDSYGPKFVENIVQATSRDILCYAM--KTLRCCSIVMH 599

Query: 628 VHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           +HDE+V E        A  +   M   P WA GL L+A+GYE+  Y+K
Sbjct: 600 IHDEVVIEADRRMSLQA--VCDQMGRTPPWANGLQLRADGYETDFYKK 645


>gi|225405823|ref|ZP_03761012.1| hypothetical protein CLOSTASPAR_05044 [Clostridium asparagiforme
           DSM 15981]
 gi|225042637|gb|EEG52883.1| hypothetical protein CLOSTASPAR_05044 [Clostridium asparagiforme
           DSM 15981]
          Length = 668

 Score =  281 bits (720), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 224/723 (30%), Positives = 322/723 (44%), Gaps = 112/723 (15%)

Query: 4   LFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMP-QVLKEA 60
           L ID ETRS +D++K G  +YA+  D  ++LFA+ +DD PVE+ D   D   P ++ +EA
Sbjct: 6   LSIDIETRSSVDISKAGAYRYAQSPDFEILLFAYQWDDGPVEVIDLTADESFPPEIWEEA 65

Query: 61  LENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKL-- 118
           L + DV   A+N+ FE   L        P+ +W CT+      G  + L A G+A+ L  
Sbjct: 66  LRDPDVIKHAYNAAFEWYCLNRA-GYATPLDQWRCTMAHGLYCGYTAGLDATGKAIGLPQ 124

Query: 119 SSQKMEEGKELIARFC---KGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTREIFKR 174
             QK+  GK LI  FC   K          N+P H  + W LF EYC+ DV    EI +R
Sbjct: 125 DKQKLAVGKALIRYFCVPCKPTKSNGGRTWNQPRHDPDKWTLFKEYCRQDVVTEHEILRR 184

Query: 175 LE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSS 232
           L   P+   E+ LW LD  +N  G  VD  L      + +V   KL  E   LT GL  +
Sbjct: 185 LNFFPMPEDEERLWQLDVAMNAYGVRVDTKLIAGALYVDEVSTEKLTAEAVELT-GL-DN 242

Query: 233 SRCLEKLKTWLFLETGLH------LEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRS 286
                +L  W+      H      L DL + T +  L     L     ++   R +  ++
Sbjct: 243 PNSGAQLVPWINAHNKEHPDDPDLLADLRKETVEEALKDRDNLPEDVARMLEIRQQLGKT 302

Query: 287 AVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPR-------------PS 333
           +V K   +  A     R+RG  Q+ GA+RTGRW+G +   QNLPR              +
Sbjct: 303 SVKKYVAMDVARGEGDRVRGLTQYYGANRTGRWAGRLVQLQNLPRNYLKTLDYARELVKA 362

Query: 334 RSHEELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMA 393
           ++++ L  +  ++P ++          S  +R+  I SEG K VVAD + IEAR +AW+A
Sbjct: 363 KNYDGLRILYGNVPDTL----------SQLIRTAFIPSEGHKFVVADFSAIEARAIAWLA 412

Query: 394 GEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQ-----RAIGKVMELALGYQGGAKAF 448
           GEQW  + F T   +Y  T A+ F V   ++TK       R  GKV  LALGYQG   A 
Sbjct: 413 GEQWVNEVFATHGKIYEATAAQMFGVPVERITKGNPEYSLRQKGKVATLALGYQGSTAAL 472

Query: 449 QKMAS-TTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVK 507
             M +   GL  +    +V                                         
Sbjct: 473 IAMGALKMGLTEDELPDIVTR--------------------------------------- 493

Query: 508 KAWRQKHSRVSELWNELHQAFEQTIENGK-----AIIARKRRDVPLVYMKKDKNNLILML 562
             WR  + R+  LW  +     + ++  +      +I     D  L+Y    ++ L + L
Sbjct: 494 --WRNANKRICGLWYAVENTALRVMQTAQPQGLNGLIFALEGD--LIY---GQSFLTVRL 546

Query: 563 PSGRSLVYRD--VGNNR--------SYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAE 612
           PSGR L Y    +  NR          +   TR+   + TYGGK+TENIVQA++RD LA 
Sbjct: 547 PSGRKLYYPKPFLQENRFGKQAIHYYAVGQQTRKWEIDSTYGGKMTENIVQAIARDCLAV 606

Query: 613 GMMNATKAGYDIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKR 672
            +    + G   V  VHDE++ + P   E     +  LM     WA GL LK  G+ES  
Sbjct: 607 TLRRIAQKGLQTVFHVHDEVIIDAP--METTVDEICDLMAEPIPWAPGLILKGAGFESSY 664

Query: 673 YRK 675
           Y K
Sbjct: 665 YMK 667


>gi|313896425|ref|ZP_07829976.1| DNA-directed DNA polymerase [Selenomonas sp. oral taxon 137 str.
           F0430]
 gi|312974849|gb|EFR40313.1| DNA-directed DNA polymerase [Selenomonas sp. oral taxon 137 str.
           F0430]
          Length = 650

 Score =  281 bits (719), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 221/718 (30%), Positives = 329/718 (45%), Gaps = 112/718 (15%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M +L ID ETRS +D+ K G+ +YAE  D  ++LF +  D   V++ D  +   +PQ + 
Sbjct: 1   MESLSIDLETRSSVDIGKSGVYRYAEAEDFAILLFGYSVDGGAVQVIDIANGEQIPQEIL 60

Query: 59  EALENTDVTIVAHNSYFERTVLKAC----------FNLDIPI----------HRWICTLV 98
           +AL +  V   A N+ FER  L             F+ + P+          H W CT+V
Sbjct: 61  DALTDESVIKWAFNANFERVCLSRYLSDLGIALDPFHDNHPLSTECARFLSPHSWRCTMV 120

Query: 99  LARSNGLPSALKAVGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFG 158
            +   GLP +L  VG  L L  QKM EGK LI  F     HE       P   + W LF 
Sbjct: 121 WSAYMGLPLSLAGVGRVLGLEEQKMNEGKALIRYFSTPPFHE-------PTGAK-WDLFK 172

Query: 159 EYCKGDVTVTREIFKRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERT 216
            Y + DV V   I KRL   P+     E + LDQ INDRG  +D+ L     QI    + 
Sbjct: 173 SYNRRDVEVEMAIQKRLSKYPVPQSVWEEYVLDQEINDRGIRLDMPLVENAVQIDVRTKE 232

Query: 217 KLDQELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAI-Q 275
           KL   L++LT   + +   + ++K WL  E G+  E L + +   +L++     P  + +
Sbjct: 233 KLTDRLKTLTS--LENPNSVTQMKAWL-KEQGVETESLDKKSVTALLAN----VPDPLKE 285

Query: 276 VFNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRS 335
           V   R + ++S+V K   +   + SDGR RG  QF GA+RTGR+SG     QNLP+   +
Sbjct: 286 VLELRQQLAKSSVKKYQAMQNTVCSDGRARGMFQFYGANRTGRFSGRHIQLQNLPQNHLA 345

Query: 336 HEELDQIITH------LPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVL 389
             E  + +        L     S PD   ++S  +R+  I+ EG+K +VAD + IEARVL
Sbjct: 346 DLEYARSLVRQGSFAALELLYESVPD---VLSQLIRTAFISKEGRKFIVADFSAIEARVL 402

Query: 390 AWMAGEQWKLKAFETGEDLYVTTYARSF--NVAPAQVTKDQRAIGKVMELALGYQGGAKA 447
           +W+A E+W++  F    D+Y  T  R F  NV         R  GK+ EL+ GY G   A
Sbjct: 403 SWLAKERWRMDVFANDGDIYCATAGRMFHCNVVKHGENGHLRQYGKLAELSSGYGGSVGA 462

Query: 448 FQKMAS-TTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERV 506
            +   +  +G+       LV                                        
Sbjct: 463 LKAFGALESGMKEEELNPLV---------------------------------------- 482

Query: 507 KKAWRQKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGR 566
             AWR  +  + + W  + +A +  I+     +    R    +Y     + + + LP GR
Sbjct: 483 -DAWRAANPNIVDFWWAVDRATKDCIKERSTKVTHGIR---FIY---QGSMMFIELPCGR 535

Query: 567 SLVYRD--VGNNR------SYLN-TTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNA 617
            L Y    +G N+      +Y+    +++  R  +YG KL EN+ QA+SRDIL   M   
Sbjct: 536 RLAYVKPRIGENQFGGESVTYMGLNLSKKWARIESYGPKLVENVTQAISRDILCYAMQ-- 593

Query: 618 TKAGYDIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           T    DIV  VHDE++ E    +  + S +   M   P WA GLPL+A+G+E + Y+K
Sbjct: 594 TLRTMDIVAHVHDELIIEC--DERVSLSAICEQMARTPPWADGLPLRADGFECQFYQK 649


>gi|298346386|ref|YP_003719073.1| DNA-directed DNA polymerase [Mobiluncus curtisii ATCC 43063]
 gi|298236447|gb|ADI67579.1| DNA-directed DNA polymerase [Mobiluncus curtisii ATCC 43063]
          Length = 658

 Score =  281 bits (718), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 220/696 (31%), Positives = 326/696 (46%), Gaps = 82/696 (11%)

Query: 3   TLFIDFETRSPIDLTKCGICKYAEDVC--VILFAFGFDDHPVELWDCVHDPVMPQVLKEA 60
           +L +D ET S ++L++CG+ +Y +D    ++L ++  DD  V   D      +P  +  A
Sbjct: 21  SLALDLETFSAVNLSQCGVYRYCDDPSFRILLCSYSVDDSDVVTVDLASGEQLPPEVVAA 80

Query: 61  LENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKLSS 120
           L++  V   A+N+ FERT L A     +    W CT+V A + GLP +LK VG  L L+ 
Sbjct: 81  LDDPSVIKWAYNAAFERTCLSAHLGHRLDPTGWRCTMVWAATLGLPLSLKDVGTVLGLAH 140

Query: 121 QKMEEGKELIARFCKGETHECLYDRNKP-NHREAWRLFGEYCKGDVTVTREIFKRL--EP 177
           QK+ EGK+LI  F           R++P +   AW LF +Y   DV V   I ++L   P
Sbjct: 141 QKLAEGKDLIKYFSLPTKTGI---RHQPSDDSAAWALFKQYNARDVEVETTIRRKLSHHP 197

Query: 178 LSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSSSRCLE 237
           +  +    + +DQ INDRG  +D  LA          R +     + LT GL + +  L+
Sbjct: 198 VPDEVWGQYEVDQRINDRGIHIDTRLATNAMACDKKYRKRTLARAQELT-GLDNPASPLQ 256

Query: 238 KLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLNTLVEA 297
            L++WL  E G  +  + +      L +      +A+++   R   S+S+V K   + +A
Sbjct: 257 -LQSWL-AEQGCKISSMAKEDVDSALDTATGSVREALEL---RQDLSKSSVAKYRKMADA 311

Query: 298 MNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITH------LPTSIT 351
             +DGR  G LQF GASRTGRW+G +   QNLPR         + + H      L     
Sbjct: 312 TCADGRAHGLLQFYGASRTGRWAGRLVQVQNLPRNYLPDLAQARSLVHYGDFDVLEMLYP 371

Query: 352 SDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVT 411
           S PD L   S  +R+  I SE  + +VAD + IEARVLAW+AGE+  L AF  GEDLY  
Sbjct: 372 SVPDTL---SQLIRTAFIPSENHRFIVADYSAIEARVLAWLAGEETTLAAFTNGEDLYCA 428

Query: 412 TYARSFNVAPAQ---VTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVKT 468
           T +  F V P +      + R  GK+  LA GY G   A + M                 
Sbjct: 429 TASAMFGV-PVEKHGANAELRQKGKIAVLACGYNGSVGALKAMG---------------- 471

Query: 469 NSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELHQAF 528
                                   A++     +  + +  AWR  +  +  +W+++ Q  
Sbjct: 472 ------------------------ALKMGLTASELQPIVDAWRAANPNIVAMWHDVDQTA 507

Query: 529 EQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVY--RDVGNNRSYLNTTT-- 584
            Q      AI  R    +  +     K  L + LPSGR L Y    +G NR    + T  
Sbjct: 508 IQ------AITTRSTVTLGNLSFTGTKGMLFITLPSGRRLAYVKPGLGVNRFGGTSITYW 561

Query: 585 -----RQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETPDT 639
                R+  +  TYGGKL ENIVQA +RD+LAE +     AG+++V+ +HDE+V +    
Sbjct: 562 GQGINRKWQQLETYGGKLVENIVQATARDLLAEAITRIENAGHEVVMHIHDEVVVDESKD 621

Query: 640 DEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
                + +  LM   P+WA GLP+ A GY+   Y K
Sbjct: 622 SGTTVADICTLMNQLPTWALGLPIDAAGYKCDFYMK 657


>gi|284048474|ref|YP_003398813.1| DNA-directed DNA polymerase [Acidaminococcus fermentans DSM 20731]
 gi|283952695|gb|ADB47498.1| DNA-directed DNA polymerase [Acidaminococcus fermentans DSM 20731]
          Length = 662

 Score =  280 bits (717), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 225/719 (31%), Positives = 339/719 (47%), Gaps = 102/719 (14%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAEDVC--VILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M TL ID ET S ++L KCG+ KYAE     ++LF +  D  PV++ D      +P+ + 
Sbjct: 1   MKTLSIDIETYSDVNLAKCGVYKYAESPAFEILLFGYAVDGGPVQVVDLAQGESIPEEIL 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACF-----NLDIPIHR----------------WICTL 97
           +AL +  VT  A N+ FER  L         +LD P H                 W C++
Sbjct: 61  DALTDDTVTKWAFNANFERVCLSRHLTDLGRSLD-PFHDQHPLSKKCARFLNPAGWKCSM 119

Query: 98  VLARSNGLPSALKAVGEALKLSSQKMEEGKELIARFC---KGETHECLYDRNKPNHR-EA 153
           V +   GLP +L+ VG  L L +QKM+EG+ELI  FC   K         RN P H  + 
Sbjct: 120 VWSAYLGLPLSLEGVGAVLNLDNQKMKEGRELIRYFCIPCKETKANGGRTRNLPQHALDK 179

Query: 154 WRLFGEYCKGDVTVTREIFKRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIV 211
           W LF  Y K DV V   I +RL+  P+  +  E ++LDQ INDRG  +D+ LA     + 
Sbjct: 180 WNLFKSYNKRDVEVEMAIQQRLQKYPVPKQVWEEYHLDQEINDRGIAIDLELAKQAVALD 239

Query: 212 DVERTKLDQELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTP 271
              R  L   L+  T GL + +  ++ L  WL  + GL  + L +   Q +L + ++   
Sbjct: 240 AKSRESLMAALKERT-GLENPNSVIQMLD-WL-EQHGLKTDSLGKKNVQELLKTAQEPLR 296

Query: 272 QAIQVFNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPR 331
             + +   R + ++S+V K   +      DGR RG  QF GA+RTGR++G     QNLP+
Sbjct: 297 SVLLL---RQKLAKSSVKKYQAMEMTACKDGRARGMFQFYGANRTGRFAGRHIQLQNLPQ 353

Query: 332 ---PSRSH-EELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEAR 387
              P  S   EL +   +    +  D  P  ++S  +R+  +   G K VV+D + IEAR
Sbjct: 354 NHLPDLSEARELVRQGNYEALDLLYDSIP-DVLSQLIRTAFVPRAGMKFVVSDFSAIEAR 412

Query: 388 VLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQ--VTKDQRAIGKVMELALGYQGGA 445
           V++W+AGE+WK + F  G+D+Y +T ++ F V   +  +  + R  GK+ ELA GY G  
Sbjct: 413 VISWLAGERWKSEDFAAGKDIYCSTASQMFGVPVVKHGINGNLRQKGKIAELACGYGGSV 472

Query: 446 KAFQKMASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACER 505
            A + M +   L++                              PE  + +L        
Sbjct: 473 GALKAMGA---LDMGI----------------------------PEEELGNLV------- 494

Query: 506 VKKAWRQKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSG 565
             ++WR  +  + + W ++  A + TI+    +     R      M      L + LPSG
Sbjct: 495 --QSWRSANPHIVDFWWQVDGAVKTTIKQRIPVWVNNIRFFCQSGM------LFIELPSG 546

Query: 566 RSLVYRD--VGNNRSYLNTTTRQ---LTREY----TYGGKLTENIVQAVSRDILAEGMMN 616
           R L Y    +G NR    + T +    T+++    +YG K  ENIVQ +SRDIL   M  
Sbjct: 547 RRLSYVKPRIGENRFGGESVTYEGIGATKKWEQLESYGPKFVENIVQGISRDILCYAMQT 606

Query: 617 ATKAGYDIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
                  IV  VHDE++ E P     +A  +   M   P WA+GL L+A+GY  + Y+K
Sbjct: 607 LRCCA--IVGHVHDELIIECPKDTSVDA--ICEEMGRTPPWAEGLVLRADGYACEFYQK 661


>gi|317132759|ref|YP_004092073.1| DNA-directed DNA polymerase [Ethanoligenens harbinense YUAN-3]
 gi|315470738|gb|ADU27342.1| DNA-directed DNA polymerase [Ethanoligenens harbinense YUAN-3]
          Length = 662

 Score =  280 bits (715), Expect = 7e-73,   Method: Compositional matrix adjust.
 Identities = 219/729 (30%), Positives = 335/729 (45%), Gaps = 122/729 (16%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAEDVC--VILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M T+ ID ET S +DL KCG+ +Y       ++LF +  D  PV++ D      +P+ + 
Sbjct: 1   MKTISIDIETFSDVDLGKCGVYRYCSSPAFEILLFGYSVDGGPVKVVDLACGEKIPEDIL 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACF-----NLDIPIHR----------------WICTL 97
           +AL +  V   A N+ FER  L          LD P H                 W C++
Sbjct: 61  DALTDDTVLKWAFNANFERVCLSRYLRDMGRGLD-PFHDNHPLSLEHARFLNPEGWRCSM 119

Query: 98  VLARSNGLPSALKAVGEALKLSSQKMEEGKELIARF---CKGETHECLYDRNKPNHREA- 153
           V A + GLP +LK VG  L+L+ QKM+EGK LI  F   C          RN P+     
Sbjct: 120 VWAATMGLPLSLKGVGAVLQLADQKMDEGKALIKYFSVPCAPTKANGGRTRNLPSDDPGK 179

Query: 154 WRLFGEYCKGDVTVTREIFKRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIV 211
           W  F +Y + DV V   I ++L   P+     + +++DQ INDRG  +D+ L      + 
Sbjct: 180 WATFKKYNQRDVEVEMMIQRKLRSFPVPDFVWDEYHIDQEINDRGVRIDMDLVEKAIDMD 239

Query: 212 DVERTKLDQELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTP 271
              R++L ++++++T   + +   ++++K WL  + G+ ++ L +     +L   K   P
Sbjct: 240 TRSRSELTEKMQAITN--LENPNSVQQMKQWLS-DNGMEVDSLGKKAVTALL---KTAPP 293

Query: 272 QAIQVFNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPR 331
           +  +V   R + ++S+V K  T+  A+ SD R RG   F GA+RTGRW+G +   QNLP+
Sbjct: 294 ELTEVLELRQQLAKSSVKKYQTMQRAVCSDSRARGMFMFYGANRTGRWAGRLIQLQNLPQ 353

Query: 332 -------------PSRSHEELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVV 378
                         S  +E +  I   +P ++          S  +R+  I  +G +  V
Sbjct: 354 NHLPDLDAARALVKSGDYEAVKMIYEDVPDTL----------SQLIRTAFIPKDGCRFYV 403

Query: 379 ADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFN--VAPAQVTKDQRAIGKVME 436
           AD + IEARV+AW AGE+WK  AF  GED+Y +T  R F+  V    V  + RA GK+ E
Sbjct: 404 ADFSAIEARVIAWYAGEKWKSDAFANGEDIYCSTARRMFHKPVVKHGVNGELRAKGKIAE 463

Query: 437 LALGYQGGAKAFQKMAS-TTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIE 495
           LA GY G   A + M +   GL+ +    +V +                           
Sbjct: 464 LACGYGGSTGALKAMGALEMGLSEDELPDIVSS--------------------------- 496

Query: 496 DLFIGTACERVKKAWRQKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDK 555
                         WR  + ++ + W ++ +A    ++N K       R   L +  +  
Sbjct: 497 --------------WRDANQQIVKFWWDVDKAVMAAVKNHKTT-----RLGRLAFFWQ-A 536

Query: 556 NNLILMLPSGRSLVY--RDVGNNR------SYLNT-TTRQLTREYTYGGKLTENIVQAVS 606
             L + LPSGR+L Y    VG NR      +Y     T++  R  +YG K  ENIVQA S
Sbjct: 537 GMLFITLPSGRNLAYVKPKVGMNRFGGECITYEGVGGTKKWERLESYGPKFVENIVQATS 596

Query: 607 RDILAEGMMNATKAGYDIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAE 666
           RDIL   M        D+ + +HDE+V E       +   L   M   P+WA GL L+A+
Sbjct: 597 RDILCNSMKMLRHC--DVCMHIHDELVIEA--DPRVSLDTLCEQMGRVPAWADGLVLRAD 652

Query: 667 GYESKRYRK 675
           GY    Y+K
Sbjct: 653 GYVCDFYKK 661


>gi|150391701|ref|YP_001321750.1| DNA-directed DNA polymerase [Alkaliphilus metalliredigens QYMF]
 gi|149951563|gb|ABR50091.1| DNA-directed DNA polymerase [Alkaliphilus metalliredigens QYMF]
          Length = 649

 Score =  279 bits (714), Expect = 9e-73,   Method: Compositional matrix adjust.
 Identities = 220/717 (30%), Positives = 342/717 (47%), Gaps = 114/717 (15%)

Query: 1   MATLFIDFETRSPIDLTKCGICKY--AEDVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           + TL  D ET S ++L KCG+ +Y  A+D  ++LFA+  D   V++ D      +P ++ 
Sbjct: 4   IKTLHCDIETYSSVNLAKCGVYRYVQADDFEILLFAYSTDGSEVKIIDLARGEKIPPLIL 63

Query: 59  EALENTDVTIVAHNSYFERTVLKACFN--LDIPIHR------WICTLVLARSNGLPSALK 110
            ALE+  V   AHN+ FER     CF+  L  P+ +      W CT+  A   GLP +L 
Sbjct: 64  SALEDDKVIKYAHNASFERI----CFSRFLGYPVGKYISPESWRCTMTWAAYMGLPLSLV 119

Query: 111 AVGEALKLSSQKMEEGKELIARFCKGETHECLYD----RNKP-NHREAWRLFGEYCKGDV 165
            VG  L L  QKM EGK+LI  FC G       +    RN P +  E W  F  Y   DV
Sbjct: 120 GVGAVLGLGKQKMTEGKDLIRFFC-GPCSPTKTNGNRTRNLPSDDPEKWERFKSYNIRDV 178

Query: 166 TVTREIFKRL--EPLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELE 223
               EI ++L   P+     + ++L + IND G  VD+        + ++  TKL  +++
Sbjct: 179 EAEMEIEQKLIKFPVPDFIWDEYHLSERINDSGIKVDMDFVKQAIAMNEISHTKLMDQMQ 238

Query: 224 SLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAI-QVFNNRMR 282
            +T   + +   ++++K WL  + GL     T+T  ++ ++   K  P+ + +V   R +
Sbjct: 239 EITE--LDNPNSVQQMKDWLS-DNGLE----TDTLGKKAVAELLKDAPEHLAEVLKLRQQ 291

Query: 283 ASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLP-------RPSRS 335
            ++S+V K   +  A+ SDGR+RG   FLGA+RTGR+S  +   QNLP       + +RS
Sbjct: 292 LAKSSVKKYTAMENAVCSDGRIRGMFTFLGANRTGRFSSKIVQLQNLPQNHMMDLKEARS 351

Query: 336 ------HEELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVL 389
                  E L+ +   +P ++          S  +R+  +  EG K +VAD + IEARVL
Sbjct: 352 IVKNGDSEALELLYEDIPDTL----------SQLIRTAFVPKEGNKFIVADFSAIEARVL 401

Query: 390 AWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQ--VTKDQRAIGKVMELALGYQGGAKA 447
           +W+AGEQW+ + F  G D+Y  + ++ F V   +  V    R  GK+ ELALGY G   A
Sbjct: 402 SWLAGEQWRNEVFANGGDIYCASASQMFRVPVEKHGVNAHLRQKGKIAELALGYGGSVGA 461

Query: 448 FQKMASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVK 507
            + M                                         A+E        + + 
Sbjct: 462 LKAMG----------------------------------------ALEMGLEEEELKPLV 481

Query: 508 KAWRQKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRS 567
            AWR  +  + + W ++ +  ++ I+  K   +++ +++   YM      L ++LPSGR 
Sbjct: 482 NAWRASNPNIVKFWWDVDREVKKCIKEKK---SQEVQNIKFHYM---SGMLFIVLPSGRK 535

Query: 568 LVY--RDVGNN------RSYLNT-TTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNAT 618
           L Y   ++G N       +Y     T++  R  +YG K  ENIVQA+SRDIL   M   T
Sbjct: 536 LAYVKPNIGENIFGGESVTYEGVGATKKWERIESYGPKFVENIVQAISRDILMYAM--KT 593

Query: 619 KAGYDIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
            +   IV  VHDE++ E   +   +  M+   M   P WAKGL L A+GYE   Y+K
Sbjct: 594 LSTCSIVAHVHDEVIIEADQS--LSLDMVCKQMGRVPPWAKGLLLDADGYECDFYKK 648


>gi|313898058|ref|ZP_07831597.1| DNA-directed DNA polymerase [Clostridium sp. HGF2]
 gi|312957086|gb|EFR38715.1| DNA-directed DNA polymerase [Clostridium sp. HGF2]
          Length = 646

 Score =  279 bits (713), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 213/712 (29%), Positives = 332/712 (46%), Gaps = 104/712 (14%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M TL ID ET S   L K G+ +Y E  +  ++LFA+  D  PV++ D      +P+ + 
Sbjct: 1   MKTLSIDIETYSDEPLQKTGVYRYVESPNFEILLFAYSVDHQPVQVIDLACGEQIPKEIL 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLD----IPIHRWICTLVLARSNGLPSALKAVGE 114
            ALE+ DV   A N+ FER  L           +    W C++V A + GLP +L+ VG 
Sbjct: 61  LALEDEDVIKWAFNAAFERICLSRFLGYPTGEYLDPESWRCSMVWAATMGLPLSLEGVGA 120

Query: 115 ALKLSSQKMEEGKELIARFCKG---ETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTRE 170
            L L  QK+ EGK+LI  FC+            RN+P H  + W +F +Y   DV     
Sbjct: 121 VLGLEKQKLTEGKDLIKYFCQPCAPTKTNGQRTRNRPFHAPDKWAMFKKYNIRDVETEMG 180

Query: 171 IFKRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYG 228
           I +RL   P+ ++  + +++DQ INDRG  +D+ L     ++    RTKL + ++ +T  
Sbjct: 181 IQQRLARFPVPAQVWDEYHMDQEINDRGVRLDMELVAAAIEMDTRSRTKLTETMKEITE- 239

Query: 229 LVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAV 288
            + +   ++++K WL  + GL  + L +     +L   K   P+  QV   R + ++S+V
Sbjct: 240 -LENPNSVQQMKAWLS-DNGLETDTLGKKAVAELL---KSAPPKLSQVLTLRQQLAKSSV 294

Query: 289 LKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRP-------------SRS 335
            K   + + + +DGR RG  QF GA+RTGR+SG     QNLP+              S +
Sbjct: 295 RKYQAMEKTVCADGRARGMFQFYGANRTGRFSGRNIQLQNLPQNHLSDLAEARSLVRSGN 354

Query: 336 HEELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGE 395
            E ++ +   +P ++          S  +R+  I  EG + +VAD + IEAR++AW AGE
Sbjct: 355 FEAVELLYEDVPDTL----------SQLIRTAFIPREGTQFLVADFSAIEARIIAWFAGE 404

Query: 396 QWKLKAFETGEDLYVTTYARSFNVAPAQ--VTKDQRAIGKVMELALGYQGGAKAFQKMAS 453
           +W+   F  G D+Y  + ++ F V   +  +    R  GK+ ELALGY G   A + M +
Sbjct: 405 KWRQDVFAKGGDIYCASASQMFKVPVEKHGINGHLRQKGKIAELALGYGGSVGALKAMGA 464

Query: 454 -TTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQ 512
              GL  +    LV                                          AWRQ
Sbjct: 465 LDMGLTEDELPPLV-----------------------------------------DAWRQ 483

Query: 513 KHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVY-- 570
            +  + + W  +  A  + ++           +  L +  +    L + LPSGR L Y  
Sbjct: 484 SNPNIVKFWWNVDHAVMEAVK-----FKHTTSEYGLTFSCRS-GMLFITLPSGRKLAYVK 537

Query: 571 RDVGNNR------SYLNT-TTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYD 623
             +G N+      +Y    +T++  R  +YG K  ENIVQA +RDIL   M   T     
Sbjct: 538 PKIGTNKFGGQCITYEGIGSTKKWERLDSYGPKFVENIVQATARDILCYAMQ--TLRCCS 595

Query: 624 IVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           IV+ +HDE+V E   +   +A  +   M   P WAKGL L+A+GY +  Y+K
Sbjct: 596 IVMHIHDEVVIEADPSMSLDA--ICEQMGRTPPWAKGLLLRADGYATPFYKK 645


>gi|298253796|ref|ZP_06977385.1| DNA polymerase I [Gardnerella vaginalis 5-1]
 gi|297532132|gb|EFH71105.1| DNA polymerase I [Gardnerella vaginalis 5-1]
          Length = 674

 Score =  277 bits (708), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 227/731 (31%), Positives = 345/731 (47%), Gaps = 130/731 (17%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           +  L +D ET S ++L KCG+ KYAE  D  ++LF +  D   V++ D      +P+V+ 
Sbjct: 17  LENLSVDLETFSSVNLGKCGVYKYAESEDFEILLFGYSVDGSEVQVVDLAQGETIPEVVL 76

Query: 59  EALENTDVTIVAHNSYFERTVLKACF----------------NLDIPIHRWICTLVLARS 102
            AL +  VT  A N+ FER  L                     L +    W CT++ + +
Sbjct: 77  SALTDETVTKWAFNAQFERICLSRYLRDKGINVNPGQTGKSEGLFLNPSSWHCTMIWSAT 136

Query: 103 NGLPSALKAVGEALKLSSQKMEEGKELIARFC---------KGETHECLYDRNKPNH-RE 152
            GLP +L+ VG  L L  QK+ EGK LI  FC          G T      RNK  H +E
Sbjct: 137 LGLPMSLENVGIVLGLDKQKLTEGKNLIKYFCLPCNPTKVNGGRT------RNKYFHDKE 190

Query: 153 AWRLFGEYCKGDVTVTREIFKRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQI 210
            W  F  Y K DV V   I ++L   P+     + +YLDQ INDRG  +D     +  ++
Sbjct: 191 KWEQFKSYNKRDVEVEMSIQEKLSRFPVPDFLWQEFYLDQEINDRGIGIDSLFVESAIKL 250

Query: 211 VDVE-RTKLDQELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKL 269
            D+E +T L  EL+ +T GL + +  L+ +++WL  + GL +E L +    + L   K +
Sbjct: 251 -DLEVKTHLMSELKRVT-GLENPNSVLQ-MRSWL-KKHGLEMESLGKKEVAKEL---KTV 303

Query: 270 TPQAIQVFNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNL 329
             +  +V   R + ++S+V K   +  A   D R RG  +F GA+RTGR++G +   QNL
Sbjct: 304 GKELAEVLRLRQQLAKSSVKKYTAMKNAACMDYRERGMFRFYGANRTGRFAGRLVQLQNL 363

Query: 330 PR-------PSRSH------EELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKL 376
           P+        +RS       E L+ +   +P ++          S  +R+  I   G K 
Sbjct: 364 PQNHLPDLAEARSLVKQGNVEALEMLYEDIPDTL----------SQLIRTAFIPRTGLKF 413

Query: 377 VVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQ--VTKDQRAIGKV 434
           +VAD + IEARVLAW+AGE+W+++ F  G+D+Y ++ ++ F+V   +  V    R  GK+
Sbjct: 414 IVADFSAIEARVLAWLAGEKWRMRVFAEGKDIYCSSASQMFSVPVEKHGVNGHLRQKGKI 473

Query: 435 MELALGYQGGAKAFQKMAS-TTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHA 493
            ELALGY G   A + M +   GL  +    LV                           
Sbjct: 474 AELALGYGGSVGALKAMGALDMGLTEDELQPLV--------------------------- 506

Query: 494 IEDLFIGTACERVKKAWRQKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKK 553
                          AWR  +  V+ LW ++ +A +Q +    ++     R   +V+  K
Sbjct: 507 --------------DAWRSSNPMVTTLWWDVDRAVKQCVHEHVSV-----RTHNIVFTYK 547

Query: 554 DKNNLILMLPSGRSLVY--------RDVGNNRSYLNT-TTRQLTREYTYGGKLTENIVQA 604
               LI+ LPS R L Y        +  G + +Y    +T++  R  +YG K  ENI QA
Sbjct: 548 S-GFLIIKLPSKRCLYYVKPRVEENKYGGESVTYEGVGSTKKWERLESYGPKFVENITQA 606

Query: 605 VSRDILAEGMMNATKAGYDIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLK 664
           ++RDIL   M   T   Y IV  VHDE + ET  +   +   +  LM   P WA+GL L+
Sbjct: 607 IARDILIYAMQ--TLKEYRIVAHVHDEAIIETDKS--VSVQSVCELMGRTPPWAEGLLLR 662

Query: 665 AEGYESKRYRK 675
           A+GYE + Y+K
Sbjct: 663 ADGYECEFYKK 673


>gi|167761124|ref|ZP_02433251.1| hypothetical protein CLOSCI_03522 [Clostridium scindens ATCC 35704]
 gi|167661243|gb|EDS05373.1| hypothetical protein CLOSCI_03522 [Clostridium scindens ATCC 35704]
          Length = 662

 Score =  276 bits (705), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 221/725 (30%), Positives = 332/725 (45%), Gaps = 114/725 (15%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M TL ID ET S I+L+KCG+ KYAE  D  ++LF +  D   V++ D      +PQ L 
Sbjct: 1   MQTLSIDIETYSSINLSKCGVYKYAEAPDFEILLFGYSVDGCDVKVIDLAQGEHLPQELI 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACF-NLDI---PIH----------------RWICTLV 98
           +AL +  +   A N+ FER  L     +L I   P H                 W C++V
Sbjct: 61  DALTDDSIIKWAFNANFERVCLSRYLRDLGISLDPFHDSHHLSQECSHFLNSESWRCSMV 120

Query: 99  LARSNGLPSALKAVGEALKLSSQKMEEGKELIARF---CKGETHECLYDRNKPNHR-EAW 154
            A + GLP +L+ VG  L L  QK+ EGKELI  F   C          RN+P H  E W
Sbjct: 121 WAATMGLPLSLEGVGSVLGLEKQKLTEGKELIKYFSVPCAPTKANGGRTRNRPFHDPEKW 180

Query: 155 RLFGEYCKGDVTVTREIFKRLEPLSSKEQELWY---LDQTINDRGYCVDVALAHTLNQIV 211
             F  Y   DV     I  RL      E  +WY   +DQ INDRG  +D+ L     ++ 
Sbjct: 181 DAFKRYNIRDVETEMGIKDRLSKFPVPEA-VWYEYHIDQEINDRGVRIDMDLVTEAIEMD 239

Query: 212 DVERTKLDQELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTP 271
              RT+L   ++ +T   + +   ++++K WL    GL     T++  ++V++   K  P
Sbjct: 240 TRSRTELTSAIKKMTD--LENPNSVQQMKQWLS-NNGLE----TDSLGKKVVAELIKTAP 292

Query: 272 QAIQ-VFNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLP 330
             +Q V   R + ++S+V K  T+  A+  DGR RG   F GA+RTGRW+G +   QNLP
Sbjct: 293 PELQNVLELRQQLAKSSVRKYQTMERAVCDDGRARGMFAFYGANRTGRWAGRLIQLQNLP 352

Query: 331 RPSRSHEELDQIITHLPTSITSDPDPLQI--------ISDCVRSCVIASEGKKLVVADLA 382
           +       L+ +        + D D +++        +S  +R+  I     +  V+D +
Sbjct: 353 Q-----NHLEDLADARALVKSGDFDAVKLLYEDVPDTLSQLIRTAFIPKSDTQFYVSDFS 407

Query: 383 GIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQ--VTKDQRAIGKVMELALG 440
            IEARV+AW AGE W+ K F  G D+Y  + ++ F+V   +  +    R  GK+ ELALG
Sbjct: 408 AIEARVIAWYAGETWRQKVFAEGGDIYCASASQMFHVPVEKHGINGHLRQKGKIAELALG 467

Query: 441 YQGGAKAFQKMAST-TGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFI 499
           Y G   A + M +   GL+ +    LV                                 
Sbjct: 468 YGGSIGALKAMGAIEMGLSEDELPPLV--------------------------------- 494

Query: 500 GTACERVKKAWRQKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLI 559
                    AWRQ +  + + W ++ +A  + +++      +       +        L 
Sbjct: 495 --------DAWRQTNPNIVKFWWDVDRAVMEAVKH------KHTTSCYGLTFSCRSGMLF 540

Query: 560 LMLPSGRSLVY--RDVGNNR------SYLNT-TTRQLTREYTYGGKLTENIVQAVSRDIL 610
           + LPSGR+L Y    +G N+      +Y    +T++  R  +YG K  ENIVQA SRDIL
Sbjct: 541 ITLPSGRNLAYVKPKIGTNKFGGECITYEGVGSTKKWERLDSYGPKFVENIVQATSRDIL 600

Query: 611 AEGMMNATKAGYDIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYES 670
              M   T    +IV+ +HDE+V E       +  +L   M   P WA+GL L+A+GY  
Sbjct: 601 CYAM--KTLRNCEIVMHIHDELVIEADPC--MSLDVLCEQMGRTPPWARGLKLRADGYTC 656

Query: 671 KRYRK 675
             Y+K
Sbjct: 657 PFYKK 661


>gi|76786923|ref|YP_329353.1| prophage LambdaSa04, DNA polymerase [Streptococcus agalactiae A909]
 gi|76561980|gb|ABA44564.1| prophage LambdaSa04, DNA polymerase [Streptococcus agalactiae A909]
          Length = 651

 Score =  276 bits (705), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 221/705 (31%), Positives = 330/705 (46%), Gaps = 93/705 (13%)

Query: 4   LFIDFETRSPIDLTKCGICKYAEDVC--VILFAFGFDDHPVELWDCVHDPVMPQVLKEAL 61
           L ID ET   +DL K G+  YAED    ++L A   D+ PV ++D   + +  Q+L +AL
Sbjct: 6   LSIDLETYCEVDLRKSGVYSYAEDDSFEILLLAVSVDNGPVTVYDLTKENLPDQIL-QAL 64

Query: 62  ENTDVTIVAHNSYFERTVLKACFNLDIP---------IHRWICTLVLARSNGLPSALKAV 112
            N  +   A N+ FER  L        P          + W C++V +   GLP +L+ V
Sbjct: 65  VNDSIIKWAFNASFERICLSNWLKKHHPKLLSEGFLSPNSWRCSMVWSAYLGLPLSLEGV 124

Query: 113 GEALKLSSQKMEEGKELIARFC---KGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVT 168
           G  LKL  QK++EG ++I  FC   K         RN P+H  + W  F  Y K DV V 
Sbjct: 125 GTVLKLKEQKLKEGGDVIRYFCLPCKPTKINGGRKRNFPHHAPDKWAAFINYNKRDVEVE 184

Query: 169 REIFKRL--EPLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLT 226
             I  +L   P+     E ++ DQ INDRG  +DV        I +  ++K+ +EL+ LT
Sbjct: 185 LAIKNKLRNHPVPDFLWEEYHQDQNINDRGIGIDVDFVKAAITIDEESKSKIQEELKELT 244

Query: 227 YGLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRS 286
            GL + +  L+ +  WL  E G+    L +   + +L   K +  +  +V   R +A++S
Sbjct: 245 -GLENPNSVLQMI-GWL-REHGVTTNSLDKKAVKELL---KVVDAKTTKVLKLRQQAAKS 298

Query: 287 AVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHL 346
           +V K   +V  +  DGR RG  QF GA+RTGRW+G +   QNLP+      +L +     
Sbjct: 299 SVSKYQAMVNCVCLDGRARGMFQFYGANRTGRWAGRLVQLQNLPQ--NHLPDLKEARDLF 356

Query: 347 PTSITSDPDPL----QIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAF 402
            T      D L      +S  +R+  + S+GKK +V D + IEARVL+ +AGE+W+   F
Sbjct: 357 KTGDLEATDLLYGTQDTLSQLIRTAFVPSDGKKFIVCDFSAIEARVLSHLAGEKWRSMVF 416

Query: 403 ETGEDLYVTTYARSFNVAPAQVTK--DQRAIGKVMELALGYQGGAKAFQKMAST-TGLNL 459
           E G+D+Y  + ++ F V   +  +  D R  GK+ ELA GY G   A + M +   GL+ 
Sbjct: 417 EQGKDIYCMSASQMFGVPVEKHGRNADLRQKGKIAELACGYGGAVGALKAMGAIDMGLDE 476

Query: 460 NTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSE 519
                LV +                                         WRQ +  +  
Sbjct: 477 QELQPLVDS-----------------------------------------WRQANPNIVL 495

Query: 520 LWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVY--RDVGNNR 577
            W ++ +A +       AI  +K+ +   +  K  K  L + LPSGR L Y    +G N+
Sbjct: 496 FWWDVDKAVKT------AIKYQKQTETHGIQFKVRKGMLFITLPSGRKLAYVKPKMGENQ 549

Query: 578 ------SYLNT-TTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHD 630
                 +Y  T T ++  R  +YG K  ENI+QA+SRDILA  M       + IV  VHD
Sbjct: 550 FGGESVTYEGTGTAKRWERLESYGPKFVENIIQAISRDILAYSMKQLKD--FRIVGHVHD 607

Query: 631 EIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           EI+ E   +   N   +  LM   P W   + L+A+GYE   Y+K
Sbjct: 608 EIIIECDQSQ--NLEQIATLMGKAPYWMPDINLRADGYECLFYQK 650


>gi|260161774|emb|CAZ39318.1| phage polymerase [Streptococcus suis]
 gi|313575356|emb|CBR26885.1| hypothetical protein [Streptococcus phage phi-SsUD.1]
          Length = 651

 Score =  275 bits (704), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 214/703 (30%), Positives = 335/703 (47%), Gaps = 89/703 (12%)

Query: 4   LFIDFETRSPIDLTKCGICKYAEDVC--VILFAFGFDDHPVELWDCVHDPVMPQVLKEAL 61
           L ID ET   IDL K G+ +YAED    ++LFA   D+ PV ++D  +   +PQ + EAL
Sbjct: 6   LSIDIETYCEIDLRKSGVYRYAEDDSFELLLFAVSVDNGPVTVYD-FNKEKLPQDILEAL 64

Query: 62  ENTDVTIVAHNSYFERTVLKACFNLDIP---------IHRWICTLVLARSNGLPSALKAV 112
            +  V   A N+ FER  L        P          + W C+++ +   GLP +L+ V
Sbjct: 65  VDDRVIKWAFNASFERICLSNWLKKHHPELLLDGFLSPNSWRCSMIWSAYLGLPLSLEGV 124

Query: 113 GEALKLSSQKMEEGKELIARFC---KGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVT 168
           G  LKL  +KM EG +LI  FC   K         RN P+H    W  F +Y + DV V 
Sbjct: 125 GTVLKLKDKKMREGADLIRYFCVPCKPTKVNGGRIRNFPHHAPNKWSTFIDYNRRDVEVE 184

Query: 169 REIFKRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLT 226
             I +RL+  P+     + ++ DQ INDRG  +D+       +I    + K+ +EL++LT
Sbjct: 185 LAIKERLKNFPVPDFVWDEYHQDQIINDRGIGIDIDFVKAAIKIDSESKAKIQEELKALT 244

Query: 227 YGLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRS 286
              + +   + ++  WL  E G+  + L +   + +L +  + T Q +++   R +A++S
Sbjct: 245 R--LENPNSVLQMIGWL-REHGVTTDSLDKKVVKELLKTADETTAQVLKL---RQQAAKS 298

Query: 287 AVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSH-EELDQIITH 345
           +V K   ++  +  DGR RG  QF GA+RTGRW+G +   QNLP+      EE  ++   
Sbjct: 299 SVSKYQAMMNCVCKDGRARGMFQFFGANRTGRWAGRLVQLQNLPQNHLPDLEEARELFGT 358

Query: 346 LPTSITSD-PDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFET 404
                T    D    +S  +R+  + S+GKK +V D + IEARVL+ +AGE+W+ K FE 
Sbjct: 359 GDLEATEFLYDTQDTLSQLIRTAFVPSKGKKFIVCDFSAIEARVLSHLAGERWRSKVFEQ 418

Query: 405 GEDLYVTTYARSFNVAPAQVTKDQ--RAIGKVMELALGYQGGAKAFQKMAS-TTGLNLNT 461
           G+D+Y  + ++ F V   +  ++   R  GK+ ELA GY G   A + M +   GL    
Sbjct: 419 GKDIYCISASQMFGVPVEKYGQNSELRQKGKIAELACGYGGSVGALKAMGALDMGLKDKE 478

Query: 462 FAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELW 521
              LV +                                         WRQ +  +   W
Sbjct: 479 LRPLVDS-----------------------------------------WRQANPNIVLFW 497

Query: 522 NELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVY--RDVGNNR-- 577
            ++ +A +  I+         + +   +  + +K  L + LPSGR L Y    +G N+  
Sbjct: 498 WDVDRAVKTAIKQ------HIQTETHGIQFEVNKGMLSITLPSGRKLAYVKPKIGENQFG 551

Query: 578 ----SYLNT-TTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEI 632
               +Y  T T ++  R  +YG K  ENIVQA+SRDILA  M    +  ++IV  VHDE+
Sbjct: 552 GESITYEGTGTAKRWERLESYGPKFVENIVQAISRDILAFAMKQLQE--FNIVGHVHDEV 609

Query: 633 VCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           + E       +   + +LM   P W   + L+A+GYE   Y+K
Sbjct: 610 IIECGIDQSLDE--IAYLMGIAPEWMTDIKLRADGYECSFYQK 650


>gi|57233569|ref|YP_180826.1| family A DNA-dependent DNA polymerase [Dehalococcoides ethenogenes
           195]
 gi|57224017|gb|AAW39074.1| DNA-dependent DNA polymerase, family A [Dehalococcoides ethenogenes
           195]
          Length = 646

 Score =  275 bits (704), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 213/708 (30%), Positives = 326/708 (46%), Gaps = 96/708 (13%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M +L ID ET S  +L K G+ +Y E  D  ++LF +  D   V++ D      +P  + 
Sbjct: 1   MKSLSIDIETYSSANLAKSGVYRYVESPDFEILLFGYSVDGGEVQVVDLTSGEKLPSDVI 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLD----IPIHRWICTLVLARSNGLPSALKAVGE 114
            AL +  V   A N+ FER  L     L     I    W C++V A + GLP +L+ VG 
Sbjct: 61  TALTDETVIKWAFNANFERICLSRFLGLPTGKYINPASWKCSMVWAATMGLPLSLEGVGS 120

Query: 115 ALKLSSQKMEEGKELIARF---CKGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTRE 170
            LKL  QK+ EGK+LI  F   C          RN   H  + W  F +Y   D+     
Sbjct: 121 VLKLDKQKLTEGKDLIKYFSQPCAPTKSNGQRTRNHLYHAPDKWSAFKKYNIRDIETEMS 180

Query: 171 IFKRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYG 228
           I ++L   P+     + ++LDQ INDRG  +D+ L      +    R++L   ++ LT  
Sbjct: 181 IQEKLTRFPVQDSIWDEYHLDQEINDRGVALDMTLVQEAIAMDGRSRSELTTAMKHLTE- 239

Query: 229 LVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAI-QVFNNRMRASRSA 287
            + +   ++++K WL  + G+     T+T  +++++   K  P  +  V + R + ++S+
Sbjct: 240 -LDNPNSVQQMKQWL-ADNGME----TDTLGKKIVAELLKTAPLDLADVLSLRQQLAKSS 293

Query: 288 VLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLP 347
           V K   +  A+ +DGR RG  QF GA+RTGRW+G +   QNLP+       L+ +     
Sbjct: 294 VRKYQAMENAVCTDGRARGMFQFFGANRTGRWAGRLIQMQNLPQ-----NHLEDLAEARA 348

Query: 348 TSITSDPDPLQII--------SDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKL 399
                D D L+++        S  +R+  +   G +L+V+D + IEARV+AWMAGE+W+ 
Sbjct: 349 LVRFGDFDALEMLYEDVPDTLSQLIRTAFVPKAGARLIVSDFSAIEARVIAWMAGEEWRQ 408

Query: 400 KAFETGEDLYVTTYARSFNVAPAQ--VTKDQRAIGKVMELALGYQGGAKAFQKMAS-TTG 456
             F  G D+Y  + ++ F V   +  +    R  GK+ ELALGY G   A + M +   G
Sbjct: 409 DVFAKGGDIYCASASQMFKVPVEKHGINGHLRQKGKIAELALGYGGSVGALKAMGALDMG 468

Query: 457 LNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSR 516
           L  +    LV                                          AWRQ +  
Sbjct: 469 LEEDELPQLV-----------------------------------------DAWRQANPC 487

Query: 517 VSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRD--VG 574
           + + W ++ +A  +      A+  ++      +        L + LPSGR L Y    +G
Sbjct: 488 IVKFWWDVDKAAME------AVRYKRTNSTHGITFSCQSGMLFITLPSGRRLAYVKPRIG 541

Query: 575 NNR------SYLNT-TTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLT 627
            N+      +Y     T++  R  +YG K  ENIVQA +RDIL   M   T     IV+ 
Sbjct: 542 ENKFGGQCITYEGVGATKKWERLDSYGPKFVENIVQATARDILCNAMQ--TLQHCSIVMH 599

Query: 628 VHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           VHDEIV E        A  +   M   PSWAKGL L+A+GYE+  Y+K
Sbjct: 600 VHDEIVIEADPRMSLKA--VCEQMGRTPSWAKGLLLRADGYETDFYKK 645


>gi|302876795|ref|YP_003845428.1| DNA-directed DNA polymerase [Clostridium cellulovorans 743B]
 gi|307687477|ref|ZP_07629923.1| DNA-directed DNA polymerase [Clostridium cellulovorans 743B]
 gi|302579652|gb|ADL53664.1| DNA-directed DNA polymerase [Clostridium cellulovorans 743B]
          Length = 663

 Score =  275 bits (702), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 219/734 (29%), Positives = 330/734 (44%), Gaps = 134/734 (18%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           + TL ID ET S IDL KCG+ KY+E  D  V+LFA+  D   V + D  +   +P  + 
Sbjct: 4   IGTLSIDIETYSSIDLAKCGVYKYSESSDSEVLLFAYSVDGGSVIVIDVANGESIPDEIL 63

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIP------------------IHRWICTLVLA 100
           +AL +  V   A N+ FER  L      + P                     W C+++ +
Sbjct: 64  QALVDDSVIKWAFNAAFERVFLSIWLKRNYPELFCSYSIPEDSVGNYLDPSAWRCSMIWS 123

Query: 101 RSNGLPSALKAVGEALKLSSQKMEEGKELIARFCK---------GETHECLYDRNKPNHR 151
              GLP +L+ VG  L L  QK++EGK+LI  FCK         G T      RN P H 
Sbjct: 124 AYMGLPLSLEGVGAVLGLEEQKLKEGKDLIRYFCKPCAATKVNGGRT------RNLPEHA 177

Query: 152 -EAWRLFGEYCKGDVTVTREIFKRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLN 208
            + W LF  Y K DV V   I K+L   P+     E ++LDQ INDRG  +D+ +     
Sbjct: 178 PDKWELFKAYNKRDVEVEMNIQKKLSHYPVPEFVWEEYHLDQEINDRGIALDMDVVENAI 237

Query: 209 QIVDVERTKLDQELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKK 268
           +I  + +  L   ++ LT   + +   + ++K WL    G+  + L +     +L   K 
Sbjct: 238 RIDAISKATLMATMQDLTD--LENPNSVAQMKGWL-AAKGVDTDSLDKKAVIELL---KT 291

Query: 269 LTPQAIQVFNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQN 328
           +      V   R + ++S+V K   +  A+  DGR RG  QF GA+R+GRW+G +   QN
Sbjct: 292 VPTDVADVLTLRQQLAKSSVKKYQAMQNAVCDDGRARGMFQFYGANRSGRWAGRIIQLQN 351

Query: 329 LPR-------------PSRSHEELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKK 375
           LP+              S  +E L+    ++P           ++S+ +R+  I  EG K
Sbjct: 352 LPQNHMEDLDVARDIVKSGDYEILNMFYDNVPG----------VLSELIRTAFIPREGYK 401

Query: 376 LVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQ--RAIGK 433
             VAD + IEARV+A +A E+W++K F    D+Y  + +  F V   +  ++   R  GK
Sbjct: 402 FAVADFSAIEARVIAHLAKERWRMKVFADNGDIYCASASAMFGVPVEKHGQNAHLRQKGK 461

Query: 434 VMELALGYQGGAKAFQKMASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHA 493
           + ELALGY G   A   M +                                        
Sbjct: 462 IAELALGYGGSVGALTSMGA---------------------------------------- 481

Query: 494 IEDLFIGTACERVK---KAWRQKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVY 550
              L +G A E ++    AWR  +  + + W ++  A ++ I   K   A K   +  +Y
Sbjct: 482 ---LDMGLAEEELQPLVDAWRAANPNIVQFWWDVDNAVKRAI---KERTATKTHGIRFIY 535

Query: 551 MKKDKNNLILMLPSGRSLVYRD--VGNNR------SYLNT-TTRQLTREYTYGGKLTENI 601
                  L ++LPSGR L Y    +G N+      +Y    T ++  R  +YG K  ENI
Sbjct: 536 KSA---MLFIVLPSGRRLAYVKPRIGENKFGGESVTYEGVGTNKKWERIESYGPKFVENI 592

Query: 602 VQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGL 661
           VQA+SRDIL   +   +     IV  VHDE++ E        A  +   M   P W +GL
Sbjct: 593 VQAISRDILCYALRTLSHCF--IVGHVHDEVIIECRQDASLEA--ICEQMGRVPEWIEGL 648

Query: 662 PLKAEGYESKRYRK 675
            L+A+GYE++ Y+K
Sbjct: 649 LLRADGYETQFYKK 662


>gi|268610653|ref|ZP_06144380.1| hypothetical protein RflaF_14297 [Ruminococcus flavefaciens FD-1]
          Length = 658

 Score =  274 bits (701), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 221/723 (30%), Positives = 329/723 (45%), Gaps = 114/723 (15%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAED--VCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M T+ ID ETRS  D+TKCG+  YA+     + L +   DD  V+L+D  +   +P+ + 
Sbjct: 1   MKTIEIDLETRSDRDITKCGVYAYADSPYFAITLMSVSIDDGAVQLYDLANGDRVPEDIL 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIP-IHR-----------------WICTLVLA 100
            AL +  V   A N  FER  L      + P I R                 W CT++  
Sbjct: 61  TALVDESVVKRAFNVNFERVCLSRYLREEYPQIFRSYSIDADTVGDYLSPVGWQCTMIHC 120

Query: 101 RSNGLPSALKAVGEALKLSSQKMEEGKELIARFC-KGETHECLYDRNKP-NHREAWRLFG 158
           R+ GL S L + G ALKL  QKM EGK LI  FC   +T + +   + P +  E W  F 
Sbjct: 121 RTLGLSSTLASAGAALKLEQQKMPEGKALIKYFCVPYDTVDGIPQFHSPADAPEKWETFK 180

Query: 159 EYCKGDVTVTREIFKRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERT 216
            Y K DV     I +RL   P+     E +YLDQ INDRG  VD+ L      +    + 
Sbjct: 181 AYNKQDVEAELAIDRRLSRFPVPDFIWEQFYLDQEINDRGIRVDMELVEAALTLDAQAKA 240

Query: 217 KLDQELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQV 276
            L  E+  LT   + +   + +L  WL  E G   + L +   + +L + K      +++
Sbjct: 241 TLSSEMRRLTG--IENPNSVYQLLEWLG-EQGYKSDCLDKAAVKELLKTVKDPVKSVLEL 297

Query: 277 FNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPR---PS 333
              R+  S+S+V K   +  A  SD R RG   F GASRTGRW+G +   QNLP+   P 
Sbjct: 298 ---RLMLSKSSVKKYQAMQTAACSDSRARGMFSFYGASRTGRWAGRIIQLQNLPQNHIPD 354

Query: 334 RS----------HEELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAG 383
            +          ++E++     +P ++          S  +R+  +   G K ++AD + 
Sbjct: 355 LTEARNTVKYGYYDEVEMFYGDVPDTL----------SQLIRTAFVPRPGYKFIIADFSA 404

Query: 384 IEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQ--VTKDQRAIGKVMELALGY 441
           IEARV+AW+AGE+W++ AF  G D+Y  + ++ F V   +  V  + R  GKV ELA GY
Sbjct: 405 IEARVIAWLAGEKWRMDAFANGADIYCASASKMFGVPVVKHGVNGELRQKGKVAELACGY 464

Query: 442 QGGAKAFQKMASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGT 501
            G   A + M     LNL+                D+E                      
Sbjct: 465 GGSVGAMKAMGG-DALNLS----------------DSE---------------------- 485

Query: 502 ACERVKKAWRQKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILM 561
             +++   WR     + + W  +  A ++ I   K  I  +   +   Y  K    L + 
Sbjct: 486 -LKQIVTDWRDASPNIVKFWWTVDDAVKKAI---KQKITTETHGLQFSYQSK---MLFIT 538

Query: 562 LPSGRSLVYR--DVGNNR------SYLNT-TTRQLTREYTYGGKLTENIVQAVSRDILAE 612
           LPSGR L Y    +G N+      +Y+    +++  R  +YG K  ENIVQAV+RD+L  
Sbjct: 539 LPSGRKLCYAHPQIGENQFGGESVTYMGVGASKKWERIESYGPKFVENIVQAVARDLLMF 598

Query: 613 GMMNATKAGYDIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKR 672
            M   T     IV  +HDE++ E       +   +   M   P+WA+GL L+A+GYE + 
Sbjct: 599 SMQ--TMRCCFIVGHIHDEMIIEA--DRRMSLDEVCRQMERTPAWAEGLLLRADGYECEF 654

Query: 673 YRK 675
           YRK
Sbjct: 655 YRK 657


>gi|77412069|ref|ZP_00788395.1| DNA polymerase, putative [Streptococcus agalactiae CJB111]
 gi|77161874|gb|EAO72859.1| DNA polymerase, putative [Streptococcus agalactiae CJB111]
          Length = 651

 Score =  273 bits (698), Expect = 7e-71,   Method: Compositional matrix adjust.
 Identities = 220/705 (31%), Positives = 329/705 (46%), Gaps = 93/705 (13%)

Query: 4   LFIDFETRSPIDLTKCGICKYAEDVC--VILFAFGFDDHPVELWDCVHDPVMPQVLKEAL 61
           L ID ET   +DL K G+  YAED    ++L A   D+ PV ++D   + +  Q+L +AL
Sbjct: 6   LSIDLETYCEVDLRKSGVYSYAEDDSFEILLLAVSVDNGPVTVYDLTKENLPDQIL-QAL 64

Query: 62  ENTDVTIVAHNSYFERTVLKACFNLDIP---------IHRWICTLVLARSNGLPSALKAV 112
            N  +   A N+ FER  L        P          + W C++V +   GLP +L+ V
Sbjct: 65  VNDSIIKWAFNASFERICLSNWLKKHHPKLLSEGFLSPNSWRCSIVWSAYLGLPLSLEGV 124

Query: 113 GEALKLSSQKMEEGKELIARFC---KGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVT 168
           G  LKL  QK++EG ++I  FC   K         RN P+H  + W  F  Y K DV V 
Sbjct: 125 GTVLKLKEQKLKEGGDVIRYFCLPYKPTKINGGRKRNFPHHAPDKWAAFINYNKRDVEVE 184

Query: 169 REIFKRL--EPLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLT 226
             I  +L   P+     E ++ DQ IND G  +DV        I +  ++K+ +EL+ LT
Sbjct: 185 LAIKNKLRNHPVPDFLWEEYHQDQNINDSGIGIDVDFVKAAITIDEESKSKIQEELKELT 244

Query: 227 YGLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRS 286
            GL + +  L+ +  WL  E G+    L +   + +L   K +  +  +V   R +A++S
Sbjct: 245 -GLENPNSVLQMI-GWL-REHGVTTNSLDKKAVKELL---KVVDAKTTKVLKLRQQAAKS 298

Query: 287 AVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHL 346
           +V K   +V  +  DGR RG  QF GA+RTGRW+G +   QNLP+      +L +     
Sbjct: 299 SVSKYQAMVNCVCLDGRARGMFQFYGANRTGRWAGRLVQLQNLPQ--NHLPDLKEARDLF 356

Query: 347 PTSITSDPDPL----QIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAF 402
            T      D L      +S  +R+  + S+GKK +V D + IEARVL+ +AGE+W+   F
Sbjct: 357 KTGDLEATDLLYGTQDTLSQLIRTAFVPSDGKKFIVCDFSAIEARVLSHLAGEKWRSMVF 416

Query: 403 ETGEDLYVTTYARSFNVAPAQVTK--DQRAIGKVMELALGYQGGAKAFQKMAST-TGLNL 459
           E G+D+Y  + ++ F V   +  +  D R  GK+ ELA GY G   A + M +   GL+ 
Sbjct: 417 EQGKDIYCMSASQMFGVPVEKHGRNADLRQKGKIAELACGYGGAVGALKAMGAIDMGLDE 476

Query: 460 NTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSE 519
                LV +                                         WRQ +  +  
Sbjct: 477 QELQPLVDS-----------------------------------------WRQANPNIVL 495

Query: 520 LWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVY--RDVGNNR 577
            W ++ +A +       AI  +K+ +   +  K  K  L + LPSGR L Y    +G N+
Sbjct: 496 FWWDVDKAVKT------AIKYQKQTETHGIQFKVRKGMLFITLPSGRKLAYVKPKMGENQ 549

Query: 578 ------SYLNT-TTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHD 630
                 +Y  T T ++  R  +YG K  ENI+QA+SRDILA  M       + IV  VHD
Sbjct: 550 FGGESVTYEGTGTAKRWERLESYGPKFVENIIQAISRDILAYSMKQLKD--FRIVGHVHD 607

Query: 631 EIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           EI+ E   +   N   +  LM   P W   + L+A+GYE   Y+K
Sbjct: 608 EIIIECDQSQ--NLEQIATLMGKAPYWMPDINLRADGYECLFYQK 650


>gi|304436359|ref|ZP_07396335.1| DNA-directed DNA polymerase [Selenomonas sp. oral taxon 149 str.
           67H29BP]
 gi|304370628|gb|EFM24277.1| DNA-directed DNA polymerase [Selenomonas sp. oral taxon 149 str.
           67H29BP]
          Length = 641

 Score =  272 bits (696), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 214/708 (30%), Positives = 327/708 (46%), Gaps = 101/708 (14%)

Query: 1   MATLFIDFETRSPIDLTKCGICKY--AEDVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M +L +D ETRS +D+ + G+ +Y  AED  ++LF +  D   V++ D V    +PQ + 
Sbjct: 1   MKSLSVDLETRSSVDIGQSGVYRYTEAEDFAILLFGYSVDGGAVQVIDLVRGERIPQEIL 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIH-----------RWICTLVLARSNGLPS 107
           +AL +  V   A N+ FER  L    +    +H            W CT+V +   GLP 
Sbjct: 61  DALADDSVIKWAFNANFERVCLSRYLSDLGMLHTTERAHFLSPRSWRCTMVWSAYMGLPL 120

Query: 108 ALKAVGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTV 167
           +L  V   L L  QKM EGK LI  F     HE       P   E W LF  Y + DV V
Sbjct: 121 SLAVVARVLGLEEQKMTEGKALIRYFSTPPFHE-------PTG-EKWELFKSYNRRDVEV 172

Query: 168 TREIFKRL--EPLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESL 225
              I +RL   P+     E + LDQ INDRG C+D+       +I    + K+   L++L
Sbjct: 173 EMAIQQRLFKYPVPQSVWEEYVLDQEINDRGICLDMPFVENAVKIDAHTKEKMTDRLKTL 232

Query: 226 TYGLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASR 285
           T GL  +   + ++K WL  E G+  E L + T   +L++   L  + +++   R + ++
Sbjct: 233 T-GL-ENPNSVAQMKAWL-KEQGVETESLDKKTVAALLTNVSALLKEVLEL---RQQLAK 286

Query: 286 SAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITH 345
           S+V K   +   + +D R RG  QF GA+RTGR+SG     QNLP+   ++ E  + +  
Sbjct: 287 SSVKKYQAMQNTVCADNRARGMFQFYGANRTGRFSGRHIQLQNLPQNHLANLEYARSLVR 346

Query: 346 ------LPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKL 399
                 L     S  D   ++S  +R+  I  EG+K +VAD + IEARVL+W+A E+W++
Sbjct: 347 QGNFAALELLYESVSD---VLSQLIRTAFIPKEGRKFIVADFSAIEARVLSWLAKERWRM 403

Query: 400 KAFETGEDLYVTTYARSF--NVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMAS-TTG 456
             F    D+Y  T  R F  NV         R  GK  ELA GY G   A +   +  +G
Sbjct: 404 DVFANDGDIYCATAGRMFHCNVVKHGENGHLRQKGKQAELACGYGGSVGALKAFGALESG 463

Query: 457 LNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSR 516
           +  +    LV                                          AWR  +  
Sbjct: 464 MKEDELKPLV-----------------------------------------DAWRTANPN 482

Query: 517 VSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRD--VG 574
           + + W  + +A +  I+  ++I       +  +Y       + + LPSGR L Y    +G
Sbjct: 483 IVDFWWAVDRAAKDCIKE-RSITG--THGIKFIY---QSGMMFIELPSGRRLAYVKPRIG 536

Query: 575 NNR------SYLN-TTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLT 627
            N+      +Y+    +++  R  +YG KL ENI QA+SRD+L   M   T    DIV  
Sbjct: 537 ENQFGGESITYMGLDLSKKWARIESYGPKLVENITQAISRDLLCYAMQ--TLRSMDIVAH 594

Query: 628 VHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           VHDE++ E  +    +++     M   P WA+GL L+A+G+E + Y+K
Sbjct: 595 VHDELIIECDERVSLSSAC--EQMARTPLWAEGLLLRADGFECQFYQK 640


>gi|153581904|emb|CAM34262.1| phage polymerase [Streptococcus pyogenes]
 gi|262113717|emb|CAR95384.1| hypothetical protein [Streptococcus phage phi-m46.1]
          Length = 651

 Score =  271 bits (694), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 220/715 (30%), Positives = 337/715 (47%), Gaps = 113/715 (15%)

Query: 4   LFIDFETRSPIDLTKCGICKYAEDVC--VILFAFGFDDHPVELWDCVHDPVMPQVLKEAL 61
           L ID ET   IDL K G+ +YAED    ++LFA   D+ PV ++D  +   +PQ + EAL
Sbjct: 6   LSIDIETYCEIDLRKSGVYRYAEDDSFELLLFAVSVDNGPVTVYD-FNKEKLPQDILEAL 64

Query: 62  ENTDVTIVAHNSYFERTVLKACFNLDIP---------IHRWICTLVLARSNGLPSALKAV 112
            +  V   A N+ FER  L        P          + W C+++ +   GLP +L+ V
Sbjct: 65  VDDRVIKWAFNASFERICLSNWLKKHHPELLLDGFLSPNSWRCSMIWSAYLGLPLSLEGV 124

Query: 113 GEALKLSSQKMEEGKELIARFC---KGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVT 168
           G  LKL  +KM EG +LI  FC   K         RN P+H  + W  F +Y + DV V 
Sbjct: 125 GTVLKLKDKKMREGADLIRYFCVPCKPTKVNGGRIRNFPHHAPDKWSAFIDYNRRDVEVE 184

Query: 169 REIFKRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLT 226
             I +RL+  P+     + ++ DQ INDRG  +DV       +I    + K+ +EL++LT
Sbjct: 185 LAIKERLKNFPVPDFVWDEYHQDQIINDRGLGIDVDFVKAAIKIDRESKAKIQEELKALT 244

Query: 227 YGLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRS 286
            GL + +  L+ +  WL  E G+  + L +   + +L +  + T Q +++   R +A++S
Sbjct: 245 -GLENPNSVLQMI-GWL-REHGVTTDSLDKKAVKGLLKTVDETTAQVLKL---RQQAAKS 298

Query: 287 AVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHL 346
           +V K   ++  +  DGR RG  QF GA+RTGRW+G +   QNLP+             HL
Sbjct: 299 SVSKYQAMMNCVCKDGRARGMFQFYGANRTGRWAGRLVQLQNLPQ------------NHL 346

Query: 347 PT-------SITSDPDPLQIISDC-------VRSCVIASEGKKLVVADLAGIEARVLAWM 392
           P          T D +  ++I D        +R+  + S+GKK +V D + IEARVL+ +
Sbjct: 347 PDLEEARELFGTGDLEATELIYDTQDTLSQLIRTAFVPSKGKKFIVCDFSAIEARVLSHL 406

Query: 393 AGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQ--RAIGKVMELALGYQGGAKAFQK 450
           AGE+W+ K FE G+D+Y  + ++ F V   +  ++   R  GK+ ELA GY G   A + 
Sbjct: 407 AGERWRSKVFEQGKDIYCMSASQMFGVPVEKHGQNSELRQKGKIAELACGYGGSVGALKA 466

Query: 451 MAS-TTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKA 509
           M +   GL       LV +                                         
Sbjct: 467 MGALDMGLTEEELQPLVNS----------------------------------------- 485

Query: 510 WRQKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLV 569
           WR  +  +   W ++  A +  +   K +I      +     +  +  L + LPSGR L 
Sbjct: 486 WRLANPNIVLYWWDVDNAVKTAV---KELIPTSTHGIQF---EVKRGILFITLPSGRKLA 539

Query: 570 YRD--VGNNR------SYLNT-TTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKA 620
           Y    +G+N+      +Y  T T ++  R  +YG K  ENIVQA+SRDILA  M      
Sbjct: 540 YIKPRIGDNQFGGESVTYEGTGTAKRWERLESYGPKFVENIVQAISRDILAFSMKQLKN- 598

Query: 621 GYDIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
            + IV  VHDE++ E P   + +   +  LM   P W   + L+A+GYE   Y+K
Sbjct: 599 -FKIVGHVHDEVIIECPIEQKLDE--VASLMGIAPDWLSDINLRADGYECFFYQK 650


>gi|50914501|ref|YP_060473.1| phage-related DNA polymerase [Streptococcus pyogenes MGAS10394]
 gi|40218547|gb|AAR83201.1| phage polymerase [Streptococcus pyogenes]
 gi|50261592|gb|AAT72360.1| DNA polymerase [Streptococcus pyogenes]
 gi|50903575|gb|AAT87290.1| phage-related DNA polymerase [Streptococcus pyogenes MGAS10394]
          Length = 651

 Score =  271 bits (693), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 218/705 (30%), Positives = 333/705 (47%), Gaps = 93/705 (13%)

Query: 4   LFIDFETRSPIDLTKCGICKYAEDVC--VILFAFGFDDHPVELWDCVHDPVMPQVLKEAL 61
           L ID ET   IDL K G+ +YAED    ++L A   D+ PV ++D  +   +PQ + EAL
Sbjct: 6   LSIDIETYCEIDLRKSGVYRYAEDDSFELLLIAVSVDNGPVTVYD-FNKEKLPQDILEAL 64

Query: 62  ENTDVTIVAHNSYFERTVLKACFNLDIPIH---------RWICTLVLARSNGLPSALKAV 112
               V   A N+ FER  L        P            W C+++ +   GLP +L+ V
Sbjct: 65  VEDRVIKWAFNASFERICLSNWLKKHHPEFLSDGFLSPVSWRCSMIWSAYLGLPLSLEGV 124

Query: 113 GEALKLSSQKMEEGKELIARFC---KGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVT 168
           G  LKL  QKM EG +LI  FC   K         RN P+H    W  F +Y + DV V 
Sbjct: 125 GTVLKLKDQKMREGADLIRYFCLPCKPTKVNGGRIRNFPHHAPNKWSTFIDYNRRDVEVE 184

Query: 169 REIFKRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLT 226
             I +R++  P+ S     ++ DQ INDRG  +DV       +I    + K+  EL++LT
Sbjct: 185 LAIKERVKNFPVPSFVWNEYHQDQIINDRGIGIDVDFVKAALKIDGESKAKIQAELKTLT 244

Query: 227 YGLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRS 286
            GL   +  L+ + +WL  E G+  + L +   + +L +  + T Q +++   R +A++S
Sbjct: 245 -GLEKPNSVLQMI-SWL-REHGVATDSLDKKAVKELLKTVDETTAQVLKL---RQQAAKS 298

Query: 287 AVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPS----RSHEELDQI 342
           +V K   ++  +  DGR RG  QF GA+RTGRW+G +   QNLP+      +   EL + 
Sbjct: 299 SVSKYQAMMNCVCKDGRARGMFQFFGANRTGRWAGRLVQLQNLPQNHLPDLKEARELFRT 358

Query: 343 ITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAF 402
                T +  D      +S  +R+  + S+GKK +V D + IEARVL+ +AGE+W+ K F
Sbjct: 359 GDLESTELLYDTQ--DTLSQLIRTAFVPSKGKKFIVCDFSAIEARVLSHLAGERWRSKVF 416

Query: 403 ETGEDLYVTTYARSFNVAPAQVTKDQ--RAIGKVMELALGYQGGAKAFQKMAS-TTGLNL 459
           E G+D+Y  + ++ F V   +  ++   R  GK+ ELA GY G   A + M +   GL+ 
Sbjct: 417 EQGKDIYCMSASQMFGVPVEKHGQNSELRQKGKIAELACGYGGSVGALKAMGALDMGLSE 476

Query: 460 NTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSE 519
                LV +                                         WRQ +  +  
Sbjct: 477 EELQPLVNS-----------------------------------------WRQANPNIVL 495

Query: 520 LWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRD--VGNNR 577
            W ++  A +  +   K ++    +++     +     L + LPSGR L Y    +G N+
Sbjct: 496 YWWDVDNAVKTAV---KELLPTSTQNIQF---EVKSGILFITLPSGRKLAYIKPRIGENQ 549

Query: 578 ------SYLNT-TTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHD 630
                 +Y  T T ++  R  +YG K  ENIVQA+SRDILA  M       + IV  VHD
Sbjct: 550 FGGESVTYEGTGTAKRWERLESYGPKFVENIVQAISRDILAFSMKQLND--FKIVGHVHD 607

Query: 631 EIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           E++ E P   + +   +  LM   P W   + L+A+GYE   Y+K
Sbjct: 608 EVIIECPIEQKLDE--VASLMGIAPYWLSDINLRADGYECFFYQK 650


>gi|293401134|ref|ZP_06645278.1| prophage DNA polymerase [Erysipelotrichaceae bacterium 5_2_54FAA]
 gi|291305260|gb|EFE46505.1| prophage DNA polymerase [Erysipelotrichaceae bacterium 5_2_54FAA]
          Length = 646

 Score =  271 bits (692), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 215/714 (30%), Positives = 321/714 (44%), Gaps = 108/714 (15%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M TL ID ET S + L K G+ +Y E  +  ++LFA+  D  PV++ D      +P+ + 
Sbjct: 1   MKTLSIDIETYSDVQLPKTGVYRYCESDNFEILLFAYSIDSQPVQVVDLACGETIPEEII 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIH----RWICTLVLARSNGLPSALKAVGE 114
            ALE+  V   A N+ FER  L          +     W C+++ A + GLP +L+ VG 
Sbjct: 61  AALEDDTVIKWAFNAAFERICLSRFLGYPTGTYLSPESWRCSMIWAATMGLPLSLEGVGA 120

Query: 115 ALKLSSQKMEEGKELIARFCK---GETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTRE 170
            L L  QK+ EGK+LI  FC+            RN+P H  + W  F  Y   DV     
Sbjct: 121 VLGLEKQKLTEGKDLIKYFCQPCAATKANGGRTRNRPFHAPDKWEAFKRYNIRDVETEMG 180

Query: 171 IFKRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYG 228
           I  +L   P+ ++  E +++DQ INDRG  +D+ L      +    R +L   ++ +T  
Sbjct: 181 IQHKLRKFPVPNEVWEEYHIDQEINDRGVRLDMELVSQAIAMDTRSREELTAAIKDMTE- 239

Query: 229 LVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAV 288
            + +   ++++K WL  + G+  + L +     +L   K        V   R + ++S+V
Sbjct: 240 -LENPNSVQQMKQWLS-DNGIETDSLDKKAVAELL---KDAPDNLADVLTLRQQLAKSSV 294

Query: 289 LKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPT 348
            K   + + + SDGR RG  QF GA+RTGR+SG     QNLP+             HLP 
Sbjct: 295 RKYQAMEKTVCSDGRARGMFQFYGANRTGRFSGRNIQLQNLPQ------------NHLPD 342

Query: 349 -------SITSDPDPLQII--------SDCVRSCVIASEGKKLVVADLAGIEARVLAWMA 393
                    + D D ++++        S  +R+  I  E     VAD + IEARV+AW A
Sbjct: 343 LSEARSLVRSGDFDGVELLYEDVPDTLSQLIRTAFIPRENALFYVADFSAIEARVIAWFA 402

Query: 394 GEQWKLKAFETGEDLYVTTYARSFNVAPAQ--VTKDQRAIGKVMELALGYQGGAKAFQKM 451
           GE W+ + FE G D+Y  + ++ F V   +  +    R  GK+ ELALGY G   A + M
Sbjct: 403 GESWRQQVFEKGGDIYCASASQMFKVPVEKHGINGHLRQKGKIAELALGYGGSVGALKAM 462

Query: 452 AS-TTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAW 510
            +   GLN      LV                                          AW
Sbjct: 463 GALDMGLNEEELPALV-----------------------------------------DAW 481

Query: 511 RQKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVY 570
           RQ + R+ E W  + +A  + ++           D  L +  K    L + LPSGR L Y
Sbjct: 482 RQANPRIVEFWWAVDRAVMEAVK-----YKHTTTDYGLTFSCK-SGMLFITLPSGRKLAY 535

Query: 571 --RDVGNNR------SYLNT-TTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAG 621
               +G N+      +Y     T++  R  +YG K  ENIVQA +RDIL   M   T   
Sbjct: 536 VKPKIGTNKFGGSCITYEGVGGTKKWERLDSYGPKFVENIVQATARDILCYAM--KTLRC 593

Query: 622 YDIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
             IV+ +HDE+V E       +A  +   M   P WAKGL L+A+GY +  Y+K
Sbjct: 594 CSIVMHIHDELVIEADPKVSLDA--ICEQMGRTPPWAKGLLLRADGYTTPFYKK 645


>gi|319757792|gb|ADV69734.1| phage polymerase [Streptococcus suis JS14]
          Length = 651

 Score =  270 bits (691), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 216/719 (30%), Positives = 338/719 (47%), Gaps = 121/719 (16%)

Query: 4   LFIDFETRSPIDLTKCGICKYAEDVC--VILFAFGFDDHPVELWDCVHDPVMPQVLKEAL 61
           L ID ET   IDL K G+ +YAED    ++LFA   ++ PV ++D   +  +PQ + EAL
Sbjct: 6   LSIDIETYCEIDLRKSGVYRYAEDDSFEILLFAVSVNNGPVTVYDLSKEK-LPQDILEAL 64

Query: 62  ENTDVTIVAHNSYFERTVLK---ACFNLDIPIHR------WICTLVLARSNGLPSALKAV 112
            +  V   A N+ FER  L      ++ D+ + R      W C+++ +   GLP +L+ V
Sbjct: 65  VDDRVIKWAFNASFERVCLSNWLKKYHPDLLLDRFLSPVSWRCSMIWSAYLGLPLSLEGV 124

Query: 113 GEALKLSSQKMEEGKELIARFC---KGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVT 168
           G  LKL  QKM EG +LI  FC   K         RN P+H  + W  F +Y + DV V 
Sbjct: 125 GTVLKLKDQKMREGADLIRYFCVPCKPTKINGGRTRNLPHHAPDQWATFIDYNRRDVEVE 184

Query: 169 REIFKRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLT 226
             I +RL+  P+     + +  DQ INDRG  +DV       +I    + ++ +EL++LT
Sbjct: 185 LAIKERLKNFPVPDFVWDEYLQDQIINDRGIGIDVDFVKAAIKIDTESKAQIQEELKALT 244

Query: 227 YGLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRS 286
              + +   + ++  WL  E G+  + L +   + +L   K +  +  +V   R +A++S
Sbjct: 245 S--LENPNSVLQMIGWL-REHGVTTDSLDKKAVKELL---KTVDDKTSKVLKLRQQAAKS 298

Query: 287 AVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHL 346
           +V K   ++  +  DGR RG  QF GA+RTGRW+G +   QNLP+             HL
Sbjct: 299 SVSKYQAMMNCVCKDGRARGMFQFYGANRTGRWAGRLVQLQNLPQ------------NHL 346

Query: 347 PT-------SITSDPDPLQIISDC-------VRSCVIASEGKKLVVADLAGIEARVLAWM 392
           P          T D +  +++ D        +R+  + S+GKK +V D + IEARVL+ +
Sbjct: 347 PDLEEARKLFKTGDLEATELLYDTQDTLSQLIRTAFVPSKGKKFIVCDFSAIEARVLSHL 406

Query: 393 AGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQ--RAIGKVMELALGYQGGAKAFQK 450
           AGE+W+ K FE G+D+Y  + ++ F V   +  ++   R  GK+ ELA GY G   A + 
Sbjct: 407 AGEKWRSKVFELGKDIYCMSASQMFGVPVEKHGQNSKLRQKGKIAELACGYGGSVGALKA 466

Query: 451 MAS-TTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKA 509
           M +   GL+      LV +                                         
Sbjct: 467 MGALDMGLSEEELQPLVNS----------------------------------------- 485

Query: 510 WRQKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPL----VYMKKDKNNLILMLPSG 565
           WRQ +  +  LW ++  A +  +          +  +P     +  +     L + LPSG
Sbjct: 486 WRQANPNIVLLWWDVDNAVKTAV----------KEQIPTSTHGIQFEVRSGILFITLPSG 535

Query: 566 RSLVYRD--VGNNR------SYLNT-TTRQLTREYTYGGKLTENIVQAVSRDILAEGMMN 616
           R L Y    +G N+      +Y  T T ++  R  +YG K  ENIVQA+SRDILA  +  
Sbjct: 536 RKLAYIKPRIGENQFGGESVTYEGTGTAKRWERLESYGPKFVENIVQAISRDILAYSLKQ 595

Query: 617 ATKAGYDIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
             +  + IV  VHDE++ E P   + +   +  LM   P W   + L+A+GYE   Y+K
Sbjct: 596 LKE--FKIVGHVHDEVIIECPMEQKIDK--IASLMGIAPDWMSDINLRADGYECLFYQK 650


>gi|313618507|gb|EFR90506.1| DNA polymerase [Listeria innocua FSL S4-378]
          Length = 684

 Score =  270 bits (690), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 215/710 (30%), Positives = 330/710 (46%), Gaps = 100/710 (14%)

Query: 1   MATLFIDFETRSPIDLTKCGICKY--AEDVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M  L ID ET S  +L K G+ +Y  A+D  VILF +  D   V++ D +    +P+ + 
Sbjct: 39  MKNLEIDIETYSSTNLQKSGVYRYVEADDFEVILFGYAVDGDEVKVIDLMDGEKIPKEIL 98

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIH----RWICTLVLARSNGLPSALKAVGE 114
           +AL +  +T  A N+ FER  L          +     W C++V +   GL  +L+ VG 
Sbjct: 99  DALTDETITKWAFNAQFERVCLSRYLGYPTGTYLNPSSWKCSMVWSAYMGLALSLEGVGA 158

Query: 115 ALKLSSQKMEEGKELIARFC---------KGETHECLYDRNKPNHREAWRLFGEYCKGDV 165
            L L  QK+ EGK+LI  FC          G T     D       + W+ F  Y K DV
Sbjct: 159 VLGLEKQKLTEGKDLIRYFCLPCTPTKINGGRTRNLSTD-----EIDKWQQFKAYNKRDV 213

Query: 166 TVTREIFKRLEPLSSKEQELW---YLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQEL 222
               +I +RL      E ++W   +LDQ INDRG  VD+        + D+   KL   +
Sbjct: 214 EAEIQIQQRLIKFPVPE-DIWDEYHLDQEINDRGIKVDMDFVKQAIAMDDISHEKLLTVM 272

Query: 223 ESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMR 282
           + +T   + +   ++++K+WL  E GL +E L +      L   K+   +  +V + R +
Sbjct: 273 QQITN--LDNPNSVQQMKSWL-CENGLEMETLGKKAVAEKL---KETDGELNEVLSLRQQ 326

Query: 283 ASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSH-EELDQ 341
            ++S+V K   +  A+ SD R RG  QF GA+RTGR++G +   QNLP+      +E   
Sbjct: 327 LAKSSVKKYTAMENAVCSDSRARGMFQFYGANRTGRFAGRLVQLQNLPQNHMPDLKEARN 386

Query: 342 IITH-----LPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQ 396
           I+ +     L       PD L   S  +R+  +   G K +VAD + IEARVL+W+AGE 
Sbjct: 387 IVRNGDVETLEMLYEDIPDTL---SQLIRTAFVPRVGHKFIVADFSAIEARVLSWLAGET 443

Query: 397 WKLKAFETGEDLYVTTYARSFNVAPAQ--VTKDQRAIGKVMELALGYQGGAKAFQKMAST 454
           W+ K F +G D+Y  + ++ F V   +  V    R  GK+ ELALGY G   A + M   
Sbjct: 444 WRTKVFASGGDIYCASASQMFKVPVEKHGVNGHLRQKGKIAELALGYGGSVGALKAMG-- 501

Query: 455 TGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKH 514
                                                 A+E        + +  AWR  +
Sbjct: 502 --------------------------------------ALEMGLEEEELKPLVNAWRMSN 523

Query: 515 SRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRD-- 572
             +++ W ++ +A +Q ++  K+      ++   +        L ++LPSGR L Y    
Sbjct: 524 PNITQFWWDVDRAAKQCVKENKS------QETHSIEFHCFSGMLFIVLPSGRRLAYVKPR 577

Query: 573 VGNNR------SYLNT-TTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIV 625
           +G N+      +Y     T++  R  +YG K  ENIVQA+SRDIL   M +     Y IV
Sbjct: 578 IGENQFGGESVTYEGVGGTKKWERLESYGPKFVENIVQAISRDILMHAMKSLRH--YRIV 635

Query: 626 LTVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
             VHDE++ ET    + + + +   M+  P WAKGL L A+GYE   Y+K
Sbjct: 636 AHVHDEVIIET--NPQISVTEVCKQMSQVPPWAKGLLLDADGYECDFYQK 683


>gi|317501098|ref|ZP_07959304.1| DNA-dependent DNA polymerase, family A [Lachnospiraceae bacterium
           8_1_57FAA]
 gi|316897485|gb|EFV19550.1| DNA-dependent DNA polymerase, family A [Lachnospiraceae bacterium
           8_1_57FAA]
          Length = 662

 Score =  270 bits (689), Expect = 7e-70,   Method: Compositional matrix adjust.
 Identities = 216/725 (29%), Positives = 335/725 (46%), Gaps = 114/725 (15%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M TL ID ET S ++L+KCG+ KYAE  D  ++LF +  D   V + D      +PQ + 
Sbjct: 1   MQTLSIDIETYSDVNLSKCGVYKYAESPDFEILLFGYSADGSEVTVIDLAQGEHLPQKII 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACF-----NLDIPIH----------------RWICTL 97
           +AL +  V   A N+ FER  L         +LD P H                 W C++
Sbjct: 61  DALTDDTVIKWAFNANFERVCLSRYLRDLGVSLD-PFHDNHPLSTECARFLNPESWRCSM 119

Query: 98  VLARSNGLPSALKAVGEALKLSSQKMEEGKELIARF---CKGETHECLYDRNKPNHR-EA 153
           V A + GLP +L+ VG  L L  QK+ EGK+LI  F   C          RN P H  + 
Sbjct: 120 VWAATMGLPLSLEGVGAVLGLEKQKLTEGKDLIKYFSVPCAPTKANGGRTRNHPFHAPDK 179

Query: 154 WRLFGEYCKGDVTVTREIFKRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIV 211
           W  F +Y   DV     I  RL   P+     + +++DQ INDRG  +D+ L     ++ 
Sbjct: 180 WEAFKKYNIRDVETEIGIKDRLAKFPVPEAVWDEYHIDQEINDRGVRLDMDLVKEAIEMD 239

Query: 212 DVERTKLDQELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTP 271
              R++L   ++ +T   + +   ++++K WL  + GL     T++  ++V++   K  P
Sbjct: 240 TRSRSELTAAMKDMT--ALDNPNSVQQMKQWLS-DNGLE----TDSLGKKVVAELIKTAP 292

Query: 272 QAIQ-VFNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLP 330
             +Q V   R + ++S+V K  T+  A+  DGR RG   F G +RTGRW+G +   QNLP
Sbjct: 293 PELQTVLELRQQLAKSSVKKYQTMERAVCDDGRARGMFAFYGVNRTGRWAGRLIQLQNLP 352

Query: 331 RPSRSHEELDQIITHLPTSITSDPDPLQII--------SDCVRSCVIASEGKKLVVADLA 382
           +       L  +        + + D ++++        S  +R+  I  +G +  V+D +
Sbjct: 353 Q-----NHLPDLADARALVKSGNFDAVKLLYEDVPDTLSQLIRTAFIPKDGTQFYVSDFS 407

Query: 383 GIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQ--VTKDQRAIGKVMELALG 440
            IEARV+AW AGE W+ K FETG D+Y  + ++ F+V   +  +    R  GK+ ELALG
Sbjct: 408 AIEARVIAWYAGETWRQKVFETGGDIYCASASQMFHVPVEKHGINGHLRQKGKIAELALG 467

Query: 441 YQGGAKAFQKMAST-TGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFI 499
           Y G   A + M +   GL+ +    LV                                 
Sbjct: 468 YGGSVGALKAMGAIEMGLSEDELPPLV--------------------------------- 494

Query: 500 GTACERVKKAWRQKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLI 559
                    AWRQ +  + + W ++ ++  + ++              L +  +    L 
Sbjct: 495 --------DAWRQTNPNIVKFWWDVDRSVMEAVK-----YKHTTSSYGLTFSCR-SGMLF 540

Query: 560 LMLPSGRSLVY--RDVGNNR------SYLNT-TTRQLTREYTYGGKLTENIVQAVSRDIL 610
           + LPSGR+L Y    +G N+      +Y    +T++  +  +YG K  ENIVQA SRDIL
Sbjct: 541 ITLPSGRNLAYVKPKIGTNKFGGECVTYEGIGSTKKWEQLDSYGPKFVENIVQATSRDIL 600

Query: 611 AEGMMNATKAGYDIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYES 670
              M   T     IV+ +HDE+V E       +  +L   M   P WAKGL L+A+GY +
Sbjct: 601 CYAM--KTLRCCSIVMHIHDELVIEA--DPHMSLDVLCEQMGRTPPWAKGLKLRADGYVT 656

Query: 671 KRYRK 675
             Y+K
Sbjct: 657 PFYKK 661


>gi|269975277|gb|ACZ55501.1| DNA polymerase I [Staphylococcus phage SA1]
          Length = 645

 Score =  269 bits (688), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 197/663 (29%), Positives = 308/663 (46%), Gaps = 80/663 (12%)

Query: 53  MPQVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAV 112
           +P  L+EALE+ DV   A N+ FER + +    +  P   W CT+ LA   G    L AV
Sbjct: 22  LPGELREALEDPDVEKWAFNAQFERVMTRRVLGIKTPYKAWRCTMALAYMLGFAGDLLAV 81

Query: 113 GEALKLSSQKME--EGKELIARFCKGE--THECLYD-RNKPNHREAWRLFGEYCKGDVTV 167
           G  + L   K++  EGK LI  F K +  T +  ++ RN+    E W  F +Y   DV  
Sbjct: 82  GTQIGLPEDKLKDPEGKRLIDLFSKPQRVTKKNPFEWRNEATDPEDWWHFCKYNIRDVET 141

Query: 168 TREIFKRL--EPLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESL 225
              I  RL   P+   E +++ LDQ IND G  +D   A++   + +  + ++ +E+  +
Sbjct: 142 ELAIKARLMRYPVLDAEWDMYALDQFINDTGVMIDREFAYSALALAEARKPQIIEEMADI 201

Query: 226 TYGLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVL--SSNKKLTPQAIQVFNNRMRA 283
           T GL ++     +L  WL  E G    DL   T  +V+  +    + P+AI+V   R+ +
Sbjct: 202 T-GL-NNPNSPAQLTPWL-KERGYPFSDLRSDTVNKVIREADENGVDPEAIRVLQMRLNS 258

Query: 284 SRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELD--Q 341
           +++++ K  T+++A   DGR R +LQF GASRT RW+G     QNLPR  +  E++    
Sbjct: 259 AKNSLSKYQTMIDAAGEDGRFRFSLQFAGASRTNRWAGRRIQTQNLPRTPKLIEDVTDLS 318

Query: 342 IITHLPTSITSDP------DPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGE 395
           I+  +      D       +P+  +  C+RS  I + G K +VADL+ IE+ V+ W+   
Sbjct: 319 IVNKMIHQRDLDALTLYVGEPMDALVGCIRSAFIPTPGHKFIVADLSSIESVVIGWLTDC 378

Query: 396 QWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTT 455
           +W +       DLY +  A   ++ P + TK  R+  K   L  GY+ G     +    T
Sbjct: 379 KWFMNTLAAKHDLYRSFAAHWLHL-PYEETKPHRSKAKPATLGAGYRLGGGHMDENGKKT 437

Query: 456 GLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHS 515
           GL                 W  AEN    M +   E +++             A+R    
Sbjct: 438 GL-----------------WGYAENMGVHMTQKEAEESVQ-------------AFRDLCP 467

Query: 516 RVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVY----- 570
            +   W +L  A  + I   +A++         + ++  K  L + LPSGR + Y     
Sbjct: 468 EIVRAWYDLENAVFKVIRTRQAVVWG------CLIIEYTKPFLTIRLPSGRKMYYFRPRL 521

Query: 571 --------RDVGNNRSYLNTTTR----------QLTREYTYGGKLTENIVQAVSRDILAE 612
                   +       Y  T  +          +  + Y++GGKL ENIVQA++RD+LAE
Sbjct: 522 VERQMTVQKGPKKGEKYTKTNFQYEGKVEGSGTKWGKIYSHGGKLVENIVQALARDVLAE 581

Query: 613 GMMNATKAGYDIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKR 672
           G+  A + G+ IV+ +HDEIV E P+        L   M +   WA+GLPL A G+E   
Sbjct: 582 GLKKAHRMGFRIVMHIHDEIVTEVPEDSPLTVDDLISCMAAELPWAEGLPLGAAGWEGYF 641

Query: 673 YRK 675
           YRK
Sbjct: 642 YRK 644


>gi|331083931|ref|ZP_08333040.1| hypothetical protein HMPREF0992_01964 [Lachnospiraceae bacterium
           6_1_63FAA]
 gi|330403356|gb|EGG82916.1| hypothetical protein HMPREF0992_01964 [Lachnospiraceae bacterium
           6_1_63FAA]
          Length = 646

 Score =  269 bits (687), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 217/713 (30%), Positives = 329/713 (46%), Gaps = 106/713 (14%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M  L ID ET S  +L+K G+ +Y E  D  +ILF +  D   V++ D      +P+ + 
Sbjct: 1   MKNLEIDIETYSSANLSKSGVYRYVESPDFEIILFGYSIDGGEVKVVDLACGETIPKEVY 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIH----RWICTLVLARSNGLPSALKAVGE 114
           +ALE+  VT  A N+ FER  L          +     W C++V +   GLP +L+ VG 
Sbjct: 61  DALEDDSVTKWAFNAQFERICLSKFLGYKQGTYLEPDSWKCSMVWSAYMGLPLSLEGVGV 120

Query: 115 ALKLSSQKMEEGKELIARFCKGETHECLYD---RNKPNH-REAWRLFGEYCKGDVTVTRE 170
            L L  QK+ EGKELI  FC       +     RN P+H  E W  F  Y   DV    +
Sbjct: 121 VLGLEKQKLTEGKELIKYFCTPCNPTKVNGGRMRNLPHHDTEKWERFKAYNIRDVEAEMQ 180

Query: 171 IFKRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYG 228
           I  RL+  P+     + ++LDQ INDRG  VD+       +I +V R  L  +++ LT  
Sbjct: 181 IQSRLQKFPVPDFVWDEYHLDQEINDRGIKVDMDFVEKCLEIDNVSRESLMTKMQVLTS- 239

Query: 229 LVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAI-QVFNNRMRASRSA 287
            +++   + ++K WL  + G+     TET  ++ +++     P  + ++   R + ++S+
Sbjct: 240 -LTNPNSVVQMKGWLS-DNGIE----TETLGKKAVAALIDEVPDEMSEILALRQKLAKSS 293

Query: 288 VLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRP-------------SR 334
           V K   +  ++  DGR+RG  QF GA+RTGR++G +   QNLP+              S 
Sbjct: 294 VRKYQAMQNSVCEDGRVRGMFQFYGANRTGRFAGRLVQLQNLPQNHMEDLAEARGLVRSG 353

Query: 335 SHEELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAG 394
            ++ LD +   +P ++          S  +R+  I +  +  +VAD + IEARV+AW AG
Sbjct: 354 DYDSLDLLYDDIPDTL----------SQLIRTAFIPTVNESFIVADFSAIEARVIAWFAG 403

Query: 395 EQWKLKAFETGEDLYVTTYARSFNVAPAQ--VTKDQRAIGKVMELALGYQGGAKAFQKMA 452
           E W+   F  G D+Y  + ++ F V   +  V    R  GK+ ELALGY G   A + M 
Sbjct: 404 ESWRADVFAKGGDIYCASASQMFGVPVEKHGVNGHLRQKGKIAELALGYGGSTGALKAMG 463

Query: 453 S-TTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWR 511
           +   GL                            +E  PE              +  AWR
Sbjct: 464 ALEMGL---------------------------AEEELPE--------------LVSAWR 482

Query: 512 QKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYR 571
             +  +   W ++  A +      KAI ++       V+       L + LPSGR L Y 
Sbjct: 483 CSNPNIVRFWWDVDSAVK------KAIKSKTSTATHGVHFSCRSGMLFITLPSGRVLSYV 536

Query: 572 D--VGNNR------SYLNT-TTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGY 622
              +G N+      +Y    +T++  R  +YG K  ENIVQA SRDIL   M   T    
Sbjct: 537 KPCMGENKFGGESVTYEGVGSTKKWERLESYGPKFVENIVQATSRDILMYAM--KTLRCC 594

Query: 623 DIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
            IV  VHDEI+ E       +A  +   M   P WA+GL L+A+GYE + Y+K
Sbjct: 595 SIVAHVHDEIIIEADPRMSLDA--ICEQMGRTPPWAEGLLLRADGYECQFYKK 645


>gi|332522757|ref|ZP_08399009.1| DNA-directed DNA polymerase [Streptococcus porcinus str. Jelinkova
           176]
 gi|332314021|gb|EGJ27006.1| DNA-directed DNA polymerase [Streptococcus porcinus str. Jelinkova
           176]
          Length = 653

 Score =  269 bits (687), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 219/705 (31%), Positives = 334/705 (47%), Gaps = 91/705 (12%)

Query: 4   LFIDFETRSPIDLTKCGICKYAEDVC--VILFAFGFDDHPVELWDC-VHDPVMPQVLKEA 60
           L ID ET   IDL K G+ +YAED    ++LFA   D+ PV ++D  +    +PQ + E 
Sbjct: 6   LSIDIETYCEIDLRKSGVYRYAEDESFELLLFAVSVDNGPVTVYDLDLTKEKLPQDILET 65

Query: 61  LENTDVTIVAHNSYFERTVLKAC---FNLDI-------PIHRWICTLVLARSNGLPSALK 110
           L +  V   A N+ FER  L      ++ D+       P+  W C+++ +   GLP +L+
Sbjct: 66  LVDNSVIKWAFNASFERICLSNWLKKYHPDLLLDGFLSPVS-WRCSMIWSAYLGLPLSLE 124

Query: 111 AVGEALKLSSQKMEEGKELIARFC---KGETHECLYDRNKPNH-REAWRLFGEYCKGDVT 166
            VG  LKL  QKM EG +LI  FC   K         RN P+H    W  F +Y + DV 
Sbjct: 125 GVGTVLKLKDQKMREGADLIRYFCLPCKPTKVNGGRIRNFPHHASNKWSTFIDYNRRDVE 184

Query: 167 VTREIFKRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELES 224
           V   I +R++  P+ S     ++ DQ IND G  +DV       +I    + K+  EL++
Sbjct: 185 VELAIKERVKNFPVPSFVWNEYHQDQIINDHGIGIDVDFVKAALKIDGESKAKIQAELKA 244

Query: 225 LTYGLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRAS 284
           LT GL + +  L+ + +WL  E G+  + L +   + +L +  + T Q +++   R +A+
Sbjct: 245 LT-GLENPNSVLQMI-SWL-REHGVATDSLDKNAVKELLKTVDETTAQVLKL---RQQAA 298

Query: 285 RSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRS--HEELDQI 342
           +S+V K   ++  +  DGR RG  QF GA+RTGRW+G +   QNLP+       E  D  
Sbjct: 299 KSSVSKYQAMMNCVCKDGRARGMFQFFGANRTGRWAGRLVQLQNLPQNHLPDLKEARDLF 358

Query: 343 ITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAF 402
            T    S     D    +S  +R+  + S+GKK +V D + IEARVL+ +AGE+W+ K F
Sbjct: 359 RTGDLESTELLYDTQDTLSQLIRTAFVPSKGKKFIVCDFSAIEARVLSHLAGERWRSKVF 418

Query: 403 ETGEDLYVTTYARSFNVAPAQVTKDQ--RAIGKVMELALGYQGGAKAFQKMAS-TTGLNL 459
           E G+D+Y  + ++ F V   +  ++   R  GK+ ELA GY G   A + M +   GL+ 
Sbjct: 419 EQGKDIYCMSASQMFGVPVEKHGQNSELRQKGKIAELACGYGGSVGALKAMGALDMGLSK 478

Query: 460 NTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSE 519
                LV +                                         WR  +  +  
Sbjct: 479 EELQPLVNS-----------------------------------------WRLANPNIVL 497

Query: 520 LWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRD--VGNNR 577
            W ++  A +  +   K +I      +     +     L + LPSGR L Y    +G+N+
Sbjct: 498 YWWDVDNAVKTAV---KELIPTSTHGIQF---EVKSGILFITLPSGRKLAYIKPRIGDNQ 551

Query: 578 ------SYLNT-TTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHD 630
                 +Y  + T ++  R  +YG K  ENIVQA+SRDILA  M       + IV  VHD
Sbjct: 552 FGGESVTYEGSGTAKRWERLESYGPKFVENIVQAISRDILAFSMKQLKD--FRIVGHVHD 609

Query: 631 EIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           EI+ E   +   N   +  LM   P W   + L+A+GYE   Y+K
Sbjct: 610 EIIIECDQSQ--NLEQIATLMGKAPYWMPDINLRADGYECFFYQK 652


>gi|268610175|ref|ZP_06143902.1| family A DNA-dependent DNA polymerase [Ruminococcus flavefaciens
           FD-1]
          Length = 654

 Score =  268 bits (684), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 215/725 (29%), Positives = 333/725 (45%), Gaps = 122/725 (16%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAED--VCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M  L ID ET S  D+++CG+ +YAE     ++L ++  D  PV   D      +P  + 
Sbjct: 1   MKQLTIDIETASDEDISECGVYRYAESEYFDLLLVSYSIDGGPVATVDIDSGDTLPDEIL 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIP--------------IHRWICTLVLARSNG 104
            AL +  V   A N  FER  L      + P                 W C ++ +R  G
Sbjct: 61  SALTDKSVIKKAFNVNFERVCLSVYLRRNYPEIAGFEDAVGNYIAPESWHCDMIHSRYLG 120

Query: 105 LPSALKAVGEALKLSSQKMEEGKELIARFC----KGETHECLYDRNKPNHREAWRLFGEY 160
           + S+L  +G+ L+L  +K++EGK+LI  FC      + +   YD  K +  + W+ F EY
Sbjct: 121 MMSSLDDMGKLLRLKEKKLDEGKDLIKYFCTLHQDKQGNLLFYD--KSDAPKKWKEFIEY 178

Query: 161 CKGDVTVTREIFKRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKL 218
            + DV V  +I + L   P+     E +Y+DQ INDRG  VD   A    ++    + +L
Sbjct: 179 NRRDVEVELKIQRLLSEMPVPDFIWEEFYIDQRINDRGILVDTKFAEKAVELDSNVKKEL 238

Query: 219 DQELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFN 278
             +L+ LT   + +     ++K WL +  G+  + L + +   +L+S      + + ++ 
Sbjct: 239 FPKLKELTR--LDNPNSPAQMKDWL-MRQGIEADSLDKKSMPLLLASAPDDVKEVLMLYQ 295

Query: 279 NRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEE 338
              + S+S+V K +T++ A   DGR RG   F GA+RTGR++G +   QNLP+       
Sbjct: 296 ---QLSKSSVSKYHTMLGASCKDGRARGMFNFYGANRTGRFAGRIIQLQNLPQ-----NH 347

Query: 339 LDQIITHLPTSITSDPDPLQ--------IISDCVRSCVIASEGKKLVVADLAGIEARVLA 390
           LD +        + D D ++        ++S  +R+  I  EGKK VVAD + IEARV++
Sbjct: 348 LDNLAETKWLIKSGDLDAVKERFEDIPDVLSQLIRTAFIPPEGKKFVVADFSAIEARVIS 407

Query: 391 WMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQ--VTKDQRAIGKVMELALGYQGGAKAF 448
           W+AGE W+++AF  GED+Y    A+ F V   +  V    R  GK+ ELA GY G   A 
Sbjct: 408 WLAGETWRMEAFANGEDIYCACAAKMFGVPVEKNGVNGHLRQKGKIAELACGYGGSIGAI 467

Query: 449 QKMASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKK 508
           + M  T  LNL                           ++     +ED            
Sbjct: 468 KAMGGTE-LNLT--------------------------DDELYSLVED------------ 488

Query: 509 AWRQKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSL 568
            WR+    + +LW+++     + I +  ++   + +         +   L + LPSGR L
Sbjct: 489 -WRKTSPNIVKLWSDVQSVAVKVITDQSSMTFGRLK------FSYEIGILFIELPSGRRL 541

Query: 569 V-----------------YRDVGNNRSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILA 611
                             Y  VG+N+ +L        R  TYG KL ENI Q ++RD+L 
Sbjct: 542 AYVRPKVEKDDNGKTIITYEGVGDNKKWL--------RLETYGAKLVENITQGIARDLLL 593

Query: 612 EGMMNATKAGYDIVLTVHDEIVCE-TPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYES 670
             M  A     DIV  VHDE++ E  PDT       + HLM   P WA+GL L+A+GYE 
Sbjct: 594 HSM--AAMKDMDIVGHVHDEVIVECDPDT---TVVQVCHLMEQTPDWAEGLLLRADGYEC 648

Query: 671 KRYRK 675
           + Y K
Sbjct: 649 EFYMK 653


>gi|323693311|ref|ZP_08107529.1| DNA-dependent DNA polymerase, family A [Clostridium symbiosum
           WAL-14673]
 gi|323502794|gb|EGB18638.1| DNA-dependent DNA polymerase, family A [Clostridium symbiosum
           WAL-14673]
          Length = 646

 Score =  267 bits (683), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 211/712 (29%), Positives = 326/712 (45%), Gaps = 104/712 (14%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M TL ID ET S   L K G+ +Y E  +  ++LFA+  D   V++ D      +P+ + 
Sbjct: 1   MKTLSIDIETYSDEPLQKTGVYRYVESPNFEILLFAYSVDSQSVQVIDLACGEQIPKEVL 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLD----IPIHRWICTLVLARSNGLPSALKAVGE 114
            ALEN  V   A N+ FER  L           +    W C+++ A + GLP +L+ VG 
Sbjct: 61  LALENETVIKWAFNANFERICLSRFLGYPTGEYLDSESWRCSMIWAATMGLPLSLEGVGA 120

Query: 115 ALKLSSQKMEEGKELIARFCKG---ETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTRE 170
            L L  QK+ EGK+LI  FC+            RN+P H  + W +F +Y   DV     
Sbjct: 121 VLGLEKQKLSEGKDLIKYFCQPCAPTKTNGQRTRNRPFHAPDKWAMFKKYNIRDVETEMG 180

Query: 171 IFKRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYG 228
           I +RL   P+ ++  + +++DQ INDRG  +D+ L     ++    RT+L + ++ +T  
Sbjct: 181 IQQRLAKFPVPAQVWDEYHMDQEINDRGVRLDMELVAAAIEMDTRSRTELTETMKEITE- 239

Query: 229 LVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAV 288
            + +   ++++K WL  + GL  + L +     +L   K  +P+  QV   R + ++S+V
Sbjct: 240 -LENPNSVQQMKAWLS-DNGLETDTLGKKAVTELL---KSASPKLSQVLTLRQQLAKSSV 294

Query: 289 LKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRP-------------SRS 335
            K   + + + +DGR RG  QF GA+RTGR+SG     QNLP+              S +
Sbjct: 295 RKYQAIEKTVCADGRARGMFQFYGANRTGRFSGRNIQLQNLPQNHLPDLAEARSLVRSGN 354

Query: 336 HEELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGE 395
            E +  +   +P ++          S  +R+  I  EG + +VAD + IEARV+AW AGE
Sbjct: 355 FEAVKLLYEDVPDTL----------SQLIRTAFIPREGTQFLVADFSAIEARVIAWFAGE 404

Query: 396 QWKLKAFETGEDLYVTTYARSFNVAPAQ--VTKDQRAIGKVMELALGYQGGAKAFQKMAS 453
           +W+ + F  G D+Y  + ++ F V   +  +    R  GK+ ELALGY G   A + M +
Sbjct: 405 KWRQEVFAKGGDIYCASASQMFKVPVEKHGINGHLRQKGKIAELALGYGGSVGALKAMGA 464

Query: 454 -TTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQ 512
              GL       LV                                          AWRQ
Sbjct: 465 LDMGLTEEELPPLV-----------------------------------------DAWRQ 483

Query: 513 KHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVY-- 570
            +  + + W  +  A  + ++              L +  +    L + LPSGR L Y  
Sbjct: 484 SNPNIVKFWWNVDHAVMEAVK-----FKHTTSSYGLTFSCRS-GMLFITLPSGRKLAYVK 537

Query: 571 RDVGNNR------SYLNT-TTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYD 623
             +G N+      +Y     T++  R  +YG K  ENIVQA +RDIL   M   T     
Sbjct: 538 PKLGTNKFGGQCITYEGIGGTKKWERLDSYGPKFVENIVQATARDILCYAM--KTLRCCS 595

Query: 624 IVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           IV+ +HDE+V E        A  +   M   P WAKGL L+A+GY +  Y+K
Sbjct: 596 IVMHIHDEVVIEADPRMSLEA--VCEQMGRTPPWAKGLLLRADGYATPFYKK 645


>gi|258646421|ref|ZP_05733890.1| prophage LambdaSa04, DNA polymerase [Dialister invisus DSM 15470]
 gi|260403824|gb|EEW97371.1| prophage LambdaSa04, DNA polymerase [Dialister invisus DSM 15470]
          Length = 656

 Score =  267 bits (682), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 212/714 (29%), Positives = 320/714 (44%), Gaps = 98/714 (13%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAEDVC--VILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M  L ID ET S +D+ K G+ KY E     ++LFA+ +D   V + D      +P  + 
Sbjct: 1   MKHLSIDIETFSDVDIKKSGLFKYCESPVFELLLFAYAYDFGDVHVVDLAQGEKIPDSVI 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKL 118
             L N +V   A+N+ FE T L        P  +W CT++     G P+ L  +G AL +
Sbjct: 61  SDLNNPEVIKHAYNASFEITGLNRYGYATSP-EQWRCTMLHGLYLGYPAGLAFLGAALGI 119

Query: 119 --SSQKMEEGKELIARFC---KGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTREIF 172
               +K+  GK LI  FC   K         RN P H  + W LF EY   DV    E +
Sbjct: 120 PEDKRKLSTGKALIRYFCVPCKPTKRNGGRTRNLPKHDIDKWHLFKEYNAQDVVTEMEDY 179

Query: 173 KRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLV 230
           +RL   P+    Q+ W +D  +N RG  +D+ L      I D  +T+L ++   +T    
Sbjct: 180 RRLSAYPVPGWVQDDWVIDYELNRRGIQLDMDLVRGALAIDDQHKTELVEKAIQITGLTN 239

Query: 231 SSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLK 290
            +SR   +L TW+   + L LE LT+ T    L   +    Q  +V + R   ++S++ K
Sbjct: 240 PNSR--NQLLTWINDNSDLKLEKLTKETVAESLQIAED---QVAEVLHIRRALAKSSISK 294

Query: 291 LNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPR-------------PSRSHE 337
             ++  A+ +DGR+RG LQF GA+RTGRW+G +   QNLP               + +  
Sbjct: 295 YESMKNAVCADGRIRGVLQFYGANRTGRWAGRLVQVQNLPHDVPVAMDTAIRLVKNGNAR 354

Query: 338 ELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQW 397
            +  +  H+ TS          +S  +R+  +A EG  L V+D + IEARVL+W+A E+W
Sbjct: 355 GVKLMYGHISTS----------LSHLIRAAFVAPEGSLLCVSDFSAIEARVLSWLADEKW 404

Query: 398 KLKAFETGEDLYVTTYARSFNVAPAQ--VTKDQRAIGKVMELALGYQGGAKAFQKMASTT 455
           +   F  G D+Y  + +  F V   +  +    R  GKV ELALGYQGG  A   M +  
Sbjct: 405 RQDVFAKGGDIYCASASSMFGVPVEKHGINGHLRQKGKVAELALGYQGGPPALITMGA-- 462

Query: 456 GLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHS 515
                                        +++   E  + D+            WR  + 
Sbjct: 463 -----------------------------LKQGLTEDELPDIV---------HRWRGANP 484

Query: 516 RVSELWNELHQAFEQTIENGKAIIARK----RRDVPLVYMKKDKNNLILMLPSGRSLVYR 571
           R+   W ++  A    + + + +         R+  L+Y     + L + LPSGR L Y 
Sbjct: 485 RICGFWYDVDGAALSVMSDARPVGLPHGILISRECNLLY---GYDYLTIRLPSGRKLYYP 541

Query: 572 DVGNNRS--------YLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYD 623
               N +        Y      + +   TYGGKL ENI QA++RD LA  +    KAGY 
Sbjct: 542 QPYINENQFGKPALHYRVQAGIKWSHTSTYGGKLVENITQAIARDCLALAINRLVKAGYK 601

Query: 624 IVLTVHDEIVCETP--DTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
            ++ +HDE+V E P     E     +  +M +   WA GL L A+G+ S  Y K
Sbjct: 602 PLMHIHDEVVLEVPKDKIHEDEIDRINQIMCAPIPWAPGLLLNADGFISPYYTK 655


>gi|227872576|ref|ZP_03990912.1| DNA-directed DNA polymerase [Oribacterium sinus F0268]
 gi|227841577|gb|EEJ51871.1| DNA-directed DNA polymerase [Oribacterium sinus F0268]
          Length = 643

 Score =  266 bits (680), Expect = 8e-69,   Method: Compositional matrix adjust.
 Identities = 221/710 (31%), Positives = 318/710 (44%), Gaps = 103/710 (14%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYA--EDVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M  L ID ET S ID+ K G  +YA  E   ++LFA+ FD   V++ D  +   +P  + 
Sbjct: 1   MRHLSIDIETFSDIDIQKAGAYRYAQSEQFRIMLFAYSFDGEEVQVVDLENGEEIPHFIL 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKL 118
            AL++ +V   A+N+ FE   L  C  +  P+ +W CT+V A    LP+ L   GEAL +
Sbjct: 61  TALQDMEVIKHAYNAAFEWYCLN-CAGIKTPLDQWQCTMVHAMYLSLPAGLANTGEALGI 119

Query: 119 SSQKMEE--GKELIARFCKGETHECLYDRNKPNHREA--WRLFGEYCKGDVTVTREIFKR 174
           +  K +   GK+LI  FC            KP   +A  W+ F EY + DV    EI  R
Sbjct: 120 AEDKKKSAVGKQLIRYFCV-----------KPYKPDAVKWKAFKEYNRQDVVSEMEIENR 168

Query: 175 LE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSS 232
           L   P+   E E W  D  +N  G  VD  L +   +I +    +L  E   LT   + +
Sbjct: 169 LSGFPVPELEWERWRQDIAMNAYGVKVDTELVNGAIKIQEQCEEELLNEAVRLTQ--LEN 226

Query: 233 SRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLN 292
                +L  W+  + G  LE+  + T +  L  +  L  +  +V   R +  +++V K  
Sbjct: 227 PNSPTQLLNWVNAQ-GYPLENTQKATIESALKEDLPLKVR--RVLEIRQQLGKTSVKKYE 283

Query: 293 TLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPR----PSRSHEEL--DQIITHL 346
            +   +    R+RG  QF GAS+TGR+SG +   QNLPR    P     E    Q    L
Sbjct: 284 AMTNTIGEGDRVRGISQFYGASKTGRFSGRLVQMQNLPRNYLEPLAETRECVKRQDYETL 343

Query: 347 PTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGE 406
                S PD L   S  +R+  I S G + VVAD + IEARV+AW+A E W  + F T  
Sbjct: 344 KLLFDSIPDTL---SQLIRTAFIPSTGNQFVVADFSAIEARVIAWLAKETWVQEVFATHG 400

Query: 407 DLYVTTYARSFNVAPAQVTKDQ-----RAIGKVMELALGYQGGAKAFQKMAS-TTGLNLN 460
            +Y  T ++ F+V   ++ K       R  GKV  LALGYQGG  A   M +   GL+  
Sbjct: 401 KIYEATASQMFHVPIEKIAKGNPEYALRQKGKVATLALGYQGGTNALISMGALKMGLS-- 458

Query: 461 TFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSEL 520
                                    +E  PE              +   WR  + R+  L
Sbjct: 459 -------------------------EEELPE--------------IVTRWRAANQRIVAL 479

Query: 521 WNELHQAFEQTIENGKA-----IIARKRRDVPLVYMKKDKNNLILMLPSGRSLVY----- 570
           W+ +     +T+ +G+A     +I R  +D     +K     L + LPS R L Y     
Sbjct: 480 WSAVGSYALRTVRDGRARQVNGLIFRMEQD-----LKHGLRFLTIELPSKRKLFYCKPYI 534

Query: 571 --RDVGNNRSYL---NTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIV 625
                G    Y    N TT++     T+GGKL ENIVQ ++RD L E +   T  GY IV
Sbjct: 535 GLNQFGGESLYFYTQNQTTKKWEESSTFGGKLVENIVQGIARDCLCETLDRITSKGYRIV 594

Query: 626 LTVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
             VHDE++ +     +     L  +M     WAKGL LK  G+  + Y+K
Sbjct: 595 FHVHDEVIVDA--GMDLTVEELCGIMAEPIPWAKGLILKGAGFSGQFYQK 642


>gi|312897720|ref|ZP_07757136.1| DNA-directed DNA polymerase [Megasphaera micronuciformis F0359]
 gi|310621104|gb|EFQ04648.1| DNA-directed DNA polymerase [Megasphaera micronuciformis F0359]
          Length = 654

 Score =  265 bits (678), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 215/708 (30%), Positives = 319/708 (45%), Gaps = 88/708 (12%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M  L ID ET SP D++  G+ KY+E  +  ++LF++ +    V + D      +P  + 
Sbjct: 1   MRHLNIDIETYSPNDIS-FGVYKYSESEEFEILLFSYAYAFGEVHVVDLASGETIPDDVV 59

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKL 118
             L+  +V   A+N+ FE T L         + +W CT++     G P  L  +G+AL L
Sbjct: 60  LDLKRDEVIKHAYNAQFEITCLNRA-GYQTFVEQWRCTMIHGAYLGYPMGLAKLGKALGL 118

Query: 119 SSQKMEE--GKELIARF---CKGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTREIF 172
           +  KM++  G  LI  F   CK         RN P H  + W  +  Y K DV    E +
Sbjct: 119 TQDKMKDKAGAALIRYFSVPCKPTKKNGGRTRNLPKHDPDKWAAYIAYNKQDVVTEMECY 178

Query: 173 KRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLV 230
           +RL   P+  + ++ W +D  +N  G  +D  L      I +  +  L +E   LT GL 
Sbjct: 179 RRLSAFPVPEEVEKQWQVDIRMNATGVGIDRQLVDGALTIDEENKKALLEEAYELT-GL- 236

Query: 231 SSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLK 290
           S+     +L  WL   T L LE LT+ +    ++    L  + + +   R + ++S+V K
Sbjct: 237 SNPNSRNQLLDWLNSNTNLELEKLTKDSVAAAMTDADDLAKKVLTI---RKKLAKSSVSK 293

Query: 291 LNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSI 350
              +  A   DGRLRGTLQF GA+RTGRW+G +   QNLPR   ++ +  + +      +
Sbjct: 294 YEMMASATGQDGRLRGTLQFYGANRTGRWAGRLLQVQNLPRNYITNLDTARSLVKASNRV 353

Query: 351 TSD---PDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGED 407
                  D    +S  +R+ +IA EG  L VAD + IEARV+AW++GE W+ K F  G D
Sbjct: 354 GLGLLFGDVSDTLSQLIRTAIIAKEGYTLCVADFSAIEARVIAWLSGETWRQKVFAEGGD 413

Query: 408 LYVTTYARSFNVAPAQ--VTKDQRAIGKVMELALGYQGGAKAFQKMAS-TTGLNLNTFAH 464
           +Y  + +  F V   +  V    R  GKV ELALGYQGG  A + M +   GL      +
Sbjct: 414 IYCASASSMFGVPVVKHGVNGHLRQKGKVAELALGYQGGVNALKAMGALDMGLTEEELPN 473

Query: 465 LVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNEL 524
           +V                                           WRQ    + + W  +
Sbjct: 474 IVGL-----------------------------------------WRQASPNIVKFWYTV 492

Query: 525 HQAFEQTIENGKAIIARK----RRDVPLVYMKKDKNNLILMLPSGRSLVYRDVG---NN- 576
            +A   T+  G  +        R +V   Y  +    + + LPSGR L Y D     NN 
Sbjct: 493 EKAAVYTVTTGNPMTLDHGITFRLEVDPFYGYR---YMTIELPSGRKLFYPDPHIKLNNF 549

Query: 577 -------RSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVH 629
                  ++ LN        E TYGGKL ENI QAV+RD LA  +M  +  G   ++ +H
Sbjct: 550 DKEAVHFKTQLNNA---WVTESTYGGKLVENITQAVARDCLALTLMRLSGNGLPAIMHIH 606

Query: 630 DEIVCETP--DTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           DE V E P  + DE+   +        P WA+GL L A G+ +  Y K
Sbjct: 607 DEAVIEVPKDEADEYLDIVEKTFALPIP-WAEGLALTAAGFTNDYYMK 653


>gi|154794286|gb|ABS86178.1| DNA polymerase [Glycaspis brimblecombei secondary endosymbiont
           phage 1]
          Length = 415

 Score =  262 bits (669), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 156/418 (37%), Positives = 234/418 (55%), Gaps = 20/418 (4%)

Query: 164 DVTVTREIFKRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQE 221
           D+  TREI++ L    ++  E  LW LDQ IN RG C+DV LA +    V+ E+ +L   
Sbjct: 3   DILATREIYQHLPRWNMNVDETTLWQLDQKINRRGMCMDVELAKSALTAVENEQKRLSTV 62

Query: 222 LESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRM 281
            + LT   V ++   + L   +    G+ L D+  +T QR ++ +  + P   ++ + R+
Sbjct: 63  TQQLTDNAVQNATQRDALLQHITSAFGITLPDMQASTLQRRIN-DPDIPPALRELLSIRL 121

Query: 282 RASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQ 341
           ++ R++  K   L++++++DGRLRGT QF GASRTGRW+G +F P NLPRP+     +D 
Sbjct: 122 QSCRTSTSKYKALLKSISADGRLRGTKQFCGASRTGRWAGRIFQPDNLPRPTLDPNTIDN 181

Query: 342 IITHLPTS---ITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWK 398
            I  L      +  D D +Q+ S  +R C+IA  GKKLV++DL+ IE R+LAW+AGE WK
Sbjct: 182 GIEALKAGCAELICD-DIMQLTSSALRGCIIAPPGKKLVISDLSNIEGRMLAWLAGENWK 240

Query: 399 LKAFE-----TGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMAS 453
           + AF       G+DLY   YAR+FN+ P  VTK QR IGKVMEL LGY GG  AF   A 
Sbjct: 241 VNAFSEFDNGKGDDLYKLAYARAFNLLPENVTKAQRQIGKVMELGLGYGGGVAAFLTFAL 300

Query: 454 TTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQK 513
              L+L   A+    N       +A ++ +   E    + +      T C+ +K+ WR  
Sbjct: 301 AYSLDLAELANAALPNIPLNVKREAISWYQKSVETDKTYGLSKKVFVT-CDSIKRMWRNA 359

Query: 514 HSRVSELWNELHQAFEQTIEN-GKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVY 570
           H++    W ++  A +Q I++ G A   RK      + +++DK+ L + LPSGRSL Y
Sbjct: 360 HTQTVSFWYDIEDAVKQAIQSPGVAFKCRK------LSVRRDKSWLRICLPSGRSLCY 411


>gi|313813472|gb|EFS51186.1| DNA-directed DNA polymerase [Propionibacterium acnes HL025PA1]
 gi|315106933|gb|EFT78909.1| DNA-directed DNA polymerase [Propionibacterium acnes HL030PA1]
          Length = 538

 Score =  261 bits (668), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 205/594 (34%), Positives = 274/594 (46%), Gaps = 84/594 (14%)

Query: 108 ALKAVGEALKLSSQKMEEGKELIARFCKGETHECLYD---RNKPNHRE-AWRLFGEYCKG 163
           +L AVG AL L  QK   GK LI +FC   T   L     RN P+    +W  F +Y + 
Sbjct: 2   SLDAVGAALDLDVQKDTAGKRLIKQFCTPATPSVLNGGGTRNLPSSDPTSWAQFIDYNQR 61

Query: 164 DVTVTREIFKRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQE 221
           DV V   I  RL   P+   E + + LDQ IND G  +D  LA     + D  R      
Sbjct: 62  DVEVELAIHDRLSSFPIPEAEWDAYALDQRINDTGILLDHTLADAAVALDDQHRAATLAR 121

Query: 222 LESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRM 281
              LT GL + +  ++ LK WL    G  +  L +   +  L S    T +  +V   R 
Sbjct: 122 ARELT-GLENPNSPIQ-LKEWLTTH-GCEMSSLAKADVEAALESA---TGKVKEVLELRG 175

Query: 282 RASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQ 341
             ++S+V K   +     +DGR RG +QF GA RTGR++G +   QNLPR      +LDQ
Sbjct: 176 DLAKSSVKKYQAMHNVTGTDGRARGLIQFYGAGRTGRFAGRLVQVQNLPR--NYLPDLDQ 233

Query: 342 IIT--------HLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMA 393
             T         L     S PD L   S  +R+  I S G + +VAD + IEARV+AW+A
Sbjct: 234 ARTLTRQRNLDALELLYDSVPDTL---SQLIRTAFIPSAGCRFIVADYSAIEARVIAWLA 290

Query: 394 GEQWKLKAFETGEDLYVTTYARSFNVAPAQ---VTKDQRAIGKVMELALGYQGGAKAFQK 450
           GE   L AF  G+DLY  T +R F V P +   +  + R  GK+  LA GY G   A + 
Sbjct: 291 GETSTLAAFRDGKDLYCETASRMFGV-PVEKHGINAELRQKGKIATLACGYNGSVGALKA 349

Query: 451 MASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAW 510
           M +   L +    H +K                                      +  AW
Sbjct: 350 MGA---LRMGLAEHELKP-------------------------------------IVDAW 369

Query: 511 RQKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVY 570
           R  +  +  LW ++ QA    I   +A+  R  R         +   L + LPSGR L Y
Sbjct: 370 RAANPNIVRLWADVEQAALDAITTRQAVRLRNLR------FTAESGILFITLPSGRRLAY 423

Query: 571 --RDVGNNR------SYLNTTT-RQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAG 621
               +G NR      +Y   TT R+  R  TYGGKL ENIVQAV+RD+L   M    +AG
Sbjct: 424 VKPQLGENRWGGTSITYSGVTTGRKWGRLETYGGKLVENIVQAVARDLLVHAMTLVAQAG 483

Query: 622 YDIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           + IV+ VHDEIV + P+   F  +    LMT+ P WA GLPL A+GYE   YRK
Sbjct: 484 HKIVMHVHDEIVIDEPEDSGFTIADACQLMTTPPDWAAGLPLDADGYECDYYRK 537


>gi|227498331|ref|ZP_03928481.1| DNA polymerase I [Acidaminococcus sp. D21]
 gi|226903793|gb|EEH89711.1| DNA polymerase I [Acidaminococcus sp. D21]
          Length = 662

 Score =  260 bits (665), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 218/723 (30%), Positives = 325/723 (44%), Gaps = 110/723 (15%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAEDVC--VILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M T+ ID ET S ++L KCG+ KYAE     ++LF +  D   V++ D      +P  + 
Sbjct: 1   MKTISIDIETFSDVNLAKCGVYKYAESPAFEILLFGYAIDGGKVQVVDLARGERIPDDIL 60

Query: 59  EALENTDVTIVAHNSYFERTVLKAC----------FNLDIPIHR----------WICTLV 98
           +AL +  VT  A N+ FER  L             F+   P+ R          W C+++
Sbjct: 61  DALTDESVTKWAFNASFERVCLSRYLRDLRISLDPFHDHHPLSRDCARFLNPAGWKCSMI 120

Query: 99  LARSNGLPSALKAVGEALKLSSQKMEEGKELIARFC---KGETHECLYDRNKPNHR-EAW 154
            +   GLP +L+  G  LKL SQKM+EGK+LI  FC   K         RN P H  + W
Sbjct: 121 WSAYMGLPLSLEGAGAVLKLDSQKMKEGKDLIRYFCVPCKETKLNGGRTRNLPRHAPDKW 180

Query: 155 RLFGEYCKGDVTVTREIFKRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVD 212
            LF  Y K DV V   I +RL+  P+     + ++LDQ INDRG  +D  LA     I  
Sbjct: 181 TLFKSYNKRDVEVEMVIQERLKKYPVPEPIWDEYHLDQEINDRGIAIDRTLAENAIVIDA 240

Query: 213 VERTKLDQELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQ 272
             R  L   L+  T GL + +  ++ +  WL  + G+  + L +   Q +L + ++    
Sbjct: 241 RSRDSLMAVLKGKT-GLENPNSVIQMI-GWL-EQHGMKTDSLGKKQVQELLKTAEEPLRS 297

Query: 273 AIQVFNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPR- 331
            + +   R + ++S+V K   +      D R RG  QF GA+RTGR++G     QNLP+ 
Sbjct: 298 VLLL---RQKLAKSSVKKYQAMEMTACEDSRARGMFQFYGANRTGRFAGRHIQLQNLPQN 354

Query: 332 --PSRSH-EELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARV 388
             P  +   EL +   +    +  D  P  ++S  +R+  +  +G K VV+D + IEARV
Sbjct: 355 HLPDLAEARELVRQGNYEALELLYDSIP-DVLSQLIRTAFVPRKGMKFVVSDFSAIEARV 413

Query: 389 LAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQ--VTKDQRAIGKVMELALGYQGGAK 446
           L+W+AGE W+L  F    D+Y  + +  F V   +  V    R  GK+ ELALGY G   
Sbjct: 414 LSWLAGETWRLDVFARNGDIYCASASSMFGVPVEKHGVNGHLRQKGKIAELALGYGGSTG 473

Query: 447 AFQKMAS-TTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACER 505
           A + M +   GL  N    LV++                                     
Sbjct: 474 ALKAMGALDMGLTENELYPLVQS------------------------------------- 496

Query: 506 VKKAWRQKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPL----VYMKKDKNNLILM 561
               WR  +  + + W ++    +  I          +  +P+    +        L + 
Sbjct: 497 ----WRSANPHIVDFWWQVDATVKTAI----------KEQIPMRAGCIRFLCQSGMLFIQ 542

Query: 562 LPSGRSLVYRD--VGNNR------SYLNT-TTRQLTREYTYGGKLTENIVQAVSRDILAE 612
           LPSGR L Y    +G NR      +Y     T++  R  +YG K  ENIVQ +SRDIL  
Sbjct: 543 LPSGRRLSYVKPRIGENRFGGESVTYEGIGATKKWERLESYGPKFVENIVQGISRDILCY 602

Query: 613 GMMNATKAGYDIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKR 672
            M         IV  VHDE++ E       +A  +   M   P WA+GL L+A+GYE + 
Sbjct: 603 AMQTLRCCA--IVGHVHDELIIECSRDASVDA--ICEQMGRTPPWAEGLLLRADGYECEF 658

Query: 673 YRK 675
           Y+K
Sbjct: 659 YQK 661


>gi|217965857|ref|YP_002351535.1| DNA polymerase [Listeria monocytogenes HCC23]
 gi|217335127|gb|ACK40921.1| DNA polymerase [Listeria monocytogenes HCC23]
          Length = 545

 Score =  260 bits (665), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 185/599 (30%), Positives = 282/599 (47%), Gaps = 89/599 (14%)

Query: 104 GLPSALKAVGEALKLSSQKMEEGKELIARFC---KGETHECLYDRNKPNH-REAWRLFGE 159
           GLP++L  + +AL+L+ +K  EGK LI  FC   K         RN P H  E W  F E
Sbjct: 8   GLPASLDMMSKALRLAQEKDNEGKALIRYFCMPCKPTKANGGRTRNYPEHASEKWAKFIE 67

Query: 160 YCKGDVTVTREIFKRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTK 217
           YC+ DV V R I K++   P    EQ  W LDQ I D+G  +DV L        +  +  
Sbjct: 68  YCRQDVVVERSIAKKIAKFPFPEDEQRNWELDQRIADKGVRIDVDLVKHAIACQERYQAS 127

Query: 218 LDQELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVF 277
           L ++ + LT GL  +   +++LK WL  + G  +  L + +   +L+ ++ L     ++ 
Sbjct: 128 LSKKAKGLT-GL-ENPNSVQQLKDWL-ADMGYPVSSLNKDSVSELLA-DEDLDEDVREML 183

Query: 278 NNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPR------ 331
             R   S++++ K   +  A   DGR+RG LQF GA+RTGRW+G +   QNLPR      
Sbjct: 184 LLRQEMSKTSIKKYEKMQHARCHDGRVRGLLQFNGANRTGRWAGRLVQVQNLPRNYIKDI 243

Query: 332 -------PSRSHEELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGI 384
                   +  +E  + + +++P           ++S  +R+  IA +G    + D + I
Sbjct: 244 AEVRKDLKAGDYEAFEMMYSNVP----------DVLSQLIRTAFIAEDGYTFDITDFSAI 293

Query: 385 EARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGG 444
           EARV+AW+AGEQW+L  F +   +Y  + ++ F++   +V K+ R  GKV ELALGY GG
Sbjct: 294 EARVIAWLAGEQWRLDVFNSHGKIYEASASQMFHIPIEEVDKNLRQKGKVSELALGYNGG 353

Query: 445 AKAFQKMAS-TTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTAC 503
             A   M +   GL  N    +V                                     
Sbjct: 354 VNALIAMGALEMGLKENELQGIV------------------------------------- 376

Query: 504 ERVKKAWRQKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLP 563
                AWR+    ++ LW  + +  +  I   K   ++K + +   Y   +   L + LP
Sbjct: 377 ----DAWRKASPAITSLWRGVEKHAKLAISTRK---SQKYKGLTFYY---EAGILFIKLP 426

Query: 564 SGRSLVY-------RDVGNNRSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMN 616
           SGR+L Y          G    Y   T +   ++YTYGGKL ENIVQA++RD LA  +  
Sbjct: 427 SGRNLAYFRAKLVPGKYGPQICYEGVTDKGWRKQYTYGGKLVENIVQAIARDCLAISLRR 486

Query: 617 ATKAGYDIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
               G D V+ VHDE + E  ++ E +   L  ++    SWA GLPL+ +G+ S  Y K
Sbjct: 487 IEDTGIDTVMHVHDEAITEVQES-ESSVDKLNAILAEPISWAPGLPLQGDGFSSDFYMK 544


>gi|197303496|ref|ZP_03168535.1| hypothetical protein RUMLAC_02218 [Ruminococcus lactaris ATCC
           29176]
 gi|197297494|gb|EDY32055.1| hypothetical protein RUMLAC_02218 [Ruminococcus lactaris ATCC
           29176]
          Length = 661

 Score =  260 bits (664), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 214/728 (29%), Positives = 326/728 (44%), Gaps = 122/728 (16%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M  L ID ET S ID++KCG  KYAE  +  ++LF    D+ PV ++D      +P  + 
Sbjct: 2   MKELSIDLETYSDIDISKCGAYKYAESNNFEILLFGVSVDNGPVVVYDLASGDEIPAEIL 61

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIH------------------RWICTLVLA 100
            AL + ++   A N+ FER  L        P +                   W CT++ +
Sbjct: 62  AALSDENIIKWAFNASFERVCLSNWLRKHHPEYFKTYNTQGDPVQNFLDPASWKCTMIWS 121

Query: 101 RSNGLPSALKAVGEALKLSSQKMEEGKELIARFC---KGETHECLYDRNKPNHR-EAWRL 156
              GLP +L+ VG  LKL  QKM+EGK+LI  FC   K         RN P H  + W  
Sbjct: 122 AYMGLPLSLEGVGAVLKLQDQKMKEGKDLIKYFCSPCKPTKVNGGRTRNLPEHAPDKWET 181

Query: 157 FGEYCKGDVTVTREIFKRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVE 214
           F  Y + DV V   I +RL   P+       +++DQ IND G  +D+ +    N I   E
Sbjct: 182 FKTYNRRDVEVELAIKQRLSKFPVPDSVWHEYHIDQEINDSGIMLDMDVVE--NAIAFDE 239

Query: 215 RTK--LDQELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQ 272
           R+K  L   ++++T   + +   + ++K WL  + G+  E L +     ++        +
Sbjct: 240 RSKSALITAMKNITN--LDNPNSVVQMKQWLS-DNGVETESLGKKEVAGLIKETDGDISK 296

Query: 273 AIQVFNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRP 332
           A+++   R++ ++S+V K   +  A+  DGR  G  QF GA+R+GRW+G +   QNLP+ 
Sbjct: 297 ALKL---RLQLAKSSVKKYQAMQNAVCKDGRAHGMFQFYGANRSGRWAGRLIQLQNLPQN 353

Query: 333 SRS-------------HEELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVA 379
             S             ++ LD +   +P ++          S  +R+  IA  G K +V+
Sbjct: 354 HMSDLTEARELVRTGDYDTLDMLYDDIPDTL----------SQLIRTAFIARPGYKFIVS 403

Query: 380 DLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQ--VTKDQRAIGKVMEL 437
           D + IEARVLA +AGE W+ K F  G+D+Y  + ++ F V   +  +    R  GK+ EL
Sbjct: 404 DYSAIEARVLAHLAGETWRSKVFAEGKDIYCASASQMFGVPVKKHGINSHLRQKGKIAEL 463

Query: 438 ALGYQGGAKAFQKMAS-TTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIED 496
           ALGY G   A + M +   GL       LV +                            
Sbjct: 464 ALGYGGSVGALKSMGALEMGLTEEELQPLVDS---------------------------- 495

Query: 497 LFIGTACERVKKAWRQKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKN 556
                        WR  +  ++  W  +  A +  I   K  I  +   +   Y      
Sbjct: 496 -------------WRSSNPMITAFWWNVDNAIKTAI---KMHIPTEVNGIHFCY---KSG 536

Query: 557 NLILMLPSGRSLVY--RDVGNNR------SYLNT-TTRQLTREYTYGGKLTENIVQAVSR 607
            L++  PSGR L Y    +G NR      +Y    +T++  R  +YG K  ENIVQAVSR
Sbjct: 537 MLLIKRPSGRVLSYVKPKIGENRFGGESVTYEGIGSTKKWERIESYGPKFVENIVQAVSR 596

Query: 608 DILAEGMMNATKAGYDIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEG 667
           DIL   M   T     IV  VHDE++ E     + N   +   M  +  W  G+ L+A+G
Sbjct: 597 DILCNAM--KTLRHCFIVGHVHDELIIECSSGVDLNE--ICKQMGRSLDWMPGILLRADG 652

Query: 668 YESKRYRK 675
           YE+  Y+K
Sbjct: 653 YETNFYKK 660


>gi|167746061|ref|ZP_02418188.1| hypothetical protein ANACAC_00756 [Anaerostipes caccae DSM 14662]
 gi|167654576|gb|EDR98705.1| hypothetical protein ANACAC_00756 [Anaerostipes caccae DSM 14662]
          Length = 663

 Score =  258 bits (658), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 211/720 (29%), Positives = 335/720 (46%), Gaps = 106/720 (14%)

Query: 1   MATLFIDFETRSPIDLTKCGICKY--AEDVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           + T+ ID ET S +DL KCG+ KY  ++   ++LF +  D   V + D      +P  + 
Sbjct: 4   IKTISIDIETYSDVDLQKCGVYKYVQSDSFEILLFGYSVDGGEVSVVDLKQGEKIPMEII 63

Query: 59  EALENTDVTIVAHNSYFERTVL---------KACFNLDIP---------IHRWICTLVLA 100
            AL + ++T  A N+ FER  L         K   +  IP            W C++V +
Sbjct: 64  MALTDENITKWAFNANFERVCLSEYLRRFYPKKFVSYSIPEDSVGNYLDPSSWKCSMVWS 123

Query: 101 RSNGLPSALKAVGEALKLSSQKMEEGKELIARFC---KGETHECLYDRNKPNHRE-AWRL 156
              GLP  L   G  L L  QK+ EGKELI  FC   K         RN P H    W +
Sbjct: 124 AYMGLPLLLAGAGAVLGLEEQKLTEGKELIRYFCVPCKPTKVNGGRTRNLPQHDMIKWEM 183

Query: 157 FGEYCKGDVTVTREIFKRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVE 214
           F +Y K DV V   I  +L   P+ +   E ++LDQ INDRG  +D+ +    N I   E
Sbjct: 184 FKKYNKRDVEVEMSIQDKLRHFPVPNFVWEEYHLDQEINDRGITLDMDV--VTNAIAFDE 241

Query: 215 RTK--LDQELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQ 272
           ++K  L  +++ +T GL  +   ++++K WL    GL ++ L +     VL++     P+
Sbjct: 242 KSKAVLADKMQEMT-GL-ENPNSVQQMKQWLSC-NGLEMDSLGKKEVAAVLNT----APE 294

Query: 273 AIQ-VFNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPR 331
            ++ V   R + ++S+V K   +  A+ SDGR RG   F GA+R+GRW+G +   QNLP+
Sbjct: 295 PLKTVLTLRQQLAKSSVKKYQAMANAVCSDGRARGMFMFYGANRSGRWAGRLIQLQNLPQ 354

Query: 332 PSRSH-EELDQII---THLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEAR 387
              S  EE   ++    +   ++  D  P   +S  +R+  +  +G + +V+D + IEAR
Sbjct: 355 NHMSDLEEARSLVKQGNYEAMNMLYDDVP-DTLSQLIRTAFVPRKGMEFIVSDFSAIEAR 413

Query: 388 VLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQ--VTKDQRAIGKVMELALGYQGGA 445
           VL+ +AGE+W+   F +G D+Y  + ++ F V   +  V    R  GK+ ELALGY G  
Sbjct: 414 VLSHLAGEKWRTDVFASGGDIYCASASQMFKVPVEKHGVNGHLRQKGKIAELALGYGGSV 473

Query: 446 KAFQKMAS-TTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACE 504
            A + M +   GL  +    LV                                      
Sbjct: 474 GALKSMGALDMGLEEDELKPLVDM------------------------------------ 497

Query: 505 RVKKAWRQKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPS 564
                WR+ +  + +LW ++ +A +      KA+  R+   +  +        L + LPS
Sbjct: 498 -----WREANPNIVKLWWDVDRAVK------KAVKQREPSSIGSITFSYKSGMLFIGLPS 546

Query: 565 GRSLVY--RDVGNNRSYLNTT-------TRQLTREYTYGGKLTENIVQAVSRDILAEGMM 615
           GR L Y    +G N+    +        T++  R  +YG K  ENIVQA+SRDIL   + 
Sbjct: 547 GRCLSYVKPKMGINQFGSESVTYEGVGGTKKWERIESYGPKFVENIVQAISRDILMYAIR 606

Query: 616 NATKAGYDIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
             +     I   VHDE++ E   +   +  ++   M   P W +G+ L+A+GYE++ Y+K
Sbjct: 607 TLSHCF--ICGHVHDELIIEC--SKSVSLDVICEQMGRTPPWIEGILLRADGYETEFYKK 662


>gi|34610177|ref|NP_919002.1| DNA polymerase I [Burkholderia phage BcepNazgul]
 gi|34304552|gb|AAQ63369.1| DNA polymerase I [Burkholderia phage BcepNazgul]
          Length = 693

 Score =  251 bits (641), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 209/729 (28%), Positives = 333/729 (45%), Gaps = 102/729 (13%)

Query: 6   IDFETRSPIDLTKCGICKYA--EDVCVILFAFGFDDHPVELWDCVHDPVMPQVLKEALEN 63
           +D+E+RS  DL  CG+  Y+  E   +++ ++ F+   V+ W+ + D   P  ++EALE+
Sbjct: 7   LDYESRSEEDLPTCGLDIYSAHESTEILMASWSFNGGRVQQWE-IRDGKFPAEVREALED 65

Query: 64  TDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKLSSQKM 123
            +V   A N+ FER + +    ++ P   W CT+  A        L+ VG  L L   K+
Sbjct: 66  PNVIKRAWNAQFERVMTRRVLKINTPYKNWRCTMARAYMLSFAGNLEMVGGQLGLPQDKV 125

Query: 124 E--EGKELIARFCKGE------THECLYDRNKPNHREAWRLFGEYCKGDVTVTREIFKRL 175
           +   GK+LI  F K +       H+ L  +  P     W  F  Y + DV     I + L
Sbjct: 126 KLATGKKLINLFSKPQRITKKNPHKWLDWQTNPFE---WDDFLIYNQQDVIAEAAIDEWL 182

Query: 176 EPLSS--KEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSSS 233
            P  +  +E EL+ LDQ INDRG  VD+   ++   + D  + +L +++ ++T GL  + 
Sbjct: 183 APYPTLDEEWELYELDQLINDRGVPVDLDFCNSATAMADRRKLELVRQMRAIT-GL-ENP 240

Query: 234 RCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKK---LTPQAIQVFNNRMRASRSAVLK 290
              ++LK W+    G   +DL + T ++VL+ +K    LT +  +V   RM+++R++V K
Sbjct: 241 NSPQQLKPWV-KARGYRFDDLGKDTVKKVLAEHKDEPVLTGRCDEVLKMRMQSARTSVGK 299

Query: 291 LNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHE---ELDQIITHLP 347
               V  +    RLR  LQF GA RT RW+G      NL R  ++ E   + D  +  + 
Sbjct: 300 YKKFVSLVGPGRRLRFPLQFGGAQRTQRWAGRGVQVHNLGRTPKALEPDGDNDWALCTVT 359

Query: 348 TSITSD---------PDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWK 398
            +I +           +P+  ++ CVRS + A EG + V  DL+ IE  V+AW+A  Q  
Sbjct: 360 NAIRAGDYDLLGLMMKEPMDGLAGCVRSAIYAPEGYEFVTCDLSSIETVVIAWLADCQPL 419

Query: 399 LKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLN 458
           L  F  G   Y     R + V   +VT   R + K   L  GY+ G          TGL 
Sbjct: 420 LNVFREGRCAYREFATRLYGVEYPEVTSQMRTMSKPAVLGAGYRLGGGDLSHEGKRTGL- 478

Query: 459 LNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVS 518
                           W  AEN    M       ++             K +R+ +  V 
Sbjct: 479 ----------------WGYAENMGIDMSRQEAHDSV-------------KMYREAYPEVP 509

Query: 519 ELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYR------- 571
           +LW +L  A  +TI+  KA+   +     +V        L+ +LPSGR + Y        
Sbjct: 510 QLWKDLEAAIIRTIKT-KAVTRVRYVSFEIV-----GEFLVAILPSGRRMYYHRPRIEKK 563

Query: 572 ---------------DVGNNRSY---------LNTTTRQLTREYTYGGKLTENIVQAVSR 607
                          + G+ ++Y          N   ++  R+ ++GGK+TEN+VQA++R
Sbjct: 564 KFQKKNWKTGELLWNEDGSPQTYEKIGFSYMGFNQDIKKWLRQDSHGGKMTENLVQAIAR 623

Query: 608 DILAEGMMNATKAGYDIVLTVHDEIVCETPDTDEFNA-SMLYHLMTSNPSWAKGLPLKAE 666
           +IL  G+ NA K G +IVL VHDEIV      D      +L   MT+   W + +P+ A 
Sbjct: 624 EILKYGLFNAHKKGLNIVLHVHDEIVTLRKIGDASKGLHVLKECMTAKRKWYEEMPVGAA 683

Query: 667 GYESKRYRK 675
           G+ +  YRK
Sbjct: 684 GWSAAFYRK 692


>gi|159146215|gb|ABW90571.1| DNA polymerase [Bacteriophage APSE-2]
          Length = 370

 Score =  251 bits (641), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 147/374 (39%), Positives = 211/374 (56%), Gaps = 20/374 (5%)

Query: 182 EQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSSSRCLEKLKT 241
           E ELW LDQ IN RG C+DV LA +    V+ E+ +L    + LT   V ++   + L  
Sbjct: 3   ETELWQLDQKINRRGMCMDVELAKSALTAVENEQKRLSTVTQQLTDNAVQNATQRDALLQ 62

Query: 242 WLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLNTLVEAMNSD 301
            +    G+ L D+  +T QR ++ +  + P   ++ + R+++  ++  K   L++++++D
Sbjct: 63  HIASAFGITLPDMQASTLQRRIN-DPDIPPALRELLSVRLQSCTTSTSKYKALLKSVSAD 121

Query: 302 GRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTS---ITSDPDPLQ 358
           GRLRGT QF GASRTGRW+G VF P NLPRP+     +D  I  L      +  D D +Q
Sbjct: 122 GRLRGTKQFCGASRTGRWAGRVFQPDNLPRPTLDPNTIDNGIEALKAGCAELICD-DIMQ 180

Query: 359 IISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFE-----TGEDLYVTTY 413
           + S  +R C+IA  GKKLV++DL+ IE R+LAW+AGE WK+ AF       G+DLY   Y
Sbjct: 181 LTSSALRGCIIAPPGKKLVISDLSNIEGRMLAWLAGENWKVNAFSEFDNGKGDDLYKLAY 240

Query: 414 ARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVKTNSAPE 473
           AR+FN+ P  VTKDQR IGKVMEL LGY GG  AF   A   GL+L+  A     N  P 
Sbjct: 241 ARAFNLLPEDVTKDQRQIGKVMELGLGYGGGVAAFLTFALAYGLDLDELAEAALPNIPPG 300

Query: 474 EWEDAENFCRWMQ---ENHPEHAI-EDLFIGTACERVKKAWRQKHSRVSELWNELHQAFE 529
              +A    RW Q   E    + + E +F+   C+ +K+ WR  H +    W ++  A +
Sbjct: 301 VKREA---MRWYQKSVETDKTYGLSEKIFV--TCDSLKRMWRNAHPQTVSFWYDIEDAVK 355

Query: 530 QTIEN-GKAIIARK 542
           Q I++ G A   RK
Sbjct: 356 QAIQSPGIAFKCRK 369


>gi|159146203|gb|ABW90565.1| DNA polymerase [Bacteriophage APSE-2]
          Length = 370

 Score =  251 bits (640), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 144/371 (38%), Positives = 212/371 (57%), Gaps = 14/371 (3%)

Query: 182 EQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSSSRCLEKLKT 241
           E ELW LDQ IN RG C+DV LA +    V+ E+ +L    + LT   V ++   + L  
Sbjct: 3   ETELWQLDQKINRRGMCMDVELAKSALTAVENEQKRLSTVTQQLTDNAVQNATQRDALLQ 62

Query: 242 WLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLNTLVEAMNSD 301
            +    G+ L D+  +T QR ++ +  + P   ++ + R+++  ++  K   L++++++D
Sbjct: 63  HIASAFGITLPDMQASTLQRRIN-DPDIPPDLRELLSVRLQSCTTSTSKYKALLKSVSAD 121

Query: 302 GRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTS---ITSDPDPLQ 358
           GRLRGT QF GASRTGRW+G VF P NLPRP+     +D  I  L      +  D D +Q
Sbjct: 122 GRLRGTKQFCGASRTGRWAGRVFQPDNLPRPTLDPNTIDNGIEALKAGCAELICD-DIMQ 180

Query: 359 IISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFE-----TGEDLYVTTY 413
           + S  +R C+IA  GKKLV++DL+ IE R+LAW+AGE WK+KAF       G+DLY   Y
Sbjct: 181 LTSSALRGCIIAPPGKKLVISDLSNIEGRMLAWLAGENWKVKAFSEFDNGKGDDLYKLAY 240

Query: 414 ARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVKTNSAPE 473
           AR+FN+ P  VTKDQR IGKVMEL LGY GG  AF   A   GL+L+  A     +  P 
Sbjct: 241 ARAFNLLPEDVTKDQRQIGKVMELGLGYGGGVAAFLTFALAYGLDLDELAEAALPHIPPG 300

Query: 474 EWEDAENFCRWMQENHPEHAI-EDLFIGTACERVKKAWRQKHSRVSELWNELHQAFEQTI 532
              +A ++ +   E    + + E +F+   C+ +K+ WR  H +    W ++  A +Q I
Sbjct: 301 VKREATSWYQKSVEKDKTYGLSEKIFV--TCDSLKRMWRNAHPQTVSFWYDIEDAVKQAI 358

Query: 533 EN-GKAIIARK 542
           ++ G A   RK
Sbjct: 359 QSPGIAFKCRK 369


>gi|159146201|gb|ABW90564.1| DNA polymerase [Bacteriophage APSE-2]
 gi|159146213|gb|ABW90570.1| DNA polymerase [Bacteriophage APSE-2]
 gi|159146218|gb|ABW90572.1| DNA polymerase [Bacteriophage APSE-2]
          Length = 370

 Score =  251 bits (640), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 144/371 (38%), Positives = 212/371 (57%), Gaps = 14/371 (3%)

Query: 182 EQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSSSRCLEKLKT 241
           E ELW LDQ IN RG C+DV LA +    V+ E+ +L    + LT   V ++   + L  
Sbjct: 3   ETELWQLDQKINRRGMCMDVELAKSALTAVENEQKRLSTVTQQLTDNAVQNATQRDALLQ 62

Query: 242 WLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLNTLVEAMNSD 301
            +    G+ L D+  +T QR ++ +  + P   ++ + R+++  ++  K   L++++++D
Sbjct: 63  HIASAFGITLPDMQASTLQRRIN-DPDIPPDLRELLSVRLQSCTTSTSKYKALLKSVSAD 121

Query: 302 GRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTS---ITSDPDPLQ 358
           GRLRGT QF GASRTGRW+G VF P NLPRP+     +D  I  L      +  D D +Q
Sbjct: 122 GRLRGTKQFCGASRTGRWAGRVFQPDNLPRPTLDPNTIDNGIEALKAGCAELICD-DIMQ 180

Query: 359 IISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFE-----TGEDLYVTTY 413
           + S  +R C+IA  GKKLV++DL+ IE R+LAW+AGE WK+KAF       G+DLY   Y
Sbjct: 181 LTSSALRGCIIAPPGKKLVISDLSNIEGRMLAWLAGENWKVKAFSEFDNGKGDDLYKLAY 240

Query: 414 ARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVKTNSAPE 473
           AR+FN+ P  VTKDQR IGKVMEL LGY GG  AF   A   GL+L+  A     +  P 
Sbjct: 241 ARAFNLLPEDVTKDQRQIGKVMELGLGYGGGVAAFLTFALAYGLDLDELAEAALPHIPPG 300

Query: 474 EWEDAENFCRWMQENHPEHAI-EDLFIGTACERVKKAWRQKHSRVSELWNELHQAFEQTI 532
              +A ++ +   E    + + E +F+   C+ +K+ WR  H +    W ++  A +Q I
Sbjct: 301 VKREATSWYQKSVETDKTYGLSEKIFVN--CDSLKRMWRNAHPQTVSFWYDIEDAVKQAI 358

Query: 533 EN-GKAIIARK 542
           ++ G A   RK
Sbjct: 359 QSPGIAFKCRK 369


>gi|159146205|gb|ABW90566.1| DNA polymerase [Bacteriophage APSE-2]
 gi|159146207|gb|ABW90567.1| DNA polymerase [Bacteriophage APSE-2]
 gi|159146209|gb|ABW90568.1| DNA polymerase [Bacteriophage APSE-2]
          Length = 370

 Score =  249 bits (635), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 146/374 (39%), Positives = 211/374 (56%), Gaps = 20/374 (5%)

Query: 182 EQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSSSRCLEKLKT 241
           E ELW LDQ IN RG C+DV LA +    V+ E+ +L    + LT   V ++   + L  
Sbjct: 3   ETELWQLDQKINRRGMCMDVELAKSALTAVENEQNRLSTVTQQLTDNAVQNATQRDALLQ 62

Query: 242 WLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLNTLVEAMNSD 301
            +    G+ L D+  +T QR ++ +  + P   ++ + R+++  ++  K   L++++++D
Sbjct: 63  HIASAFGITLPDMQASTLQRRIN-DPDIPPDLRELLSVRLQSCTTSTSKYKALLKSVSAD 121

Query: 302 GRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTS---ITSDPDPLQ 358
           GRLRGT QF GASRTGRW+G VF P NLPRP+     +D  I  L      +  D D +Q
Sbjct: 122 GRLRGTKQFCGASRTGRWAGRVFQPDNLPRPTLDPNTIDNGIEALKAGCAELICD-DIMQ 180

Query: 359 IISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFE-----TGEDLYVTTY 413
           + S  +R C+IA  GKKLV++DL+ IE R+LAW+AGE WK+ AF       G+DLY   Y
Sbjct: 181 LTSSALRGCIIAPPGKKLVISDLSNIEGRMLAWLAGENWKVNAFSEFDNGKGDDLYKLAY 240

Query: 414 ARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVKTNSAPE 473
           AR+FN+ P  VTK+QR IGKVMEL LGY GG  AF   A   GL+L+  A     N  P 
Sbjct: 241 ARAFNLLPEDVTKEQRQIGKVMELGLGYGGGVAAFLTFALAYGLDLDELAEAALPNILPG 300

Query: 474 EWEDAENFCRWMQ---ENHPEHAI-EDLFIGTACERVKKAWRQKHSRVSELWNELHQAFE 529
              +A    RW Q   E    + + E +F+   C+ +K+ WR  H +    W ++  A +
Sbjct: 301 VKREA---MRWYQKSVETDKTYGLSEKIFV--TCDALKRMWRNAHPQTVSFWYDIEDAVK 355

Query: 530 QTIEN-GKAIIARK 542
           Q I++ G A   RK
Sbjct: 356 QAIQSPGIAFKCRK 369


>gi|262043421|ref|ZP_06016546.1| conserved hypothetical protein [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|259039247|gb|EEW40393.1| conserved hypothetical protein [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
          Length = 328

 Score =  248 bits (632), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 143/335 (42%), Positives = 196/335 (58%), Gaps = 28/335 (8%)

Query: 357 LQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFE-----TGEDLYVT 411
           +Q+ S  +R C++A  GKKLVV+DL+ IE R+LAW+AGEQWKL AF      TG DLY  
Sbjct: 5   MQLASSALRGCIMAPAGKKLVVSDLSNIEGRMLAWLAGEQWKLDAFRQYDEGTGPDLYKL 64

Query: 412 TYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVKTNSA 471
            YAR+FN++   VTK QR IGKVMEL LG+ GG  AF   A   GL+L   A     N  
Sbjct: 65  AYARAFNISHEDVTKYQRQIGKVMELGLGFGGGVAAFLTFALVYGLDLEELATAALPNIP 124

Query: 472 PEEWEDAENFCRWMQENHPEHAI----EDLFIGTACERVKKAWRQKHSRVSELWNELHQA 527
            +   +A+    W  E+    A     E +FI  AC+ +K+ WR+ H    + W +L   
Sbjct: 125 RDVQREAKG---WYDESVKRKATYGLSERVFI--ACDSLKRLWRRAHPETCDFWYQL--- 176

Query: 528 FEQTIENGKAIIARKRRDVPLVYMK--KDKNNLILMLPSGRSLVYRDV---GNNRSYL-- 580
            E+T+   +  IA   + +   Y+K  +D   L + LPSGR+L Y        N +Y+  
Sbjct: 177 -ERTV---RTAIATPAKTLYCGYLKVRRDGAWLRIQLPSGRALCYPSPTIEKGNITYMGI 232

Query: 581 NTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETPDTD 640
           N+ +R+  R  TYGGKL EN+ QA +RD+LA  M     AGY IVLTVHDE++CE PDTD
Sbjct: 233 NSYSRKWQRLKTYGGKLVENVTQAAARDVLAGNMPLIENAGYSIVLTVHDEVICEAPDTD 292

Query: 641 EFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           ++  + L  L+++NP WA  +PL A G+E+  YRK
Sbjct: 293 DYTDAALSSLLSTNPEWAPDIPLNAGGFEAYHYRK 327


>gi|159146211|gb|ABW90569.1| DNA polymerase [Bacteriophage APSE-2]
          Length = 370

 Score =  245 bits (625), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 145/374 (38%), Positives = 210/374 (56%), Gaps = 20/374 (5%)

Query: 182 EQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSSSRCLEKLKT 241
           E ELW LDQ IN RG C+DV LA +    V+ E+ +L    + LT   V ++   + L  
Sbjct: 3   ETELWQLDQKINRRGMCMDVELAKSALTAVENEQNRLSTVTQQLTDNAVQNATQRDALLQ 62

Query: 242 WLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLNTLVEAMNSD 301
            +    G+ L D+  +T QR ++ +  + P   ++ + R+++  ++  K   L++++++D
Sbjct: 63  HIASAFGITLPDMQASTLQRRIN-DPDIPPALRELLSVRLQSCTTSTSKYKALLKSVSAD 121

Query: 302 GRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTS---ITSDPDPLQ 358
           GRLRGT QF GASRTGRW+G VF P NLPRP+     +D  I  L      +  D D +Q
Sbjct: 122 GRLRGTKQFCGASRTGRWAGRVFQPDNLPRPTLDPNTIDNGIEALKAGCAELICD-DIMQ 180

Query: 359 IISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFE-----TGEDLYVTTY 413
           + S  +R C+IA  GKKLV++DL+ IE R+LAW+AGE WK+ AF       G+DLY   Y
Sbjct: 181 LTSSALRGCIIAPPGKKLVISDLSNIEGRMLAWLAGENWKVNAFSEFDNGKGDDLYKLAY 240

Query: 414 ARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVKTNSAPE 473
           AR+FN+ P  VTK+QR IGKVMEL LGY GG  AF   A   GL+L+  A     N    
Sbjct: 241 ARAFNLLPEDVTKEQRQIGKVMELGLGYGGGVAAFLTFALAYGLDLDELAEAALPNIPLG 300

Query: 474 EWEDAENFCRWMQ---ENHPEHAI-EDLFIGTACERVKKAWRQKHSRVSELWNELHQAFE 529
              +A    RW Q   E    + + E +F+   C+ +K+ WR  H +    W ++  A +
Sbjct: 301 VKREA---MRWYQKSVETDKTYGLSEKIFV--TCDSLKRMWRNAHPQTVSFWYDIEDAVK 355

Query: 530 QTIEN-GKAIIARK 542
           Q I++ G A   RK
Sbjct: 356 QAIQSPGIAFKCRK 369


>gi|297242717|ref|ZP_06926655.1| DNA polymerase I [Gardnerella vaginalis AMD]
 gi|296888928|gb|EFH27662.1| DNA polymerase I [Gardnerella vaginalis AMD]
          Length = 560

 Score =  244 bits (623), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 195/620 (31%), Positives = 295/620 (47%), Gaps = 110/620 (17%)

Query: 93  WICTLVLARSNGLPSALKAVGEALKLSSQKMEEGKELIARFC---------KGETHECLY 143
           W CT++ + + GLP +L++VG  L L  QK+ EGK LI  FC          G T     
Sbjct: 13  WHCTMIWSATLGLPMSLESVGAVLGLDKQKLTEGKNLIKYFCLPCNPTKVNGGRT----- 67

Query: 144 DRNKPNH-REAWRLFGEYCKGDVTVTREIFKRLE--PLSSKEQELWYLDQTINDRGYCVD 200
            RNK  H +E W LF  Y K DV V   I ++L   P+     + +YLDQTINDRG  +D
Sbjct: 68  -RNKYFHDKEKWELFKSYNKRDVEVEMSIQEKLSLFPVPDFLWQEFYLDQTINDRGIEID 126

Query: 201 VALAHTLNQIVDVERTKLDQELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQ 260
                +  ++    +T L  EL+ +T GL + +  L+ +++WL  E GL +E L +    
Sbjct: 127 SLFVESAIKLDQEVKTHLMSELKHVT-GLENPNSVLQ-MRSWL-KEHGLEMESLGKKEVA 183

Query: 261 RVLSSNKKLTPQAIQVFNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWS 320
           + L   K +  +  +V   R + ++S+V K   +  A   D R RG  +F GA+RTGR++
Sbjct: 184 KEL---KTVGKELAEVLRLRQQLAKSSVKKYTAMKNAACMDYRERGMFRFYGANRTGRFA 240

Query: 321 GCVFPPQNLPR-------PSRSH------EELDQIITHLPTSITSDPDPLQIISDCVRSC 367
           G +   QNLP+        +RS       E L+ +   +P ++          S  +R+ 
Sbjct: 241 GRLVQLQNLPQNHLPDLAEARSLVKQGNVEALEMLYEDIPDTL----------SQLIRTA 290

Query: 368 VIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQ--VT 425
            I   G K +VAD + IEARVLAW+AGE+W+++ F  G+D+Y ++ ++ F+V   +  V 
Sbjct: 291 FIPRTGFKFIVADFSAIEARVLAWLAGEKWRMRVFAEGKDIYCSSASQMFSVPVEKHGVN 350

Query: 426 KDQRAIGKVMELALGYQGGAKAFQKMAST-TGLNLNTFAHLVKTNSAPEEWEDAENFCRW 484
              R  GK+ ELALGY G   A + M +   GL       LV                  
Sbjct: 351 GHLRQKGKIAELALGYGGSVGALKAMGALDMGLTEEELQPLV------------------ 392

Query: 485 MQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELHQAFEQTIENGKAIIARKRR 544
                                   AWR+ +  V+ LW ++ +A +Q +      I+ +  
Sbjct: 393 -----------------------DAWRKSNPMVTTLWWDVDRAVKQCVHEH---ISVRTH 426

Query: 545 DVPLVYMKKDKNNLILMLPSGRSLVY--------RDVGNNRSYLNT-TTRQLTREYTYGG 595
           ++   Y       LI+ LPS R L Y        +  G + +Y    +T++  R  +YG 
Sbjct: 427 NIVFTY---KSGFLIIKLPSKRCLYYVKPRVEENKYGGESVTYEGVGSTKKWERLESYGP 483

Query: 596 KLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETPDTDEFNASMLYHLMTSNP 655
           K  ENI QA++RDIL   M   T   Y IV  VHDE + ET      +   +  LM   P
Sbjct: 484 KFVENITQAIARDILLYAMQ--TLKEYRIVAHVHDEAIIETDKN--VSVQSVCELMGRTP 539

Query: 656 SWAKGLPLKAEGYESKRYRK 675
            WA+GL L+A+GYE + Y+K
Sbjct: 540 PWAEGLVLRADGYECEFYKK 559


>gi|211731846|gb|ACJ10149.1| DNA polymerase [Bacteriophage APSE-5]
          Length = 773

 Score =  241 bits (614), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 143/365 (39%), Positives = 210/365 (57%), Gaps = 25/365 (6%)

Query: 248 GLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLNTLVEAMNSDGRLRGT 307
           G+ L D+  +T QR ++ +  + P   ++ + R+++  ++  K   L++++++DGRLRGT
Sbjct: 34  GITLPDMQASTLQRRIN-DPDIPPDLRELLSVRLQSCTTSTSKYKALLKSVSADGRLRGT 92

Query: 308 LQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTS---ITSDPDPLQIISDCV 364
            QF GASRTGRW+G VF P NLPRP+     +D  I  L      +  D D +Q+ S  +
Sbjct: 93  KQFCGASRTGRWAGRVFQPDNLPRPTLDPNTIDNGIEALKAGCAELICD-DIMQLTSSAL 151

Query: 365 RSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFE-----TGEDLYVTTYARSFNV 419
           R C+IA  GKKLV++DL+ IE R+LAW+AGE WK+KAF       G+DLY   YAR+FN+
Sbjct: 152 RGCIIAPPGKKLVISDLSNIEGRMLAWLAGENWKVKAFSEFDNGKGDDLYKLAYARAFNL 211

Query: 420 APAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVKTNSAPEEWEDAE 479
            P  VTKDQR IGKVMEL LGY GG  AF   A   GL+L+  A     +  P    +A 
Sbjct: 212 LPEDVTKDQRQIGKVMELGLGYGGGVAAFLTFALAYGLDLDELAEAALPHIPPGVKREAT 271

Query: 480 NFCRWMQENHPEHAI-EDLFIGTACERVKKAWRQKHSRVSELWNELHQAFEQTIEN-GKA 537
           ++ +   E    + + E +F+   C+ +K+ WR  H +    W ++  A +Q I++ G A
Sbjct: 272 SWYQKSVETDKTYGLSEKIFVN--CDSLKRMWRNAHPQTVSFWYDIEDAVKQAIQSPGIA 329

Query: 538 IIARKRRDVPLVYMKKDKNNLILMLPSGRSLVY---RDVGNNRSYLNTT--TRQLTREYT 592
              RK      + +++DK  L + LPSGRSL Y   R      +Y+ T   +R+  R  T
Sbjct: 330 FKCRK------LSVRRDKGWLRICLPSGRSLCYPSARIENGQITYMGTNPYSRKWERLKT 383

Query: 593 YGGKL 597
           YGGKL
Sbjct: 384 YGGKL 388



 Score = 90.9 bits (224), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 43/77 (55%), Positives = 54/77 (70%)

Query: 599 ENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWA 658
           ENI Q+ +RD+LA  M    KAGY+IVLTVHDEI+ E PDT +F+A  L  L++ N  WA
Sbjct: 696 ENICQSAARDVLAYSMPPIEKAGYEIVLTVHDEIISEAPDTPQFSAEGLSKLLSFNSHWA 755

Query: 659 KGLPLKAEGYESKRYRK 675
             LPL A G+E+ RYRK
Sbjct: 756 WDLPLSANGFETYRYRK 772


>gi|211731855|gb|ACJ10154.1| DNA polymerase [Bacteriophage APSE-4]
          Length = 773

 Score =  234 bits (598), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 144/368 (39%), Positives = 208/368 (56%), Gaps = 31/368 (8%)

Query: 248 GLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLNTLVEAMNSDGRLRGT 307
           G+ L D+  +T QR ++ +  + P   ++ + R+++  ++  K   L++++++DGRLRGT
Sbjct: 34  GITLPDMQASTLQRRIN-DPDIPPALRELLSVRLQSCTTSTSKYKALLKSVSADGRLRGT 92

Query: 308 LQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTS---ITSDPDPLQIISDCV 364
            QF GASRTGRW+G VF P NLPRP+     +D  I  L      +  D D +Q+ S  +
Sbjct: 93  KQFCGASRTGRWAGRVFQPDNLPRPTLDPNTIDNGIEALKAGCAELICD-DIMQLTSSAL 151

Query: 365 RSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFE-----TGEDLYVTTYARSFNV 419
           R C+IA  GKKLV++DL+ IE R+LAW+AGE WK+ AF       G+DLY   YAR+FN+
Sbjct: 152 RGCIIAPPGKKLVISDLSNIEGRMLAWLAGENWKVNAFSEFDNGKGDDLYKLAYARAFNL 211

Query: 420 APAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVKTNSAPEEWEDAE 479
            P  VTK+QR IGKVMEL LGY GG  AF   A   GL+L+  A     N       +A 
Sbjct: 212 LPEDVTKEQRQIGKVMELGLGYGGGVAAFLTFALAYGLDLDELAEAALPNIPLGVKREA- 270

Query: 480 NFCRWMQ---ENHPEHAI-EDLFIGTACERVKKAWRQKHSRVSELWNELHQAFEQTIEN- 534
              RW Q   E    + + E +F+   C+ +K+ WR  H +    W ++  A +Q I++ 
Sbjct: 271 --MRWYQKSVETDKTYGLSEKIFV--TCDSLKRMWRNAHPQTVSFWYDIEDAVKQAIQSP 326

Query: 535 GKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVY---RDVGNNRSYLNTT--TRQLTR 589
           G A   RK      + +++DK  L + LPSGRSL Y   R      +Y+ T   +R+  R
Sbjct: 327 GIAFKCRK------LSVRRDKGWLRICLPSGRSLCYPSARIENGQITYMGTNPYSRKWER 380

Query: 590 EYTYGGKL 597
             TYGGKL
Sbjct: 381 LKTYGGKL 388



 Score = 91.3 bits (225), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 43/77 (55%), Positives = 54/77 (70%)

Query: 599 ENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWA 658
           ENI Q+ +RD+LA  M    KAGY+IVLTVHDEI+ E PDT +F+A  L  L++ N  WA
Sbjct: 696 ENICQSAARDVLAYSMPPIEKAGYEIVLTVHDEIISEAPDTPQFSAEGLSKLLSFNSDWA 755

Query: 659 KGLPLKAEGYESKRYRK 675
             LPL A G+E+ RYRK
Sbjct: 756 WDLPLSANGFETYRYRK 772


>gi|323173135|gb|EFZ58766.1| DNA-directed DNA polymerase [Escherichia coli LT-68]
          Length = 385

 Score =  230 bits (586), Expect = 7e-58,   Method: Compositional matrix adjust.
 Identities = 140/379 (36%), Positives = 206/379 (54%), Gaps = 10/379 (2%)

Query: 4   LFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHDPVMPQVLKEALEN 63
           L+ D ET   I +T  G   YAE V V+LFA+  +D PV +WD      +P  L EA+  
Sbjct: 6   LWGDLETYCEIPITN-GTHAYAEGVEVMLFAWAINDGPVNVWDITAGGGIPHGLYEAIAA 64

Query: 64  TDVTIVAHNSYFERTVLK-ACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKLSSQK 122
            +  +  HNS+F+RTVL+ A   L  P+ RW  T+V A ++GLP +L  + E L +   K
Sbjct: 65  PETLLYFHNSHFDRTVLRYAMPRLAPPVERWRDTMVQALAHGLPGSLGELCEILGVPQDK 124

Query: 123 ME--EGKELIARFCKGETHECLYDR-NKPNHREAWRLFGEYCKGDVTVTREIFKRLEPLS 179
            +  EGK LI  FCK         R     H E WR F  Y   D+   RE++KRL   +
Sbjct: 125 AKDKEGKALIQLFCKPRPKNSKLRRATSKTHPEEWRRFVAYAGLDIEAMREVYKRLPKWN 184

Query: 180 SKEQEL--WYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSSSRCLE 237
            +  EL  W+ DQ INDRG C+D+ LA    + VD E+ +L +  + +T G V ++   +
Sbjct: 185 YQGTELALWHRDQQINDRGVCMDIQLARAAIEAVDQEQKRLAKRTQEMTDGEVQAATQRD 244

Query: 238 KLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLNTLVEA 297
            L   +    G+ L D+  +T +R ++ +  L     ++   R +AS ++  K   L++ 
Sbjct: 245 ALIKHIVESYGVELPDMQRSTLERRIA-DPDLPSAVKELLAIRQQASTTSTSKYKALMKG 303

Query: 298 MNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITS--DPD 355
           ++ DGRLRGTLQF GASRTGRW+G +F PQNLPRPS   E++D+ I  L          +
Sbjct: 304 VSHDGRLRGTLQFCGASRTGRWAGRLFQPQNLPRPSLKQEQIDEGIEALKAGCADLLFDN 363

Query: 356 PLQIISDCVRSCVIASEGK 374
            +++ S  +R C+IA  GK
Sbjct: 364 IMELTSSALRGCIIAPTGK 382


>gi|227544275|ref|ZP_03974324.1| DNA-directed DNA polymerase [Lactobacillus reuteri CF48-3A]
 gi|227185735|gb|EEI65806.1| DNA-directed DNA polymerase [Lactobacillus reuteri CF48-3A]
          Length = 449

 Score =  228 bits (580), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 153/457 (33%), Positives = 239/457 (52%), Gaps = 25/457 (5%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M  + ID ET S  +L + G+ +YA+  D  ++LF +  D  PV++ D      +P  + 
Sbjct: 1   MKQISIDIETYSSTNLNQTGVYRYADSDDFELLLFGYATDFGPVKVVDLTQGEKIPPQII 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKL 118
           E L+N ++   A N+ FER  L       +    W C+ V + + GLP +L+ +G  L L
Sbjct: 61  EVLDNPNIIKSAFNAQFERVCLSRFVGHRLKPTGWHCSRVWSATLGLPLSLRDIGSVLGL 120

Query: 119 SSQKMEEGKELIARF---CKGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTREIFKR 174
             QK+  GKEL+  F   CK         RN P H  + W+ F +Y + DV V  EI ++
Sbjct: 121 PRQKITAGKELVRYFCTPCKPTKANQNRTRNFPYHAPDKWQQFKQYNQRDVEVEMEITQK 180

Query: 175 LE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSS 232
           LE  P+   E E +++DQ INDRG  +D  L +   +  +V   +  Q  + LT GL + 
Sbjct: 181 LECFPVPQNEWENYWMDQDINDRGIRIDQQLVNNAIKCQNVFHDQYLQTAKELT-GLANP 239

Query: 233 SRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLN 292
           +  L+ LK WL  + G+    L++ +  ++L +    T    QV   R   S+S+V K  
Sbjct: 240 NSPLQ-LKDWL-QQQGIKTNSLSKASVAQLLQTT---TGTVHQVLALRQLLSKSSVKKYQ 294

Query: 293 TLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSH-EELDQIITH-----L 346
            + +AM  DGR+ G LQF GA+RTGRW+G +   QNLPR S    EE  +++       L
Sbjct: 295 AMQKAMCQDGRVHGLLQFYGANRTGRWAGRLVQVQNLPRNSMPDLEEARELVKQGNVPAL 354

Query: 347 PTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGE 406
                S PD   ++S  +R+  I S+     VAD + +EARV+AW++ E+W+ ++F   E
Sbjct: 355 AMLYDSVPD---VLSQLIRTAFIPSKNHHFYVADFSAVEARVIAWLSNEKWRQESFAKNE 411

Query: 407 DLYVTTYARSFNVAPAQ--VTKDQRAIGKVMELALGY 441
           D+Y  + ++ F V   +  +  + R  GK+ ELALGY
Sbjct: 412 DIYCASASQMFGVPVVKHGINGELRQKGKIAELALGY 448


>gi|320182116|gb|EFW57020.1| DNA polymerase, phage-associated [Shigella boydii ATCC 9905]
          Length = 533

 Score =  224 bits (571), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 151/421 (35%), Positives = 215/421 (51%), Gaps = 19/421 (4%)

Query: 4   LFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHDPVMPQVLKEALEN 63
           L+ D ET   I +T  G   YAE V V+LFA+  +D PV +WD      +P  L EA+  
Sbjct: 6   LWGDLETYCEIPITN-GTHAYAEGVEVMLFAWAINDGPVNVWDITAGGGIPHGLYEAIAA 64

Query: 64  TDVTIVAHNSYFERTVLK-ACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKLSSQK 122
            +  +  HNS+F+RTVL+ A   L  P+ RW  T+V A ++GLP +L  + E L +   K
Sbjct: 65  PETLLYFHNSHFDRTVLRYAMPRLAPPVERWRDTMVQALAHGLPGSLGELCEVLGVPQDK 124

Query: 123 ME--EGKELIARFCKGETHECLYDR-NKPNHREAWRLFGEYCKGDVTVTREIFKRLEPLS 179
            +  EGK LI  FCK         R     H E WR F  Y   D+   RE++ RL   +
Sbjct: 125 AKDKEGKALIQLFCKPRPKNSKLRRATSKTHPEEWRRFVAYAGLDIEAMREVYNRLPKWN 184

Query: 180 SKEQEL--WYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSSSRCLE 237
            +  EL  W+ DQ INDRG C+D+ LA    + VD E+ +L +  + +T G V ++   +
Sbjct: 185 YQGTELALWHRDQQINDRGVCMDMQLARAAIEAVDQEQKRLAKRTQEMTDGEVQAATQRD 244

Query: 238 KLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLNTLVEA 297
            L   +    G+ L D+  +T +R ++ +  L     ++   R++AS ++  K   L++ 
Sbjct: 245 ALIKHIVESYGVELPDMQRSTLERRIA-DPDLPSAVKEMLAIRLQASTTSTSKYKALMKG 303

Query: 298 MNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITSDPDPL 357
           ++ DGRLRGTLQF GASRTGRW+G +F PQNLPRPS   E++D+ I   P +       L
Sbjct: 304 VSHDGRLRGTLQFCGASRTGRWAGRLFQPQNLPRPSLKQEQIDEGI-EAPNAAAKTLKCL 362

Query: 358 QIISDCVRSCVIAS----EGKKLVVADLAGIEARVLAWMAGEQWK------LKAFETGED 407
           QI S  V +    S       KL   D    EA     +    WK      LKAF  G  
Sbjct: 363 QIASGAVYTDDAGSWSELHDTKLQALDSILTEAAGAPVLVAYHWKHDLERLLKAFPRGRH 422

Query: 408 L 408
           L
Sbjct: 423 L 423


>gi|62327350|ref|YP_224063.1| hypothetical protein BPKS7gp41 [Salmonella phage SS3e]
 gi|57472384|gb|AAW51246.1| hypothetical protein [Salmonella phage SS3e]
          Length = 461

 Score =  222 bits (566), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 150/451 (33%), Positives = 231/451 (51%), Gaps = 21/451 (4%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAEDVC--VILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M  L++D ET S  DL K G   YAE     +++  + FD+ PV++WD      MP+ L+
Sbjct: 1   MNLLYLDTETFSEADLKKVGSYAYAEHPTTEIVICTYAFDEGPVQVWDATDGSDMPRDLR 60

Query: 59  EAL-----ENTDVTIVAHNS-YFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAV 112
            A+      ++++ +V  N   F+R V+K C+  ++ +   I T+++A  + LP +L A+
Sbjct: 61  RAMLKLQKPDSNLKLVGQNFLMFDRPVIKHCWGFELLVENIIDTMIVAFRHALPGSLAAL 120

Query: 113 GEALKL--SSQKMEEGKELIARFCKGETHECLYDRNKPN-HREAWRLFGEYCKGDVTVTR 169
            E L +  S  K + GK LI RF K         R   + H + W  F  Y K D+T  R
Sbjct: 121 CEVLNIDASMAKDKRGKALIQRFSKPTPKNYKIRRYTADTHPKEWAEFIAYAKSDITSMR 180

Query: 170 EIFKRLEPLSSKEQE--LWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTY 227
           E++K++    + E E  + +LDQ INDRG+ VDVALA    + V   + +L +E +    
Sbjct: 181 EVYKKMPKWGNSEFEDRVLHLDQVINDRGFKVDVALAEAAIEAVTRHKEELQEEAQRKYG 240

Query: 228 GLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSA 287
           G ++    L  L+    L     + +  ++T   +L+ ++ L   A  +   R+ A+ +A
Sbjct: 241 GSLTGKDFLPILQE---LAPAHRIHNAQKSTLNDLLA-DEDLPDDARTIIEMRLGAASTA 296

Query: 288 VLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQ-IITHL 346
             K   L+   +SD R RG LQ+ GA RT RW+G  F PQNL R     +ELD+ I   L
Sbjct: 297 STKYAPLLLGRSSDDRRRGCLQYGGAKRTLRWAGKGFQPQNLARGYYHDDELDRGIAALL 356

Query: 347 PTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGE 406
                   D  ++ +  VRSC+I   G+K VVAD + +E R LAW+AGE+  L  F  G 
Sbjct: 357 KGRAHRRFDVAKLTASTVRSCIIPEAGRKFVVADYSNVEGRGLAWLAGEETALDTFRAGL 416

Query: 407 DLYVTTYARSFNVAPAQVT---KDQRAIGKV 434
           D+Y  T  + F + P  +    KD R IGK 
Sbjct: 417 DIYCVTAGKMFGMDPDDIKKERKDLRQIGKA 447


>gi|227544664|ref|ZP_03974713.1| DNA-directed DNA polymerase [Lactobacillus reuteri CF48-3A]
 gi|227185389|gb|EEI65460.1| DNA-directed DNA polymerase [Lactobacillus reuteri CF48-3A]
          Length = 449

 Score =  222 bits (566), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 154/457 (33%), Positives = 234/457 (51%), Gaps = 25/457 (5%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M  L ID ET S  +L + G  +YA+  D  ++LF +  D  PV++ D      +P  + 
Sbjct: 1   MKQLSIDIETYSSTNLNQTGGYRYADSDDFELLLFGYAVDFGPVKVVDLTQGEKIPSQII 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKL 118
           +AL++  +   A N+ FER  L       +    W C+ V + + GLP +L+ VG  L L
Sbjct: 61  QALDDPAIIKSAFNAQFERVCLSRFVGHRLKPAGWHCSRVWSATLGLPLSLRDVGTVLGL 120

Query: 119 SSQKMEEGKELIARF---CKGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTREIFKR 174
             QK+  GKEL+  F   CK         RN P H  + W+ F +Y + DV V  EI ++
Sbjct: 121 PRQKITAGKELVRYFCTSCKPTKANQNRTRNFPYHAPDKWQQFKQYNQRDVEVEMEITQK 180

Query: 175 LE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSS 232
               P+   E E +++DQ INDRG  +D  L +   +       +  Q  + LT GL + 
Sbjct: 181 FSRFPVPQNEWENYWMDQDINDRGIRIDQQLVNNAIKCQKEFHAQYLQTSQQLT-GLANP 239

Query: 233 SRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLN 292
           +  L+ LK WL  + G+  + L + +  ++L +    T    QV   R   S+S+V K  
Sbjct: 240 NSPLQ-LKNWLH-QQGVETDSLAKASVAQLLQTT---TGTVHQVLALRQLLSKSSVKKYQ 294

Query: 293 TLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSH-EELDQII-----THL 346
            + +AM  DG + G LQF GA+RTGRW+G +   QNLPR S    EE   ++     T L
Sbjct: 295 AMQKAMCKDGCVHGLLQFYGANRTGRWAGRLVQVQNLPRNSMPDLEEARALVKQGNTTAL 354

Query: 347 PTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGE 406
                S PD   ++S  +R+  I S+G    VAD + +EARV+AW++GE+W+  AF   E
Sbjct: 355 AMLYESVPD---VLSQLIRTAFIPSKGHHFYVADFSAVEARVIAWLSGEEWRQAAFAKNE 411

Query: 407 DLYVTTYARSFNVAPAQ--VTKDQRAIGKVMELALGY 441
           D+Y  + ++ F V   +  +  + R  GK+ ELALGY
Sbjct: 412 DIYCASASQMFGVPVVKHGINGELRQKGKIAELALGY 448


>gi|134288571|ref|YP_001110810.1| DNA polymerase [Salmonella phage SETP3]
 gi|125631936|gb|ABN47339.1| DNA polymerase [Salmonella phage SETP3]
 gi|126015336|gb|ABN70699.1| DNA polymerase [Salmonella phage SETP5]
 gi|126015338|gb|ABN70700.1| DNA polymerase [Salmonella phage SETP12]
          Length = 1032

 Score =  221 bits (564), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 151/452 (33%), Positives = 230/452 (50%), Gaps = 23/452 (5%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAEDVC--VILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M  L++D ET S  DL K G   YAE     +++  + FD+ PV++WD      MP+ L+
Sbjct: 1   MNLLYLDTETFSEADLKKVGSYAYAEHPTTEIVICTYAFDEGPVQVWDATDGSDMPRDLR 60

Query: 59  EAL-----ENTDVTIVAHNS-YFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAV 112
            A+      ++++ +V  N   F+R V+K C+  ++ +   I T+++A  + LP +L ++
Sbjct: 61  RAMLKLQKPDSNLKLVGQNFLMFDRLVIKHCWGFELLVENIIDTMIVAFRHALPGSLASL 120

Query: 113 GEALKL--SSQKMEEGKELIARFCKGETHECLYDR-NKPNHREAWRLFGEYCKGDVTVTR 169
            E L +  S  K + GK LI RF K         R     H + W  F  Y K D+T  R
Sbjct: 121 CEVLNIDASMAKDKRGKALIQRFSKPTPKNYKIRRYTAATHPKEWAEFIAYAKSDITSMR 180

Query: 170 EIFKRLEPLSSKEQE---LWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLT 226
           E++K++    + E E   LW LDQ INDRG+ VDVALA    + V   + +L +E +   
Sbjct: 181 EVYKKMPKWGNSEFEDRVLW-LDQVINDRGFKVDVALAEAAIEAVTRHKEELQEEAQRKY 239

Query: 227 YGLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRS 286
            G ++    L  L+    L     + +  ++T   +L+ ++ L   A  +   R+ A+ +
Sbjct: 240 GGSLTGKDFLPILQE---LAPAHRIHNAQKSTLNDLLA-DEDLPDDARTIIEMRLGAAST 295

Query: 287 AVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQ-IITH 345
           A  K   L+   +SD R RG LQ+ GA RT RW+G  F PQNL R     +ELD+ I   
Sbjct: 296 ASTKYAPLLLGRSSDDRRRGCLQYGGAKRTLRWAGKGFQPQNLARGYYHDDELDRGIAAL 355

Query: 346 LPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETG 405
           L        D  ++ +  VRSC+I   G+K VVAD + +E R LAW+AGE+  L  F  G
Sbjct: 356 LKGRAHRRFDVAKLTASTVRSCIIPEAGRKFVVADYSNVEGRGLAWLAGEETALDTFRAG 415

Query: 406 EDLYVTTYARSFNVAPAQVT---KDQRAIGKV 434
            D+Y  T  + F + P  +    KD R IGK 
Sbjct: 416 LDIYCVTAGKMFGMDPDDIKKERKDLRQIGKA 447



 Score =  144 bits (363), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 98/285 (34%), Positives = 130/285 (45%), Gaps = 45/285 (15%)

Query: 436  ELALGYQGGAKAFQKMASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRW--MQE-NHPEH 492
            EL LGY+GG  AF   A   GL+L   A  +        W        W  +QE   P H
Sbjct: 748  ELGLGYEGGVGAFVTFAKNLGLDLIEMAKTMDGTFPDHIWAATARGYEWARIQEAKRPPH 807

Query: 493  AIE---------DLFIGTACERVKKAWRQKHSRVSELWNELHQAFEQTIEN------GKA 537
              E         D  +   C+ +K+ WR+ H      W +L       + N        A
Sbjct: 808  PGEKDDRPSYILDKKVWRTCDAIKRMWRESHPETVAFWRDLKDGILAAVRNPGREFWAGA 867

Query: 538  IIARKRRDVPLVYMKKDKNN---------LILMLPSGRSLVYRDVG-------NNRSYLN 581
             + R       ++   + ++         L + LPSGR L Y  +G       +    +N
Sbjct: 868  HLRRNGERAIRIWRTVEFDSSGRKVPGWWLCMELPSGRILSYPGIGVSVTKETDEDGRIN 927

Query: 582  TTTR-------QLTRE----YTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHD 630
            T  R       QLTR+    YT+GGK  ENIVQA+ RD+LA  M+N    GY IVL+VHD
Sbjct: 928  TNVRIKYQGENQLTRQWTTLYTHGGKACENIVQALCRDLLAYAMLNVEAGGYPIVLSVHD 987

Query: 631  EIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
            E+VCETPDT ++  + L  LM + P WA G PL AEG E KRY K
Sbjct: 988  ELVCETPDTPDYTVAELEKLMCALPGWADGFPLVAEGAELKRYAK 1032


>gi|262043420|ref|ZP_06016545.1| conserved hypothetical protein [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|259039246|gb|EEW40392.1| conserved hypothetical protein [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
          Length = 362

 Score =  220 bits (560), Expect = 7e-55,   Method: Compositional matrix adjust.
 Identities = 131/343 (38%), Positives = 196/343 (57%), Gaps = 8/343 (2%)

Query: 4   LFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHDPVMPQVLKEALEN 63
           L+ D ET   I +T  G   YAE V V+LFA+   D PV +WD      +P  L++A+ +
Sbjct: 6   LWGDLETYCEIPITN-GTHAYAEGVEVMLFAWAIGDEPVSVWDLTAGEPIPSRLRKAIAD 64

Query: 64  TDVTIVAHNSYFERTVLK-ACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKLSSQK 122
            D  +  HNS+F+RTVL+ A   L  P+ RW  T+V A ++ LP AL A+ E L +   K
Sbjct: 65  PDTLLYFHNSHFDRTVLRHAMPELAPPVERWRDTMVQALAHSLPGALAALCEVLGVPQDK 124

Query: 123 ME--EGKELIARFCKGETHECLYDR-NKPNHREAWRLFGEYCKGDVTVTREIFKRLEPLS 179
            +  EGK LI  FCK         R     H   W+ F  Y   D+   RE++KRL   +
Sbjct: 125 AKDKEGKSLIQLFCKPRPKNSKLRRATSKTHPIEWQRFVAYAGLDIEAMREVYKRLPKWN 184

Query: 180 SKEQEL--WYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSSSRCLE 237
            +  EL  W+ DQ INDRG+CVD+ L H   + VD  + +L ++   +T G V ++   +
Sbjct: 185 YQGTELALWHRDQQINDRGFCVDMDLVHGAIRAVDRAQKRLAEQTVEITNGEVQAATQRD 244

Query: 238 KLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLNTLVEA 297
            +   +    G+ L D+ ++T +R ++ +  L P   ++ + R++AS ++  K  TL+++
Sbjct: 245 AMIKHIVESYGVELPDMQKSTIERRIA-DPDLPPAVKELLHIRLQASATSTSKYKTLLKS 303

Query: 298 MNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELD 340
           ++SDGRLRGTLQF GASRTGRW+G +F PQNL R S S EE++
Sbjct: 304 VSSDGRLRGTLQFCGASRTGRWAGRLFQPQNLSRESLSREEIE 346


>gi|284048438|ref|YP_003398777.1| DNA-directed DNA polymerase [Acidaminococcus fermentans DSM 20731]
 gi|283952659|gb|ADB47462.1| DNA-directed DNA polymerase [Acidaminococcus fermentans DSM 20731]
          Length = 971

 Score =  219 bits (559), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 162/477 (33%), Positives = 240/477 (50%), Gaps = 41/477 (8%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAEDVC--VILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M TL +D ET S ++L KCG+ KYAE     ++LF +  D   V++ D      +P+ + 
Sbjct: 1   MKTLSLDLETYSDVNLAKCGVYKYAESPAFEILLFGYAVDGGAVQVIDLAQGETIPEEIL 60

Query: 59  EALENTDVTIVAHNSYFERTVLKAC----------FNLDIPIHR----------WICTLV 98
           +AL +  VT  A N+ FER  L             F    P+ +          W C++V
Sbjct: 61  DALTDDTVTKWAFNANFERVCLSRYLTDLGRSVDPFQDQHPLSQECARFLSPAGWKCSMV 120

Query: 99  LARSNGLPSALKAVGEALKLSSQKMEEGKELIARFC---KGETHECLYDRNKPNHR-EAW 154
            +   GLP +L+ VG  L L +QKM+EG+ELI  FC   K         RN P H  + W
Sbjct: 121 WSAYMGLPLSLEGVGAVLNLDNQKMKEGRELIRYFCVPCKETRTNGGRTRNLPQHALDKW 180

Query: 155 RLFGEYCKGDVTVTREIFKRLEPLSSKEQ--ELWYLDQTINDRGYCVDVALAHTLNQIVD 212
             F  Y K DV V   I +RL+     EQ  E ++LDQ INDRG  +D+ LA     +  
Sbjct: 181 NQFKSYNKRDVEVEMAIQQRLQKYPVPEQVWEEYHLDQEINDRGIAIDLELAKQAVAMDA 240

Query: 213 VERTKLDQELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQ 272
             R  L   L+  T GL + +  L+ L  WL  + GL  + L +   + +L + ++    
Sbjct: 241 KSRESLMAALKEKT-GLENPNSVLQML-GWL-EDHGLKTDSLGKKQVKELLKTAQEPLRS 297

Query: 273 AIQVFNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPR- 331
            +Q+   R + ++S+V K   +  A+  DGR RG  QF GA+RTGR +G     QNLP+ 
Sbjct: 298 VLQL---RQKLAKSSVKKYQAMENAVCEDGRARGMFQFYGANRTGRVAGRHIQLQNLPQN 354

Query: 332 --PSRSH-EELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARV 388
             P  S   EL +   +    +  D  P  ++S  +R+  +   G K VV+D + IEARV
Sbjct: 355 HLPDLSEARELVRQGNYEALDLLYDSIP-DVLSQLIRTAFVPRAGMKFVVSDFSAIEARV 413

Query: 389 LAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQ--VTKDQRAIGKVMELALGYQG 443
           ++WMAGE+WK  AF  G+D+Y +T ++ F V   +  V  + R  GK+ ELA   +G
Sbjct: 414 ISWMAGEKWKSAAFAAGKDIYCSTASQMFGVPVVKHGVNGELRQKGKIAELACIAEG 470



 Score = 73.9 bits (180), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 56/177 (31%), Positives = 84/177 (47%), Gaps = 19/177 (10%)

Query: 508 KAWRQKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRS 567
           ++WR  +  + + W ++  A +  I+    +     R V    M      L + LPSGR 
Sbjct: 804 QSWRSANPHIVDFWWQVDGAVKTAIKQRIPVWVNNIRFVCQSGM------LFIELPSGRQ 857

Query: 568 LVYRD--VGNNR------SYLNT-TTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNAT 618
           L Y    +G N+      +Y     T++  R  +YG K  ENIVQ  +RDIL   M   T
Sbjct: 858 LSYVKPRIGENKFGGESVTYEGIGATKKWERLESYGPKFVENIVQGTARDILCYAMQ--T 915

Query: 619 KAGYDIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
                IV  VHDE++ E   + E +   +   M+  P WA+GL L+A+GYE   Y+K
Sbjct: 916 LRCCAIVGHVHDELIIEC--SKEVSVDAICEQMSRTPPWAEGLVLRADGYECAFYQK 970


>gi|295114046|emb|CBL32683.1| DNA polymerase I-3'-5' exonuclease and polymerase domains
           [Enterococcus sp. 7L76]
          Length = 545

 Score =  216 bits (549), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 151/449 (33%), Positives = 226/449 (50%), Gaps = 52/449 (11%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M  L +D ET S +DL+KCG+ KY+E  D  ++LFA+  D  PVE+ D   D  +P  + 
Sbjct: 1   MKHLSLDLETYSSVDLSKCGVYKYSESPDFEILLFAYSVDGGPVEVVDLKMDETIPAEIL 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLD--IPIHRWICTLVLARSNGLPSALKAVGEAL 116
            +L +  V   A N+ FER  L     LD  +    W CT+V   + GLP +L  VG  L
Sbjct: 61  TSLSDETVIKHAFNASFERVCLSRFLGLDGFLNPRGWQCTMVWGATLGLPLSLVGVGAVL 120

Query: 117 KLSSQKMEEGKELIARFC---------KGETHECLYDRNKPNHREA-WRLFGEYCKGDVT 166
            L+ QK+ EGK+LI  FC          G T      RN P+H    W  F  Y   DV 
Sbjct: 121 GLNKQKLTEGKDLIRYFCVPCNPTKVNGGRT------RNLPHHAPTKWSAFKTYNSRDVE 174

Query: 167 VTREIFKRLEP---LSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELE 223
           V   I  +L     L S  +E W LDQ INDRG  +D        Q+ ++ +  L+Q+L+
Sbjct: 175 VEIAIQGKLSNFPVLDSVWKEYW-LDQEINDRGIEIDKDFVEAAVQLDELSKAGLNQQLQ 233

Query: 224 SLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRA 283
            LT GL + +  L+ ++ WL L+ GL  E L +     +L   + +     QV   R + 
Sbjct: 234 ELT-GLENPNSVLQ-MRGWL-LDHGLETESLGKKAVDELLE--QPIDENLKQVLVLRQQL 288

Query: 284 SRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRS-------- 335
           ++S+V K   +     SD R RG  QF GA+RTGR++G     QNLP+   S        
Sbjct: 289 AKSSVKKYQAMQNFACSDNRSRGLFQFYGANRTGRFAGRGIHLQNLPQNHMSDLSEARSL 348

Query: 336 -----HEELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLA 390
                 E L+ +  ++P           ++S+ +R+  +  EG K +V+D + IEARV+A
Sbjct: 349 VKQSNFEMLNILYGNVPN----------VLSELLRTAFVPREGMKFIVSDFSAIEARVIA 398

Query: 391 WMAGEQWKLKAFETGEDLYVTTYARSFNV 419
           W++GE+W+ + F+ G D+Y  + ++ F V
Sbjct: 399 WLSGEKWRQEVFKNGGDIYCASASQMFGV 427


>gi|273810592|ref|YP_003344973.1| gp38 [Sodalis phage SO-1]
 gi|258619877|gb|ACV84130.1| gp38 [Sodalis phage SO-1]
          Length = 1062

 Score =  214 bits (546), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 145/467 (31%), Positives = 229/467 (49%), Gaps = 40/467 (8%)

Query: 4   LFIDFETRSPIDLTKCGICKYAEDVC--VILFAFGFDDHPVELWDCVHDPVMPQVLKEAL 61
           LF+D ET S +DL K G   YAE     +++  +  D+  V+ WDC   P MP+ L++AL
Sbjct: 7   LFLDTETFSGVDLKKVGAYAYAEHPTTEIMICTYAIDEGRVQTWDCTESPKMPRELRKAL 66

Query: 62  ENTD----VTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALK 117
                     ++A+   F+R V++  + +D+P+ +   T+++A  + LP +L    + L 
Sbjct: 67  RQVSRKKAKIVMANGLLFDRLVIREKWGIDLPVSQIEDTMIMAFRHALPGSLDMQCQVLG 126

Query: 118 LSSQ--KMEEGKELIARFCKGETHECLYDR-NKPNHREAWRLFGEYCKGDVTVTREIFKR 174
           + ++  K + GK LI RFCK         R  +  H E W  F  Y   D+   RE++ R
Sbjct: 127 VDAEHAKDKAGKALIKRFCKPTPKTYKIRRYTRETHPEEWAKFLRYAALDIIAMREVYWR 186

Query: 175 LEPLSS--KEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSS 232
           +    +  KE E+  +DQ INDRG+ VDV LA+   + V   + +L +E      G ++ 
Sbjct: 187 IPDWGNTPKEDEILLIDQLINDRGFYVDVDLANAAIKAVQAHKEELKEEAWERFGGKLTG 246

Query: 233 SRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLN 292
           +  L  L+    +     + +  ++T   +L  +     +   +   R+ AS +A  K N
Sbjct: 247 NDFLPILRD---IAPAFTIHNAQKSTLNDLLE-DPDFPDEGKALIEMRLGASSTASTKYN 302

Query: 293 TLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPS------------------- 333
            LV  +++DGR RG LQ+ GA RT RW+G  F PQNL R                     
Sbjct: 303 PLVNGLSADGRRRGCLQYGGAKRTLRWAGKGFQPQNLARGEYSDDHEGKIKRREGESDVS 362

Query: 334 ---RSHEELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLA 390
              RSH   + I + L  +     D  ++ +  VR C+I ++GKK VVAD + +E R LA
Sbjct: 363 FWVRSHMLTNGINSLLRGTAHWAYDISKLTASTVRGCIIPAKGKKFVVADYSNVEGRGLA 422

Query: 391 WMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVT---KDQRAIGKV 434
           W+AGE+  L  F+ G D+Y  T  + F + P  +    KD R IGK 
Sbjct: 423 WVAGEKTALMVFKAGRDIYCETAGKMFGLDPDYIKANRKDLRQIGKA 469



 Score =  154 bits (388), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 107/293 (36%), Positives = 137/293 (46%), Gaps = 53/293 (18%)

Query: 436  ELALGYQGGAKAFQKMASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENH----PE 491
            EL LGY GG  AF + A   GL+L T A ++K       W  A+    + + N     P+
Sbjct: 770  ELGLGYGGGVAAFLQFAKNLGLDLYTMADVMKGTFPDHIWAAAKRGYEYARINEAKRPPK 829

Query: 492  HAIED--------LFIGTACERVKKAWRQKHSRVSELWNELHQAFEQTIEN-GKA----- 537
               +D          +   C+ +K+ WR+ H +    W EL  A    I N GKA     
Sbjct: 830  PGKKDERPTYILPKNVWLTCDAIKRMWREAHPKTVAFWAELEDAVLCAIRNPGKAYWAGA 889

Query: 538  -----------IIARKRRDVPLVYMKKDKNN-----LILMLPSGRSLVY----------- 570
                       I+  K +  P    ++D  N     L + LPSGR + Y           
Sbjct: 890  NVRPDGRKALKIVRTKAKHDPTFDEERDDPNAAGWWLKIELPSGRIMSYPGIALSVTTEI 949

Query: 571  -RDVGNNRSYL-------NTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGY 622
              D G  R+         N TTRQ   +YTYGGKLTENIVQA+ RDILA  M     AGY
Sbjct: 950  DEDTGKKRTSTRIKYQGENQTTRQWGFQYTYGGKLTENIVQALCRDILAWSMPGVEAAGY 1009

Query: 623  DIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
            +IVL+VHDE++ E PDTD++    L  LM   P WAKG PL AEG    RYRK
Sbjct: 1010 EIVLSVHDELITEVPDTDDYTTEELCALMCDLPIWAKGFPLAAEGDCMYRYRK 1062


>gi|170729635|ref|YP_001775068.1| phage-related DNA polymerase [Xylella fastidiosa M12]
 gi|167964428|gb|ACA11438.1| phage-related DNA polymerase [Xylella fastidiosa M12]
          Length = 422

 Score =  213 bits (543), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 163/410 (39%), Positives = 206/410 (50%), Gaps = 59/410 (14%)

Query: 316 TGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTS---ITSDPDPLQIISDCVRSCVIASE 372
           TGRW+G +F P NLPRP+ S   +   I  +      +  D D + + S  +RSC+IA  
Sbjct: 21  TGRWAGRLFQPHNLPRPTLSQPVIAVGIDAMKAGCVDVVFD-DVMALTSSALRSCLIAPT 79

Query: 373 GKKLVVADLAGIEARVLAWMAGEQWKLKAF------------------------------ 402
            KKLVVADL+ IE RVLAW+AGE  KL AF                              
Sbjct: 80  HKKLVVADLSNIEGRVLAWLAGETPKLHAFGDFDTCQGVDGTWHSGEAITHGALRGAPIT 139

Query: 403 ----------ETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMA 452
                       G+D+Y   YA SF +AP  VTK+QR IGKV ELALGY GG  AF   A
Sbjct: 140 LQRNAEHEPIRQGDDIYKRAYAHSFGIAPQAVTKEQRQIGKVQELALGYGGGVGAFAAFA 199

Query: 453 STTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENH-PEHAIEDLFIGTACERVKKAWR 511
           +   ++L   A   +    P   ++A    +W + N  P   + D     AC+  K+AWR
Sbjct: 200 AMYHIDLEAMAE--QAALPPLLLQEAVEALQWTKANQRPTFGLSDR-AWLACDVFKRAWR 256

Query: 512 QKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYR 571
             H  ++  W  L   F  T   G    A     + + Y    +  L L LPSGR L Y 
Sbjct: 257 NAHPAIAAFWQALQ--FAATDAIGHPETAHTCCGITVQY---SRAWLRLRLPSGRVLYYA 311

Query: 572 ----DVGNNRSYLNT--TTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIV 625
               D     SY+ T   TR+ TR  TYGGKL ENI QAVSRD+LA  M     AGY IV
Sbjct: 312 APRVDEHGALSYMGTHPITRKWTRITTYGGKLVENITQAVSRDVLAACMPAIEAAGYAIV 371

Query: 626 LTVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           LTVHDE++ E  D   FNA+ L  LM + P WA+GLPL AEG+++ RYRK
Sbjct: 372 LTVHDEMITEADDNAAFNAAHLAALMATPPPWAQGLPLAAEGFQTHRYRK 421


>gi|71275469|ref|ZP_00651755.1| DNA-directed DNA polymerase [Xylella fastidiosa Dixon]
 gi|71900967|ref|ZP_00683080.1| DNA-directed DNA polymerase [Xylella fastidiosa Ann-1]
 gi|71163769|gb|EAO13485.1| DNA-directed DNA polymerase [Xylella fastidiosa Dixon]
 gi|71729272|gb|EAO31390.1| DNA-directed DNA polymerase [Xylella fastidiosa Ann-1]
          Length = 422

 Score =  213 bits (541), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 160/410 (39%), Positives = 205/410 (50%), Gaps = 59/410 (14%)

Query: 316 TGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTS---ITSDPDPLQIISDCVRSCVIASE 372
           TGRW+G +F P NLPRP+ S   +   I  +      +  D D + + S  +RSC+IA  
Sbjct: 21  TGRWAGRLFQPHNLPRPTLSQPVIAVGIDAMKAGCVDLVFD-DVMALTSSALRSCLIAPT 79

Query: 373 GKKLVVADLAGIEARVLAWMAGEQWKLKAFE----------------------------- 403
            KKLVVADL+ IE RVLAW+AGE  KL AF                              
Sbjct: 80  HKKLVVADLSNIEGRVLAWLAGETPKLHAFRDFDTCQGVDGTWHSGEAITHGALRGAPIT 139

Query: 404 -----------TGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMA 452
                       G+D+Y   YA SF +AP  VTK QR IGKV ELALGY GG  AF   A
Sbjct: 140 LQRNAEHEPIRQGDDIYKRAYAHSFGIAPQAVTKQQRQIGKVQELALGYGGGVGAFAAFA 199

Query: 453 STTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENH-PEHAIEDLFIGTACERVKKAWR 511
           +   ++L   A   +    P   ++A    +W + N  P   + D     AC+  K+AWR
Sbjct: 200 AMYHIDLEAMAE--QAALPPLLLQEAVEALQWTKANQRPTFGLSDR-AWLACDVFKRAWR 256

Query: 512 QKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYR 571
             H  ++  W  L  A    I + +            + M+  +  L + LPSGR L Y 
Sbjct: 257 NAHPAIAAFWKALQFAATDAIRHPETA-----HTCCGITMQYSRAWLRMHLPSGRVLYYA 311

Query: 572 ----DVGNNRSYLNT--TTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIV 625
               D     SY+ T   TR+ TR  TYGGKL ENI QAVSRD+LA  M     AGY IV
Sbjct: 312 APRVDEHGALSYMGTHPMTRKWTRITTYGGKLVENITQAVSRDVLAACMPAIEAAGYAIV 371

Query: 626 LTVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           LTVHDE++ E  D   FNA+ L  LM + P WA+GLPL AEG+++ RYRK
Sbjct: 372 LTVHDEMITEADDNAAFNAAHLAALMATPPPWAQGLPLAAEGFQTHRYRK 421


>gi|259502603|ref|ZP_05745505.1| prophage LambdaSa04 DNA-directed DNA polymerase [Lactobacillus
           antri DSM 16041]
 gi|259169418|gb|EEW53913.1| prophage LambdaSa04 DNA-directed DNA polymerase [Lactobacillus
           antri DSM 16041]
          Length = 470

 Score =  212 bits (539), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 164/525 (31%), Positives = 253/525 (48%), Gaps = 76/525 (14%)

Query: 170 EIFKRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTY 227
           EI ++LE  P+   E E +++DQ INDRG  +D  L +   +  +V   +  Q  + LT 
Sbjct: 2   EITQKLECFPVPQNEWENYWMDQDINDRGIRIDQQLVNNAIKCQNVFHDQYLQTAKELT- 60

Query: 228 GLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSA 287
           GL + +  L+ LK WL  + G   + L++ +  ++L +    T +  Q+   R   S+S+
Sbjct: 61  GLANPNSPLQ-LKDWL-QQQGAKTDSLSKASVAQLLQTT---TGKVHQILALRQLLSKSS 115

Query: 288 VLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSH-EELDQI---- 342
           V K   + +AM  DGR+ G LQF GA+RTGRW+G +   QNLPR S    EE  ++    
Sbjct: 116 VKKYQAMQKAMCQDGRVHGLLQFYGANRTGRWAGRLVQVQNLPRNSMPDLEEARKLVKQG 175

Query: 343 -ITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKA 401
            +T L     S PD   ++S  +R+  I S+     VAD + +EARV+AW++ E+W+ +A
Sbjct: 176 NVTALAMLYDSVPD---VLSQLIRTAFIPSKNHHFYVADFSAVEARVIAWLSNEEWRQEA 232

Query: 402 FETGEDLYVTTYARSFNVAPAQ--VTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNL 459
           F   ED+Y  + ++ F V   +  +  + R  GK+ ELALGY G   A + M +T     
Sbjct: 233 FAKNEDIYCASASQMFGVPVVKHGINGELRQKGKIAELALGYGGSIGALKAMGATK---- 288

Query: 460 NTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSE 519
                LV T+                 E  P               + + WR     + +
Sbjct: 289 -----LVLTDD----------------ELPP---------------LVQMWRNASPHIVQ 312

Query: 520 LWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVY--RDVGNNR 577
            W ++ +A ++ I   K  + +    +  +Y       + L L SGR L Y    +G NR
Sbjct: 313 FWWDVDKAAKECI---KTHLPQTTHGMKFIYR---SGCMFLRLRSGRYLCYPKPKIGTNR 366

Query: 578 ------SYLN-TTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHD 630
                 +++   T ++  R  TYG KL ENIVQA SRD+LAE M         +V+ +HD
Sbjct: 367 FGSESITFMGINTVKKWDRIETYGAKLVENIVQATSRDLLAEAMRRLEATENTVVMHIHD 426

Query: 631 EIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           E V + P     +   +  LMT  P WA GL L A G+ S  Y+K
Sbjct: 427 EAVIDAPSNRSLDT--MVQLMTEVPDWANGLILNAAGFVSDFYKK 469


>gi|144453|gb|AAA23103.1| putative DNA polymerase [Citrus greening disease-associated
           bacterium]
          Length = 206

 Score =  209 bits (533), Expect = 9e-52,   Method: Compositional matrix adjust.
 Identities = 107/205 (52%), Positives = 129/205 (62%), Gaps = 2/205 (0%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHDPVMPQVLKEA 60
           M+ LFID ETRSP  L K G+  YAE   + L A+ +D  PV+LWD      +P  L + 
Sbjct: 1   MSKLFIDIETRSPKPLPKVGVWAYAEQAIITLCAYAWDGEPVKLWDRTKQSAIPSDLLQY 60

Query: 61  LENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKLSS 120
           L +  V  VAHNS FER + K    +DIP  RWICT VLAR+NGLPS+LK    AL+   
Sbjct: 61  LRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALRFPE 120

Query: 121 Q--KMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREIFKRLEPL 178
              K EEGK LIARFCKG      YD  + NH +AW LF EYCK DV  TRE+FK L PL
Sbjct: 121 HLTKKEEGKALIARFCKGSIDSPPYDCTRANHVQAWALFREYCKRDVEATRELFKSLTPL 180

Query: 179 SSKEQELWYLDQTINDRGYCVDVAL 203
           + +E+ LW LDQ INDRGY +D+ L
Sbjct: 181 NPEERTLWLLDQEINDRGYRIDLDL 205


>gi|298240|gb|AAB25243.1| DNA polymerase homolog [bacterium-like organism, citrus greening
           disease-associated, Peptide, 207 aa]
          Length = 207

 Score =  208 bits (529), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 106/205 (51%), Positives = 129/205 (62%), Gaps = 2/205 (0%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHDPVMPQVLKEA 60
           ++ LFID ETRSP  L K G+  YAE   + L A+ +D  PV+LWD      +P  L + 
Sbjct: 2   VSKLFIDIETRSPKPLPKVGVWAYAEQAIITLCAYAWDGEPVKLWDRTKQSAIPSDLLQY 61

Query: 61  LENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKLSS 120
           L +  V  VAHNS FER + K    +DIP  RWICT VLAR+NGLPS+LK    AL+   
Sbjct: 62  LRDETVMCVAHNSLFERILFKKTLGIDIPSKRWICTSVLARTNGLPSSLKNACLALRFPE 121

Query: 121 Q--KMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREIFKRLEPL 178
              K EEGK LIARFCKG      YD  + NH +AW LF EYCK DV  TRE+FK L PL
Sbjct: 122 HLTKKEEGKALIARFCKGSIDSPPYDCTRANHVQAWALFREYCKRDVEATRELFKSLTPL 181

Query: 179 SSKEQELWYLDQTINDRGYCVDVAL 203
           + +E+ LW LDQ INDRGY +D+ L
Sbjct: 182 NPEERTLWLLDQEINDRGYRIDLDL 206


>gi|331090256|ref|ZP_08339143.1| hypothetical protein HMPREF1025_02726 [Lachnospiraceae bacterium
           3_1_46FAA]
 gi|330401875|gb|EGG81450.1| hypothetical protein HMPREF1025_02726 [Lachnospiraceae bacterium
           3_1_46FAA]
          Length = 419

 Score =  206 bits (523), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 137/406 (33%), Positives = 209/406 (51%), Gaps = 23/406 (5%)

Query: 3   TLFIDFETRSPIDLTKCGICKYAEDVC--VILFAFGFDDHPVELWDCVHDPVMPQVLKEA 60
           TL ID ET S +DL KCG+  YA+     ++LFA+ FDD   ++ D      + + +K A
Sbjct: 8   TLAIDIETFSDVDLIKCGVYAYADSPAFEILLFAYSFDDEETKIIDLAQGEQLTEEIKNA 67

Query: 61  LENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKLSS 120
           L +  +   A N+ FERT L     + +    W+CT V +    LP +L+ VG  L LS 
Sbjct: 68  LSDVGIIKTAFNANFERTCLSKYMGVRLSPESWVCTAVQSAMLALPLSLEGVGAVLGLSE 127

Query: 121 QKMEEGKELIARF---CKGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTREIFKRLE 176
           QK++EGK+LI  F   CK         RN P H  E W+ F  YC  DV V + I ++L 
Sbjct: 128 QKLKEGKDLIRYFCVPCKPTKTNGGRSRNLPFHAPEKWKQFKTYCIRDVDVEKGIRQKLH 187

Query: 177 --PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSSSR 234
             P+   E   + LDQ INDRG  VD  L    +   D+    +         GL  +  
Sbjct: 188 KFPIPESEMAFYRLDQEINDRGVLVDRELVEQ-SITCDLLHKDIVTNRAYEVTGL-ENPN 245

Query: 235 CLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLNTL 294
            + +LK WL  E G+ ++ L++     ++        +A+++   R+  ++++V K   +
Sbjct: 246 SVSQLKGWLS-ERGVEIDSLSKGAVAELIEDADGEVLEALKL---RLLMAKTSVKKYEAI 301

Query: 295 VEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIIT------HLPT 348
             ++ SDGR+ G LQF GA+RTGRW+G +   QNLP+   S  EL + +        L  
Sbjct: 302 ERSVCSDGRVHGLLQFYGANRTGRWAGRLVQVQNLPQNHISDLELARSLVRRGQFEELEL 361

Query: 349 SITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAG 394
              S P+   ++S+ +R+  I  EG + +VAD + IEARVLAW++G
Sbjct: 362 FYESTPN---VLSELIRTAFIPKEGCRFIVADFSAIEARVLAWLSG 404


>gi|83311820|ref|YP_422084.1| hypothetical protein amb2721 [Magnetospirillum magneticum AMB-1]
 gi|82946661|dbj|BAE51525.1| hypothetical protein [Magnetospirillum magneticum AMB-1]
          Length = 524

 Score =  203 bits (517), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 147/485 (30%), Positives = 220/485 (45%), Gaps = 108/485 (22%)

Query: 239 LKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLNTLVEAM 298
           L TWL  + G+  E + +   +++L+ +  +   A Q    R  A++++  KL  +V+  
Sbjct: 100 LTTWL-RDQGVETEGVAKAAVRQMLAGD--IEGAARQAVEIRAEAAKASTAKLTAMVKCA 156

Query: 299 NSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITSDPD--- 355
             DGR RG L  +  + TGRW+G +   QNLPR      +L      +P  I  D D   
Sbjct: 157 CDDGRARG-LHLVYGAGTGRWAGRLIQLQNLPRGVIKKADL-----AIPLIIDGDIDLVS 210

Query: 356 -----PLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFE-----TG 405
                PL +IS  +R C+I +EG   + +D + IE R+ AW+A E+WK++AF      TG
Sbjct: 211 MLFGPPLDVISSNLRGCLIPAEGCDFIQSDFSNIEGRITAWLANEEWKIQAFRDFDAGTG 270

Query: 406 EDLYV-----------TTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMAST 454
            DLY+             YA   N    + + ++   GKV ELALG+ GG  AFQ MA+ 
Sbjct: 271 RDLYLIGAEKILTLLKVLYAHPLN----ENSPERTPYGKVPELALGFGGGVGAFQSMAAI 326

Query: 455 TGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKH 514
            G+ +                 D E                        +++K AWR+ H
Sbjct: 327 YGMKVT----------------DEE-----------------------ADQIKVAWREAH 347

Query: 515 SRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYR--- 571
            RV  LW  +  A    I N   +++     +  V        L ++LPSGR L Y    
Sbjct: 348 PRVVALWRNMEDAAFNAISNPGRVVSTAGGRIKYVV---KGGFLWMVLPSGRPLAYAHPR 404

Query: 572 --------DVGNNRSYL---------NTTTRQLTREYTYGGKLTENIVQAVSRDILAEGM 614
                   ++G +   L         N+ TR+  R  TYGG L EN +QA++RD+LA  +
Sbjct: 405 IEKRRPAWNIGQDEIKLKDTITFMAVNSITRKWERCTTYGGSLAENAIQAIARDLLANAL 464

Query: 615 MNATKAGYDIVLTVHDEIVCE----TPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYES 670
           +    AGY +V+ VHDE + E        DEF +     +M   P+WA GLP+ A G+  
Sbjct: 465 LKLEAAGYPVVIHVHDEALAEVRKGVGSVDEFKS-----IMCDTPAWAAGLPVAAAGWRG 519

Query: 671 KRYRK 675
            RYRK
Sbjct: 520 SRYRK 524


>gi|83311029|ref|YP_421293.1| hypothetical protein amb1930 [Magnetospirillum magneticum AMB-1]
 gi|82945870|dbj|BAE50734.1| hypothetical protein [Magnetospirillum magneticum AMB-1]
          Length = 516

 Score =  201 bits (512), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 143/469 (30%), Positives = 214/469 (45%), Gaps = 107/469 (22%)

Query: 255 TETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGAS 314
           T+   +++L+ +  +   A Q    R  A++++  KL  +V+    DGR RG L  +  +
Sbjct: 107 TKAAVRQMLAGD--IEGAARQAVEIRAEAAKASTAKLTAMVKCACDDGRARG-LHLVYGA 163

Query: 315 RTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITSDPD--------PLQIISDCVRS 366
            TGRW+G +   QNLPR S    +L      +P  I  D D        PL +IS  +R 
Sbjct: 164 GTGRWAGRLIQLQNLPRGSVKKADL-----AIPLIIDGDIDLVSMLFGPPLDVISSNLRG 218

Query: 367 CVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFE-----TGEDLYV----------- 410
           C+I +EG   + +D + IE R+ AW+A E+WK++AF      TG DLY+           
Sbjct: 219 CLIPAEGCDFIQSDFSNIEGRITAWLANEEWKIQAFRDFDAGTGRDLYLIGAEKILTLLK 278

Query: 411 TTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVKTNS 470
             YA   N    + ++++   GKV ELALG+ GG  AFQ MA+  G+ +           
Sbjct: 279 VPYAHPLN----ENSQERTPYGKVPELALGFGGGVGAFQSMAAIYGMKVT---------- 324

Query: 471 APEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELHQAFEQ 530
                 D E                        +++K AWR+ H RV  LW  +  A   
Sbjct: 325 ------DEE-----------------------ADQIKVAWREAHPRVVALWRNMEDAAFN 355

Query: 531 TIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYR-----------DVGNNRSY 579
            I N   +++     +  V        L ++LPSGR L Y            ++G +   
Sbjct: 356 AISNPGRVVSTAGGRIKYVV---KGGFLWMVLPSGRPLAYAHPRIEKRRPAWNIGQDEIK 412

Query: 580 L---------NTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHD 630
           L         N+ TR+  R  TYGG L EN +QA++RD+LA  ++    AGY +V+ VHD
Sbjct: 413 LKDTITFMSVNSITRKWERCTTYGGSLAENAIQAIARDLLANALLKLEAAGYPVVIHVHD 472

Query: 631 EIVCE----TPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           E + E        DEF +     +M   P+WA GLP+ A G+   RYRK
Sbjct: 473 EALAEIRKGVGSVDEFKS-----IMCDTPAWAAGLPVAAAGWRGSRYRK 516


>gi|28199207|ref|NP_779521.1| phage-related DNA polymerase [Xylella fastidiosa Temecula1]
 gi|182681937|ref|YP_001830097.1| DNA-directed DNA polymerase [Xylella fastidiosa M23]
 gi|28057313|gb|AAO29170.1| phage-related DNA polymerase [Xylella fastidiosa Temecula1]
 gi|182632047|gb|ACB92823.1| DNA-directed DNA polymerase [Xylella fastidiosa M23]
 gi|307578195|gb|ADN62164.1| DNA-directed DNA polymerase [Xylella fastidiosa subsp. fastidiosa
           GB514]
          Length = 377

 Score =  200 bits (508), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 127/332 (38%), Positives = 170/332 (51%), Gaps = 49/332 (14%)

Query: 154 WRLFGEYCKGDVTVTREIFKRLEP--LSSKEQELWYLDQTINDRGYCVDVALAHTLNQIV 211
           W  F +Y + DV   R++ KRL     +  E  LW+LDQTINDRG  VD  LA      V
Sbjct: 3   WAQFVDYARRDVAAMRDVVKRLPSHNYTGAELALWFLDQTINDRGVLVDTDLAQAAIGAV 62

Query: 212 DVERTKLDQELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTP 271
           +  +  L +    LT G+V ++   + L   L    G+ L D+ + T +R L  +  L P
Sbjct: 63  ERAKQALAERTSDLTAGVVQAATQRDALLHHLSTAHGVALPDMQQHTVERCL--DDPLLP 120

Query: 272 QAI-QVFNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLP 330
           + + ++ + R +AS ++  K   L+   + DGRLRGTLQF GASRTGRW+G +F P NLP
Sbjct: 121 ETVRELLSIRRQASTTSTAKYQALLNCTSRDGRLRGTLQFNGASRTGRWAGRLFQPHNLP 180

Query: 331 RPSRSHEELDQIITHLPTS---ITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEAR 387
           RP+ S E +   I  +      +  D D + + S  +RSC+IA   KKLVVADL+ IE R
Sbjct: 181 RPTLSQEAITVGIDAMKAGCVDLVFD-DVMALTSSALRSCLIAPTHKKLVVADLSNIEGR 239

Query: 388 VLAWMAGEQWKLKAF----------------------------------------ETGED 407
           VLAW+AGE  KL AF                                          G+D
Sbjct: 240 VLAWLAGETPKLHAFGEFDTCQGVDGTWHSGEAITHGALRGAPITLQWNAEHAPIRKGDD 299

Query: 408 LYVTTYARSFNVAPAQVTKDQRAIGKVMELAL 439
           +Y   YA SF +AP  VTK QR IGKV ELAL
Sbjct: 300 IYKRAYAHSFGIAPQAVTKQQRQIGKVQELAL 331


>gi|71902066|ref|ZP_00684106.1| DNA-directed DNA polymerase [Xylella fastidiosa Ann-1]
 gi|71728177|gb|EAO30368.1| DNA-directed DNA polymerase [Xylella fastidiosa Ann-1]
          Length = 384

 Score =  195 bits (496), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 146/368 (39%), Positives = 185/368 (50%), Gaps = 55/368 (14%)

Query: 355 DPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFE----------- 403
           D + + S  +RSC+IA   KKLVVADL+ IE RVLAW+AGE  KL AF            
Sbjct: 24  DVMALTSSALRSCLIAPTHKKLVVADLSNIEGRVLAWLAGETPKLHAFRDFDTCQGVDGT 83

Query: 404 -----------------------------TGEDLYVTTYARSFNVAPAQVTKDQRAIGKV 434
                                         G+D+Y   YA SF +AP  VTK+QR IGKV
Sbjct: 84  WHSGEAITHGALRGAPITLQRNAEHEPIRQGDDIYKRAYAHSFGIAPQAVTKEQRQIGKV 143

Query: 435 MELALGYQGGAKAFQKMASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENH-PEHA 493
            ELALGY GG  AF   A+   ++L   A   +    P   ++A    +W + N  P   
Sbjct: 144 QELALGYGGGVGAFAAFAAMYHIDLEAMAE--QAALPPLLLQEAVEALQWTKANQRPTFG 201

Query: 494 IEDLFIGTACERVKKAWRQKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKK 553
           + D     AC+  K+AWR  H  ++  W  L  A    I + +            + M+ 
Sbjct: 202 LSDR-AWLACDVFKRAWRNAHPAIAAFWKALQFAATDAIRHPETA-----HTCCGITMQY 255

Query: 554 DKNNLILMLPSGRSLVYR----DVGNNRSYLNT--TTRQLTREYTYGGKLTENIVQAVSR 607
            +  L + LPSGR L Y     D     SY+ T   TR+ TR  TYGGKL ENI QAVSR
Sbjct: 256 SRAWLRMHLPSGRVLYYAAPRVDEHGALSYMGTHPMTRKWTRITTYGGKLVENITQAVSR 315

Query: 608 DILAEGMMNATKAGYDIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEG 667
           D+LA  M     AGY IVLTVHDEI+ E  D   FNA+ L  LM + P WA+GLPL AEG
Sbjct: 316 DVLAACMPAIEAAGYQIVLTVHDEIITEADDNAAFNAAHLAALMATPPPWAQGLPLAAEG 375

Query: 668 YESKRYRK 675
           +++ RYRK
Sbjct: 376 FQTHRYRK 383


>gi|324103779|gb|ADY17820.1| DNA polymerase [Eupelmus vesicularis secondary endosymbiont phage]
          Length = 234

 Score =  192 bits (489), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 102/226 (45%), Positives = 143/226 (63%), Gaps = 12/226 (5%)

Query: 253 DLTETTCQRVLSSNKKLTPQAI-QVFNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFL 311
           D+  +T QR +  N    P+A+ ++ + R+++  ++  K   L+++++ DGRLRGT QF 
Sbjct: 1   DMQASTLQRRV--NDPDIPRALRELLSVRLQSCTTSTSKYKALLKSVSVDGRLRGTKQFC 58

Query: 312 GASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTS---ITSDPDPLQIISDCVRSCV 368
           GASRTGRW+G +F P NLPRP+   + +D+ +  L      +  D D +Q+ S  +R C+
Sbjct: 59  GASRTGRWAGRIFQPDNLPRPTLDQKTIDEGVEALKAGCAELICD-DIMQLTSSALRGCI 117

Query: 369 IASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFE-----TGEDLYVTTYARSFNVAPAQ 423
           IA +GKKLV++DL+ IE R+LAW+AGE WK+KAF       G+DLY   YAR+FN+ P  
Sbjct: 118 IAPQGKKLVISDLSNIEGRMLAWLAGENWKVKAFSEFDNGKGDDLYKLAYARAFNLLPKN 177

Query: 424 VTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVKTN 469
           VTK QR IGKVMEL LGY GG  AF   A   GLNL+  A     N
Sbjct: 178 VTKAQRQIGKVMELGLGYGGGVAAFLTFALAYGLNLDELAEAALPN 223


>gi|149882966|ref|YP_001294903.1| DNA polymerase I [Burkholderia phage BcepNY3]
 gi|148763617|gb|ABR10600.1| DNA polymerase I [Burkholderia phage BcepNY3]
          Length = 656

 Score =  192 bits (488), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 199/715 (27%), Positives = 305/715 (42%), Gaps = 108/715 (15%)

Query: 4   LFIDFETRSPIDLTKCGICKYAEDVCVILFAFGF---DDHPVELWDCVHDPVMPQVLKEA 60
           LF+DFET S  DLT+ G+ +Y  D     + F F        +LW+      +P+V+   
Sbjct: 6   LFLDFETSSHTDLTEHGLGRYLADQSTRAYCFTFRLPGMSTADLWEVGQR--VPEVITRH 63

Query: 61  LENTDVTIVAHNSYFE----RTVLKACFNL-DIP---IHRWICTLVLARSNGLPSALKAV 112
           +    +  VAHN+ F+     TVL+      D+P   I +  C+   AR NGLP +L   
Sbjct: 64  VRAGHL-FVAHNAPFDFWIWNTVLRRQRGYHDLPELQIGQVRCSAARARYNGLPGSLAGA 122

Query: 113 GEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREIF 172
            EAL L  QK  EG + +             D    +H E +    +Y   D      ++
Sbjct: 123 CEALGLPVQKDTEGAKWMKEIAANP------DWTPADHPEHFARTYKYALIDTDAMVGVW 176

Query: 173 KRLEPLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSS 232
           +   PL ++EQ  + +D  IN RG  VDV  A  +  +      +LD E+  LT G V +
Sbjct: 177 ENTVPLPAREQAYFEMDMRINARGIGVDVEAAQAMEDLKAFAEAQLDYEMAYLTDGGVLA 236

Query: 233 SRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLN 292
              +EK+KT+     G  ++D    T +++ ++   L     Q+   R+ ASR+   K +
Sbjct: 237 VSEVEKIKTYA-ATLGEDMDDAGRETLKKI-AARDNLPDSLRQLIELRLDASRAP--KKS 292

Query: 293 TLVEAMNSDGRLRGTLQFLGA---SRTGRWSGCVFPPQNL----PRPSRSHEE----LDQ 341
             +   +  GRL+ +  + GA     T R +G     Q L    PRP +   +    LD 
Sbjct: 293 AAILRAHVGGRLQHSTIYHGALSGRSTARGAGGA---QTLNTARPRPGKKTADCEAILDA 349

Query: 342 IITHLPTSITS-DPDP-LQIISDCVRSCVIASE-GKKLVVADLAGIEARVLAWMAGEQWK 398
            + H    ++S +  P L  ++D  R    A++ G  LV ADL+GIEAR   W+AG+   
Sbjct: 350 CLRHDRAYLSSPEVGPILAALADAQRQLFRATQPGHVLVGADLSGIEARFSPWIAGDLEL 409

Query: 399 LKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLN 458
           L+AFE G D Y    A  F V    VTKDQR IGKV  LAL Y GGA AF  MA+  G++
Sbjct: 410 LEAFEKGVDPYKLAAAAIFQVTYEAVTKDQRQIGKVAMLALTYGGGAGAFVSMAANYGVH 469

Query: 459 LNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVS 518
           L                              P   ++++ +          WR       
Sbjct: 470 L------------------------------PPEQVDEIVLN---------WRAARPAFE 490

Query: 519 ELWNELHQAFEQTIE--NGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDV--- 573
             W+    +    ++  N +  +   R     V    D   L + LPSGR++ Y +    
Sbjct: 491 RWWSLCEYSVLMALDQPNREITMPIGRDFCSHVTFVHDGRALRMQLPSGRAISYHNARLH 550

Query: 574 ---GNN---------RSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAG 621
              G N           Y+ T  R++         L+ N+ Q ++RD+    +++  +  
Sbjct: 551 LEPGANVPIAIYDKPEGYIETLDRKI---------LSNNMTQGLARDLFWSVLLDVDRV- 600

Query: 622 YDIVLTVHDEIVCET-PDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
             IV  V+DE + E   +  E     L   M    +W  GLPL AEG+   R+RK
Sbjct: 601 EQIVHHVYDEALLEVREEVAELRCDQLVERMCRGEAWCPGLPLGAEGWFGLRWRK 655


>gi|324103777|gb|ADY17819.1| DNA polymerase [Spalangia cameroni secondary endosymbiont phage]
          Length = 234

 Score =  190 bits (482), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 100/226 (44%), Positives = 143/226 (63%), Gaps = 12/226 (5%)

Query: 253 DLTETTCQRVLSSNKKLTPQAI-QVFNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFL 311
           D+  +T QR +  N    P+A+ ++ + R+++  ++  K   L++++++DGRLRGT QF 
Sbjct: 1   DMQASTLQRRV--NDPDIPRALRELLSVRLQSCTTSTSKXKALLKSVSADGRLRGTKQFC 58

Query: 312 GASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTS---ITSDPDPLQIISDCVRSCV 368
           GASRTGRW+G +F P NLPRP+   + +D+ +  L      +  D D +Q+ S  +R C+
Sbjct: 59  GASRTGRWAGRIFQPDNLPRPTLDQKTIDEGVEALKAGCAELICD-DIMQLTSSALRGCI 117

Query: 369 IASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFE-----TGEDLYVTTYARSFNVAPAQ 423
           IA +GKKLV++DL+ IE R+LAW+AGE WK+ AF       G+DLY   YAR+FN+ P  
Sbjct: 118 IAPQGKKLVISDLSNIEGRMLAWLAGENWKVNAFSEFDNGKGDDLYKLAYARAFNLLPKN 177

Query: 424 VTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVKTN 469
           VTK QR IGKVMEL LGY GG  AF   A   GL+L+  A     N
Sbjct: 178 VTKAQRQIGKVMELGLGYGGGVAAFLTFALAYGLDLDELAEAALPN 223


>gi|84662708|ref|YP_453672.1| putative DNA polymerase I [Xanthomonas phage OP2]
 gi|84570757|dbj|BAE72819.1| putative DNA polymerase I [Xanthomonas oryzae phage OP2]
          Length = 658

 Score =  189 bits (481), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 199/726 (27%), Positives = 311/726 (42%), Gaps = 129/726 (17%)

Query: 4   LFIDFETRSPIDLTKCGICKYAEDVCVILFAFGF---DDHPVELWDCVHDPVMPQVLKEA 60
           LF+DFE  S  DL   G+ +Y        + F F        +LW+ +  P+  Q+L   
Sbjct: 8   LFLDFEVASKTDLKAHGLARYLACPTTKPYCFTFVLPGMRQADLWE-LGQPIPRQILAHI 66

Query: 61  LENTDVTIVAHNSYFERTVLKACFNLDIPIHRWI--------------CTLVLARSNGLP 106
                 T VAHN+ F+  +    +N  +P  RW+              C+   AR NGLP
Sbjct: 67  AAGK--TFVAHNAAFDALI----WNDVLP--RWVKADLPQLNLRGQVQCSAARARYNGLP 118

Query: 107 SALKAVGEALKLSSQKMEEGKELIARFCKGE-----THECLYDRNKPNHREAWRLFGEYC 161
             L    EAL L  QK  EG   +            TH  L+ R             +Y 
Sbjct: 119 GGLGRAAEALGLPLQKDREGAAAMKELMHNPEWTPATHPELFARTY-----------KYA 167

Query: 162 KGDVTVTREIFKRLEPLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQE 221
             D  V   +++  +P+  KEQ  W LD  IN RG+ VDV  A  + ++  + +  +D E
Sbjct: 168 LLDTDVMVALWEATQPMPPKEQLYWQLDLEINMRGFGVDVEAAEGMAEMAQLAQAMIDFE 227

Query: 222 LESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQ-VFNNR 280
           +E+ T G + ++  +++++++     G  L++    + + +L+ +    P+ ++ V   R
Sbjct: 228 VETATQGKILTTSVIKQIQSFA-AGLGAELDEAGRESVKALLTRDD--VPEVLRDVLTLR 284

Query: 281 MRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWS--GCV-FPPQNLPRPSRSHE 337
           + ASR A  K + ++ A + +GR+  +  + GA  +GR +  GC      N+ RP R   
Sbjct: 285 LDASR-APKKHDAILRA-HVNGRMCHSTVYHGA-LSGRSTAMGCGDVQLLNVARP-RPGR 340

Query: 338 ELDQIITHLPTSITSDPD---------PLQIISDCVRSCVIASE-GKKLVVADLAGIEAR 387
           ++   IT+L  +   D D         PL  ++D  R    A+  G  LVVADL+GIEAR
Sbjct: 341 KVKDTITYLDAARRRDYDYLSRPEVGPPLAALADAQRHLFCATNPGCILVVADLSGIEAR 400

Query: 388 VLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQ-VTKDQRAIGKVMELALGYQGGAK 446
              W+A ++  L  +E G D Y    A  F++     VT DQR IGK+  LAL + GG  
Sbjct: 401 KGPWLANDEGMLVEYEQGIDGYKVEAATIFDLPDTDAVTSDQRQIGKITRLALQFGGGDG 460

Query: 447 AFQKMASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERV 506
           A   MA   GL L+               ED      W                      
Sbjct: 461 ALDNMAKAYGLELS---------------EDLRRKIVW---------------------- 483

Query: 507 KKAWRQKHSRVSELWNEL-HQAFEQTIENGKAIIARKRRDV-PLVYMKKDKNNLILMLPS 564
             ++R+ H  +S  W  L + A     + G+A++    R +       +D   L + LPS
Sbjct: 484 --SYRESHPALSTWWASLEYAALIALDQPGRAVVVPIGRGLCTSATFVRDTTALRMELPS 541

Query: 565 GRSLVYRDVGNNRSYL--------------NTTTRQLTREYTYGGKLTENIVQAVSRDIL 610
           GR++ Y    N R  L              N     L R+      L+ N+ Q ++RD+ 
Sbjct: 542 GRAISYH---NARLVLEPGASAPIAVYDKPNGVVETLDRKI-----LSNNMTQGLARDLF 593

Query: 611 AEGMMNATKAGYDIVLTVHDEIVCETPDT-DEFNASMLYHLMTSNPSWAKGLPLKAEGYE 669
            E M++       IV  V+DE++ E P+   E     L   ++  P WA GLPL AEG+ 
Sbjct: 594 WEAMLSVAPV-EQIVHHVYDEVILEVPEERAELRLKQLEARLSKAPLWAPGLPLGAEGFV 652

Query: 670 SKRYRK 675
           S  +RK
Sbjct: 653 SPYWRK 658


>gi|324103783|gb|ADY17822.1| DNA polymerase [Arsenophonus nasoniae]
 gi|324103785|gb|ADY17823.1| DNA polymerase [Eupelmus vesicularis secondary endosymbiont phage]
          Length = 234

 Score =  189 bits (479), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 100/226 (44%), Positives = 143/226 (63%), Gaps = 12/226 (5%)

Query: 253 DLTETTCQRVLSSNKKLTPQAI-QVFNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFL 311
           D+  +T QR +  N    P+A+ ++ + R+++  ++  K   L++++++DGRLRGT QF 
Sbjct: 1   DMQASTLQRRV--NDPDIPRALRELLSVRLQSCTTSTSKYKALLKSVSADGRLRGTKQFC 58

Query: 312 GASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTS---ITSDPDPLQIISDCVRSCV 368
           GASRTGRW+G +F P NLPRP+   + +D+ +  L      +  D D +Q+ S  +R C+
Sbjct: 59  GASRTGRWAGRIFQPDNLPRPTLDQKTIDEGVEALKAGCAELICD-DIMQLTSSALRGCI 117

Query: 369 IASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFE-----TGEDLYVTTYARSFNVAPAQ 423
           IA +GKKLV++DL+ IE R+LAW+AGE WK+KAF       G+DLY   YAR+F + P  
Sbjct: 118 IAPQGKKLVISDLSNIEGRMLAWLAGENWKVKAFSEFDNGKGDDLYKLAYARAFYLLPEN 177

Query: 424 VTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVKTN 469
           VTK QR IGKVMEL LGY GG  AF   A   GL+L+  A     N
Sbjct: 178 VTKAQRQIGKVMELGLGYGGGVAAFLTFALAYGLDLDELAEAALPN 223


>gi|324103781|gb|ADY17821.1| DNA polymerase [Nasonia vitripennis secondary endosymbiont phage]
          Length = 234

 Score =  185 bits (469), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 99/226 (43%), Positives = 141/226 (62%), Gaps = 12/226 (5%)

Query: 253 DLTETTCQRVLSSNKKLTPQAI-QVFNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFL 311
           D+  +T QR +  N    P+A+ ++ + R+++  ++  K   L++++++DGRLRGT QF 
Sbjct: 1   DMQASTLQRRV--NDPDIPRALRELLSVRLQSCTTSTSKYKALLKSVSADGRLRGTKQFC 58

Query: 312 GASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTS---ITSDPDPLQIISDCVRSCV 368
           GASRTGRW+G +F P NLPRP+   + +D+ +  L      +  D D +Q+ S  +R C+
Sbjct: 59  GASRTGRWAGRIFQPDNLPRPTLDQKTIDEGVEALKAGCAELICD-DIMQLTSSALRGCI 117

Query: 369 IASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFE-----TGEDLYVTTYARSFNVAPAQ 423
           IA  GKKLV++DL+ IE R+LAW+AGE WK+ AF       G+DLY   YAR+F + P  
Sbjct: 118 IAPXGKKLVISDLSNIEGRMLAWLAGENWKVXAFSEFDNGKGDDLYKLAYARAFYLLPXN 177

Query: 424 VTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVKTN 469
           VTK QR IGKVMEL LGY GG  AF   A   GL+L+  A     N
Sbjct: 178 VTKAQRQIGKVMELGLGYGGGVAAFLTFALAYGLDLDEXAEAALPN 223


>gi|253316034|ref|ZP_04839247.1| phage encoded DNA polymerase I [Staphylococcus aureus subsp. aureus
           str. CF-Marseille]
          Length = 368

 Score =  183 bits (464), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 137/414 (33%), Positives = 191/414 (46%), Gaps = 67/414 (16%)

Query: 280 RMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEEL 339
           R++ S+++V K N + + M SD R+RG  QF GA  TGRW+G     QNL +   S  EL
Sbjct: 3   RLQMSKTSVKKYNKMHDMMCSDERVRGLFQFYGAG-TGRWAGRGVQLQNLTKHYISDTEL 61

Query: 340 DQIITHLPTSITSDPD------PLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMA 393
           +     +      D D      P  ++S  VR+   A EG +L V+D + IEARV+AW A
Sbjct: 62  EIARDLIKEQRFDDLDLLLNVHPQDLLSQLVRTTFTAEEGNELAVSDFSAIEARVIAWYA 121

Query: 394 GEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQ--RAIGKVMELALGYQGGAKAFQKM 451
            EQW+L  F T   +Y  + ++ FNV    +TK    R  GKV ELALGYQGGA A + M
Sbjct: 122 KEQWRLDVFNTHGKIYEASASQMFNVPVESITKGDPLRQKGKVSELALGYQGGAGALKAM 181

Query: 452 AS-TTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAW 510
            +   G+  N    LV +                                         W
Sbjct: 182 GALEMGIEENELQGLVDS-----------------------------------------W 200

Query: 511 RQKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVY 570
           R  +  +   W    +A   T+++ K       R     YMK  K  L++ LPSGR+L Y
Sbjct: 201 RNANPNIVNFWKACQEAAINTVKSRKTHHTHGLR----FYMK--KGFLMIELPSGRALAY 254

Query: 571 RD--VGNNR------SYLN-TTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAG 621
               VG N        ++     R+ ++  TYGGKL ENIVQA +RD+LA  +      G
Sbjct: 255 PKALVGENSWGSQVVEFMGLDLNRKWSKLKTYGGKLVENIVQATARDLLAISIARLEALG 314

Query: 622 YDIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           + IV  VHDE++ E P         +  +M     WAKGL L ++G+ S  Y K
Sbjct: 315 FKIVGHVHDEVIVEIPRGSN-GLKEIETIMNKPVDWAKGLNLNSDGFTSPFYMK 367


>gi|41057712|ref|NP_958166.1| gp61 [Burkholderia phage Bcep43]
 gi|40737699|gb|AAR89352.1| gp61 [Burkholderia phage Bcep43]
          Length = 656

 Score =  178 bits (452), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 187/715 (26%), Positives = 299/715 (41%), Gaps = 108/715 (15%)

Query: 4   LFIDFETRSPIDLTKCGICKYAEDVCVILFAFGF---DDHPVELWDCVHDPVMPQVLKEA 60
           LF+DFE  S  DLT+ G+ +Y +D     + F F        +LW+  +  V+P+ +   
Sbjct: 6   LFLDFEASSKTDLTEAGLGRYLDDPTTRAYCFTFRLPGMATADLWE--YGNVVPKQIVMH 63

Query: 61  LENTDVTIVAHNSYFERTVLKACFNL-----DIP---IHRWICTLVLARSNGLPSALKAV 112
           L +  +  VAHN+ F+  +            D+P   I +  C+   AR NGLP +L   
Sbjct: 64  LTSGGL-FVAHNAPFDFWIWNLILRRQHGYHDLPEIQIGQVRCSAARARYNGLPGSLAGA 122

Query: 113 GEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREIF 172
            EAL L  QK  EG + +             D    +H E +    +Y   D      ++
Sbjct: 123 CEALGLPVQKDTEGAKWMKEIAANP------DWTPTDHPEHFSRTYKYALIDTDAMVGVW 176

Query: 173 KRLEPLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSS 232
           +   PL  +EQ  + +D  IN RG  VDV  A  +  +      +LD E+  LT G + +
Sbjct: 177 ESTVPLPPREQAYFEMDMRINARGIGVDVEAAQAMEDLKAFAEAQLDYEMAYLTDGGILA 236

Query: 233 SRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLN 292
              + K+K +     G  ++D    T +++ ++   L     Q+   R+ ASR+   K +
Sbjct: 237 VTEVAKIKEYA-ATLGEDMDDAGRETLKKI-AARDNLPDSLRQLIELRLDASRAP--KKS 292

Query: 293 TLVEAMNSDGRLRGTLQFLGA---SRTGRWSGCVFPPQNL----PRPSRSHEELDQIITH 345
             +   +  GRL+    + GA     T R +G     Q L    PRP +   + + I+  
Sbjct: 293 AAILRAHVGGRLQHHTIYHGALSGRSTARGAGGA---QTLNTARPRPGKKTADCEAILDA 349

Query: 346 L---PTSITSDPDP---LQIISDCVRSCVIASE-GKKLVVADLAGIEARVLAWMAGEQWK 398
                 +  S P+    L  ++D  R    A++ G  LV ADL+GIEAR+  W+A +  K
Sbjct: 350 CLRGDRAYLSSPEVGPILAALADAQRQLFRATKPGHVLVGADLSGIEARMAPWLANDVPK 409

Query: 399 LKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLN 458
           L+AFE G D Y       +++    VTKDQR +GK  +LALG+ G   AF  MA+  G++
Sbjct: 410 LEAFEKGIDGYKLAAMDIYSIEYDAVTKDQRQVGKAADLALGFGGADGAFASMAANYGVH 469

Query: 459 LNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVS 518
           L                              PE   E ++           WR       
Sbjct: 470 LP-----------------------------PEQVSEIVY----------NWRAGRPAFE 490

Query: 519 ELWNEL-HQAFEQTIENGKAIIAR-KRRDVPLVYMKKDKNNLILMLPSGRSLVYRDV--- 573
             W+   + A     + G+ I+    R +   +   KD   L + LPSGR++ Y +    
Sbjct: 491 RWWSLCEYSALMALDQPGREIVMPVGRNNCSQITFVKDARALRMHLPSGRAISYHNARLH 550

Query: 574 ---GNN---------RSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAG 621
              G N           Y+ T  R++         L+ N  Q +SRD+    +++  +  
Sbjct: 551 LEPGANVPIAIYDKPEGYVETLDRKI---------LSNNQTQGLSRDLFWSVLLDVDRV- 600

Query: 622 YDIVLTVHDEIVCET-PDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
            +IV  ++DE + E   +        L   M    +W  GLPL AEG+   R+RK
Sbjct: 601 EEIVHHIYDEALLEVLAELAALREKQLVERMCRGEAWCPGLPLGAEGWHGLRWRK 655


>gi|325478660|gb|EGC81771.1| DNA-directed DNA polymerase [Anaerococcus prevotii ACS-065-V-Col13]
          Length = 952

 Score =  175 bits (444), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 117/328 (35%), Positives = 177/328 (53%), Gaps = 16/328 (4%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M  L ID ET S +DL K G+ KYAE  D  ++LFA+  DD  V++ D  +  ++P+ + 
Sbjct: 1   MKKLSIDLETYSSVDLGKSGVYKYAESEDFEILLFAYSIDDGGVKVIDLSNGEIIPEEIL 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKL 118
            AL +  +   A N+ FER  L       +    W CT++ +   GLP +L+ VGE LKL
Sbjct: 61  SALSDKSIEKWAFNASFERVCLSRFLGKRLKPQGWYCTMIWSAYLGLPLSLEKVGEVLKL 120

Query: 119 SSQKMEEGKELIARF---CKGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTREIFKR 174
             QKM EGK LI  F   CK      +  RN P+H  E W  F EY + DV    EI K+
Sbjct: 121 DKQKMNEGKALIRYFSIPCKPTKTNGMRTRNLPHHDLEKWSTFKEYNQRDVETEMEIKKK 180

Query: 175 LE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTK-LDQELESLTYGLVS 231
           L   P+   E E +++DQ INDRG  +D  L  +  +  ++ R + +D+ +E LT GL +
Sbjct: 181 LSAFPMPQSEWENYWVDQNINDRGILIDEVLVDSAIKFDEILREENMDRAIE-LT-GLEN 238

Query: 232 SSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKL 291
            +  ++ LK WL  E GL ++ L +   +  L + +    + +++   R   S+S+V K 
Sbjct: 239 PNSPMQ-LKEWLN-EKGLEIDSLAKKDVESALKNAEGDIKEVLEL---RQELSKSSVRKY 293

Query: 292 NTLVEAMNSDGRLRGTLQFLGASRTGRW 319
           + +     +D R+RG LQF GA+RTGR+
Sbjct: 294 DAMKNVKGNDKRVRGLLQFYGANRTGRY 321



 Score =  163 bits (412), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 104/332 (31%), Positives = 161/332 (48%), Gaps = 62/332 (18%)

Query: 356 PLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYAR 415
           P  ++S  +R+  I  EG + +V+D + IEARVLAW+AGE W L AF+ GED+Y +T ++
Sbjct: 670 PSDVLSQLIRTAFIPKEGCRFIVSDFSAIEARVLAWLAGEDWVLNAFKNGEDIYCSTASQ 729

Query: 416 SFNVAPAQ--VTKDQRAIGKVMELALGYQGGAKAFQKMAST-TGLNLNTFAHLVKTNSAP 472
            F V   +  V  D R  GKV  LA GY G   A + M +   GL+ +    +V +    
Sbjct: 730 MFGVPVVKHGVNGDLRQKGKVATLACGYGGSVGALKAMGAIEMGLSEDELQSIVDS---- 785

Query: 473 EEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELHQAFEQTI 532
                                                WR+ +  +  LW ++    ++ +
Sbjct: 786 -------------------------------------WREANPNIVSLWWDIDSVVKRVV 808

Query: 533 ENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVY--RDVGNNRSYLNTTT------ 584
           +       R + +   + +  +K  L + LPS R L Y    +G NR    +        
Sbjct: 809 K------TRSKEEYKNLVISYEKGILFIELPSKRRLAYPKAKIGMNRFGGESIVYEGIVV 862

Query: 585 -RQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETPDTDEFN 643
             +  +  +YGGK  ENIVQA++RDILAE MM   K G++IV+ +HDE+V E   +D  +
Sbjct: 863 GNKWDKIESYGGKFVENIVQAIARDILAEAMMRLEKKGFNIVMHIHDEVVIE---SDSSS 919

Query: 644 ASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
              +  +M+  PSWA GL L A+G+ES+ Y+K
Sbjct: 920 IEEINEIMSLVPSWAPGLILDADGFESEFYKK 951


>gi|194432044|ref|ZP_03064333.1| Bbp42 [Shigella dysenteriae 1012]
 gi|194419573|gb|EDX35653.1| Bbp42 [Shigella dysenteriae 1012]
 gi|332089212|gb|EGI94319.1| DNA polymerase [Shigella dysenteriae 155-74]
          Length = 449

 Score =  174 bits (441), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 119/338 (35%), Positives = 169/338 (50%), Gaps = 17/338 (5%)

Query: 86  LDIPIHRWICTLVLARSNGLPSALKAVGEALKLSSQKME--EGKELIARFCKGETHECLY 143
           L  P+ RW  T+V A ++GLP +L  + E L +   K +  EGK LI  FCK        
Sbjct: 4   LAPPVERWRDTMVQALAHGLPGSLGELCEVLGVPQDKAKDKEGKALIQLFCKPRPKNSKL 63

Query: 144 DR-NKPNHREAWRLFGEYCKGDVTVTREIFKRLEPLSSKEQEL--WYLDQTINDRGYCVD 200
            R     H E WR F  Y   D+   RE++ RL   + +  EL  W+ DQ INDRG C+D
Sbjct: 64  RRATSKTHPEEWRRFVAYAGLDIEAMREVYNRLPKWNYQGTELALWHRDQQINDRGVCMD 123

Query: 201 VALAHTLNQIVDVERTKLDQELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQ 260
           + LA    + VD E+ +L +  + +T G V ++   + L   +    G+ L D+  +T +
Sbjct: 124 MQLARAAIEAVDQEQKRLAKRTQEMTDGEVQAATQRDALIKHIVESYGVELPDMQRSTLE 183

Query: 261 RVLSSNKKLTPQAIQVFNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWS 320
           R ++ N  L     ++   R++AS ++  K   L++ ++ DGRLRGTLQF GASRTGRW+
Sbjct: 184 RRIA-NPDLPSAVKELLAIRLQASTTSTSKYKALMKGVSHDGRLRGTLQFCGASRTGRWA 242

Query: 321 GCVFPPQNLPRPSRSHEELDQIITHLPTSITSDPDPLQIISDCVRSCVIAS----EGKKL 376
           G +F PQNLPRPS   E++D+ I   P +       LQI S  V +    S       KL
Sbjct: 243 GRLFQPQNLPRPSLKQEQIDEGI-EAPNAAAKTLKCLQIASGAVYTDDAGSWSELHDTKL 301

Query: 377 VVADLAGIEARVLAWMAGEQWK------LKAFETGEDL 408
              D    EA     +    WK      LKAF  G  L
Sbjct: 302 QALDSILTEAAGAPVLVAYHWKHDLERLLKAFPRGRHL 339


>gi|323443494|gb|EGB01110.1| hypothetical protein SAO46_0719 [Staphylococcus aureus O46]
          Length = 330

 Score =  172 bits (436), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 118/329 (35%), Positives = 172/329 (52%), Gaps = 19/329 (5%)

Query: 6   IDFETRSPIDLTKCGICKY--AEDVCVILFAFGFDDHPVELWDCVHDPVMP-----QVLK 58
           ID E  S  D++KCG  KY  AED  +++ A+  D  PV   D       P     +  K
Sbjct: 3   IDIEIYSSNDISKCGAYKYTEAEDFEILIIAYSIDGGPVSAIDMTKVDNEPYHADYETFK 62

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKL 118
            AL +  V   A N+ FERT L   FN  +P   WICT+V +   GLP++L  VGE L+L
Sbjct: 63  IALFDPAVKKCAFNANFERTCLAKHFNKSMPPEEWICTMVNSMRIGLPASLDKVGEVLRL 122

Query: 119 SSQKMEEGKELIARF---CKGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTREIFKR 174
            +QK + GK LI  F   CK         RN P H  E W+ F +YC  DV V   I  +
Sbjct: 123 QNQKDKAGKNLIRYFSMPCKPTKVNGGRTRNLPEHDPEKWQQFIDYCIRDVEVEMAIANK 182

Query: 175 LE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSS 232
           ++  P+++ EQ+ W  DQ INDRG  +  +L    N +    + +L ++ + +T   + +
Sbjct: 183 IKDFPVTTIEQKYWVFDQHINDRGIKLSKSLMLGANVLDKQSKGELLKQAKQITD--LEN 240

Query: 233 SRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLN 292
                +L TWL  E GL + +L + T Q  L   K+ T +A ++   R++ S+++V K N
Sbjct: 241 PNSPTQLLTWLNKEQGLDIPNLQKKTVQDYL---KEATGKAKKMLEIRLQMSKTSVKKYN 297

Query: 293 TLVEAMNSDGRLRGTLQFLGASRTGRWSG 321
            + + M SD R+RG  QF GA  TGRW+G
Sbjct: 298 KMHDMMCSDERVRGLFQFYGAG-TGRWAG 325


>gi|269976595|ref|ZP_06183580.1| DNA polymerase [Mobiluncus mulieris 28-1]
 gi|269935396|gb|EEZ91945.1| DNA polymerase [Mobiluncus mulieris 28-1]
          Length = 352

 Score =  172 bits (435), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 123/376 (32%), Positives = 177/376 (47%), Gaps = 68/376 (18%)

Query: 280 RMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPR---PSRSH 336
           R   SRS+V K   +++   +D R  G LQF GA+RTGRW+G +   QNLPR   P  + 
Sbjct: 24  RQELSRSSVAKYRKMIDVTCTDQRAHGLLQFYGANRTGRWAGRLVQVQNLPRNYLPDLAQ 83

Query: 337 EE---LDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMA 393
                 D     L    +S PD L   S  +R+  I S+G + +VAD + IEARVLAW+A
Sbjct: 84  ARSLVRDGNGETLEMLYSSVPDTL---SQLIRTAFIPSKGHRFIVADYSAIEARVLAWLA 140

Query: 394 GEQWKLKAFETGEDLYVTTYARSFNVAPAQ---VTKDQRAIGKVMELALGYQGGAKAFQK 450
           GE+  L AF+ GEDLY  T +  F V P +   V  + R  GK+  LA GY G   A + 
Sbjct: 141 GEETTLAAFKNGEDLYCATASAMFGV-PVEKHGVNSELRQKGKIAVLACGYNGSVGALKA 199

Query: 451 MASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAW 510
           M +            +K   + +E                             + +  AW
Sbjct: 200 MGA------------LKMGLSEDE----------------------------LQPIVDAW 219

Query: 511 RQKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVY 570
           R  +  + +LW+++  A  + I  G+ +          +  +K    L + LPSGR L Y
Sbjct: 220 RAANPNIVQLWHDVDNAATRAISTGRPVTLGN------LGFEKKSGMLFINLPSGRRLAY 273

Query: 571 --RDVGNNRSYLNTTT-------RQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAG 621
               +G NR    + T       R+  +  TYGGKL ENIVQA +RD+L E +     AG
Sbjct: 274 VKPGIGMNRFGGTSITYWGQGVARKWQKLETYGGKLVENIVQATARDLLVEAITRIENAG 333

Query: 622 YDIVLTVHDEIVCETP 637
           + IV+ +HDE+V + P
Sbjct: 334 HRIVMHIHDEVVIDEP 349


>gi|15838881|ref|NP_299569.1| hypothetical protein XF2290 [Xylella fastidiosa 9a5c]
 gi|9107454|gb|AAF85089.1|AE004041_1 phage-related protein [Xylella fastidiosa 9a5c]
          Length = 312

 Score =  171 bits (433), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 103/253 (40%), Positives = 139/253 (54%), Gaps = 5/253 (1%)

Query: 154 WRLFGEYCKGDVTVTREIFKRLEP--LSSKEQELWYLDQTINDRGYCVDVALAHTLNQIV 211
           W  F EY + DV   R++ KRL     +  E  LW+LDQTINDRG  +D  L       V
Sbjct: 3   WAQFVEYARRDVAAMRDVVKRLPSHNYAGAELALWFLDQTINDRGVLIDTDLVQAAIGAV 62

Query: 212 DVERTKLDQELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTP 271
           +  +  L Q  E+LT G V ++   + L   L    G+ L D+ + T  R +  +  L  
Sbjct: 63  ERAKQTLAQRTEALTGGAVQAATQRDALLQHLNTAHGVALPDMQQHTVARCVD-DPALPE 121

Query: 272 QAIQVFNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPR 331
              ++ + R +AS ++  K   L+   + DGRLRGTLQF GASRTGRW+G +F P NLPR
Sbjct: 122 TVRELLSIRRQASSTSTAKYQALLHCTSPDGRLRGTLQFNGASRTGRWAGRLFQPHNLPR 181

Query: 332 PSRSHEELDQIITHLPTSITS--DPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVL 389
           P+ S E +   I  +          D + + S  +RSC+IA   KKLVVADL+ IE RVL
Sbjct: 182 PTLSQEVIAVGIDAMKAGCVDLVFDDVMALTSSALRSCLIAPTHKKLVVADLSIIEGRVL 241

Query: 390 AWMAGEQWKLKAF 402
           AW+AGE  KL AF
Sbjct: 242 AWLAGETPKLHAF 254


>gi|38638673|ref|NP_944374.1| gp66 [Burkholderia phage Bcep1]
 gi|34486055|gb|AAQ73412.1| gp66 [Burkholderia phage Bcep1]
          Length = 655

 Score =  164 bits (416), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 192/715 (26%), Positives = 303/715 (42%), Gaps = 109/715 (15%)

Query: 4   LFIDFETRSPIDLTKCGICKYAEDVCVILFAFGF---DDHPVELWDCVHDPVMPQVLKEA 60
           LF+DFET S  DLT+ G+ +Y +D     + F F        +LW+ V  PV  Q++   
Sbjct: 6   LFLDFETSSHTDLTEHGLGRYLDDPSTRAYCFTFRLPGMSTADLWE-VGQPVPKQIIGHL 64

Query: 61  LENTDVTIVAHNSYFE----RTVLKACFNL-DIP---IHRWICTLVLARSNGLPSALKAV 112
                   VAHN+ F+     TVL+      D+P   I +  C+   AR NGLP +L   
Sbjct: 65  ---NGSPFVAHNAPFDFWIWNTVLRRQRGYHDLPELQIGQVRCSAARARYNGLPGSLAGA 121

Query: 113 GEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREIF 172
            EAL L  QK  EG + +             D    +H E +    +Y   D      ++
Sbjct: 122 CEALGLPVQKDTEGAKWMKEIAANP------DWTPADHPEHFTRTYKYALIDTDAMVGVW 175

Query: 173 KRLEPLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSS 232
           +   PL ++EQ  + +D  IN RG  VDV  A  +  +      +LD E+  LT G + +
Sbjct: 176 ENTVPLPAREQAYFEMDMRINARGIGVDVEAAQAMEDLKAFAEAQLDYEMAYLTDGGILA 235

Query: 233 SRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLN 292
              + K+K +     G  ++D    T +++ ++   L     Q+   R+ ASR+   K +
Sbjct: 236 VTEVAKIKEYA-ATLGEDMDDAGRETLKKI-AARDNLPDSLRQLIELRLDASRAP--KKS 291

Query: 293 TLVEAMNSDGRLRGTLQFLGA---SRTGRWSGCVFPPQNL----PRPSRSHEELDQIITH 345
             +   +  GRL+    + GA     T R +G     Q L    PRP +   + + I+  
Sbjct: 292 AAILRAHVGGRLQHHTIYHGALSGRSTARGAGGA---QTLNTARPRPGKKTADCEAILDA 348

Query: 346 L---PTSITSDPDP---LQIISDCVRSCVIASE-GKKLVVADLAGIEARVLAWMAGEQWK 398
                 +  S P+    L  ++D  R    A++ G  LV ADL+GIEAR+  W+A +  K
Sbjct: 349 CLRGDRAYLSSPEVGPILAALADAQRQLFRATKPGHVLVGADLSGIEARMAPWLANDVPK 408

Query: 399 LKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLN 458
           L+AFE G D Y       +++    VTKDQR +GKV +LALG+ GG  AF  MA+  G++
Sbjct: 409 LEAFEKGIDGYKLAAMDIYSIEYDAVTKDQRQVGKVADLALGFGGGDGAFASMAANYGVH 468

Query: 459 LNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVS 518
           L                              PE   E ++           WR       
Sbjct: 469 LP-----------------------------PEQVSEIVY----------NWRAGRPAFE 489

Query: 519 ELWNELHQAFEQTIEN-GKAIIARKRRDV-PLVYMKKDKNNLILMLPSGRSLVYRDV--- 573
             W+    +    ++  G+ ++    RD    +   +D   L + LPSGR++ Y +    
Sbjct: 490 RWWSLCEYSVLMALDQPGREVVMPVGRDFCSQITFVRDARALRMHLPSGRAISYHNARLH 549

Query: 574 ---GNN---------RSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAG 621
              G N           Y+ T  R++         L+ N  Q ++RD+    +++  +  
Sbjct: 550 LEPGANVPIAIYDKPEGYVETLDRKI---------LSNNQTQGLARDLFWSVLLDVDRV- 599

Query: 622 YDIVLTVHDEIVCET-PDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
            +IV  V+DE + E   +        L   M    +W  GLPL AEG+   R+RK
Sbjct: 600 EEIVHHVYDEALLEVLAELAALRQKQLVERMCRGEAWCPGLPLGAEGWHGLRWRK 654


>gi|23752370|ref|NP_705685.1| gp62 [Burkholderia phage Bcep781]
 gi|23507237|gb|AAN38060.1| gp62 [Burkholderia phage Bcep781]
          Length = 655

 Score =  157 bits (397), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 189/715 (26%), Positives = 297/715 (41%), Gaps = 109/715 (15%)

Query: 4   LFIDFETRSPIDLTKCGICKYAEDVCVILFAFGF---DDHPVELWDCVHDPVMPQVLKEA 60
           LF+DFE  S  DLT+ G+ +Y +D     + F F        +LW+ V  PV  Q++   
Sbjct: 6   LFLDFEASSKTDLTEAGLGRYLDDPTTRAYCFTFRLPGMSTADLWE-VGQPVPKQIVGHL 64

Query: 61  LENTDVTIVAHNSYFE----RTVLKACFNL-DIP---IHRWICTLVLARSNGLPSALKAV 112
                   VAHN+ F+      VL+      D+P   I +  C+   AR NGLP +L   
Sbjct: 65  ---NGSPFVAHNAPFDFWIWNLVLRRQHGYHDLPEIQIGQVRCSAARARYNGLPGSLAGA 121

Query: 113 GEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGDVTVTREIF 172
            EAL L  QK  EG + +             D    +H E +    +Y   D      ++
Sbjct: 122 CEALGLPVQKDTEGAKWMKEIAANP------DWTPADHPEHFARTYKYALIDTDAMVGVW 175

Query: 173 KRLEPLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSS 232
           +   PL  + Q  + +D  IN RG   DV  A  +  +      +LD E+  LT G + +
Sbjct: 176 ENTVPLPPRMQAEFEMDMRINHRGIGTDVEAAQAMEDLKAFAEAQLDYEMAYLTDGGILA 235

Query: 233 SRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLN 292
              + K+K +     G  ++D    T +++ ++   L     Q+   R+ ASR+   K +
Sbjct: 236 VTEVAKIKEYA-ATLGEDMDDAGRETLKKI-AARDNLPDSLRQLIELRLDASRAP--KKS 291

Query: 293 TLVEAMNSDGRLRGTLQFLGA---SRTGRWSGCVFPPQNL----PRPSRSHEELDQIITH 345
             +   +  GRL+    + GA     T R +G     Q L    PRP +   + + I+  
Sbjct: 292 AAILRAHVGGRLQHHTIYHGALSGRSTARGAGGA---QTLNTARPRPGKKTADCEAILDA 348

Query: 346 L---PTSITSDPDP---LQIISDCVRSCVIASE-GKKLVVADLAGIEARVLAWMAGEQWK 398
                 +  S P+    L  ++D  R    A++ G  LV ADL+GIEARV  W+A +  K
Sbjct: 349 CLRGDRAYLSSPEVGPILAALADAQRQLFRATKPGHVLVGADLSGIEARVAPWLANDVPK 408

Query: 399 LKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLN 458
           L+AFE G D Y       +++    VTKDQR +GK  +LALG+ GG  AF  MA+  G++
Sbjct: 409 LEAFEKGIDGYKLAAMDIYSIEYDAVTKDQRQVGKAADLALGFGGGDGAFASMAANYGVH 468

Query: 459 LNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVS 518
           L                              PE   E ++           WR       
Sbjct: 469 LP-----------------------------PEQVSEIVY----------NWRAGRPAFE 489

Query: 519 ELWNELHQAFEQTIEN-GKAIIAR-KRRDVPLVYMKKDKNNLILMLPSGRSLVYRDV--- 573
             W+    +    ++  G+ I+    R +   +   KD   L + LPSGR++ Y +    
Sbjct: 490 RWWSLCEYSVLMALDQPGREIVMPVGRNNCSQITFVKDARALRMHLPSGRAISYHNARLH 549

Query: 574 ---GNN---------RSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAG 621
              G N           Y+ T  R++         L+ N  Q ++RD+    +++  +  
Sbjct: 550 LEPGANVPIAIYDKPEGYVETLDRKI---------LSNNQTQGLARDLFWSVLLDVDRV- 599

Query: 622 YDIVLTVHDEIVCET-PDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
            +IV  V+DE + E   +        L   M    +W  GLPL AEG+   R+RK
Sbjct: 600 EEIVHHVYDEALLEVLAELAALREKQLVERMCRGEAWCPGLPLGAEGWHGLRWRK 654


>gi|331028082|ref|YP_004421796.1| DNA polymerase A domain protein [Roseobacter phage RDJL Phi 1]
 gi|301341545|gb|ADK73429.1| DNA polymerase A domain protein [Roseobacter phage RDJL Phi 1]
          Length = 838

 Score =  154 bits (390), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 146/538 (27%), Positives = 234/538 (43%), Gaps = 73/538 (13%)

Query: 6   IDFETRSPIDLTKCGICKYAEDVCVILFAFGF---DDHPVELWDCVHDPVMPQVLKEALE 62
           IDFETRSP D+ K G   Y+ D         +    +  V+LW   H       + E+  
Sbjct: 41  IDFETRSPTDIKKRGGFLYSLDPATEAMCLAYHLPGETEVKLWHMAHPEFF---IGESPA 97

Query: 63  NTDV--------TIVAHNSYFERTVLKACFNLDIPIH--------RWICTLVLARSNGLP 106
            TD+         + AHN++FER +     N+ IP +        +W C+   A +  LP
Sbjct: 98  PTDLFAFILAGGLVEAHNAFFERCIWT---NIMIPRYGWPVIKPDQWRCSAAKASAMSLP 154

Query: 107 SALKAVGEALKLSSQKMEEGKELIARFCK------GETHECLYDRNKPNHREAWRLFG-- 158
            +L+    A+ L   K  EG++L+ + CK       E  + ++D        A++  G  
Sbjct: 155 RSLEEAVAAMDLGIDKDMEGRKLMLKMCKPRKLRKAEMEKWMHDTGHKGRTPAYKSAGYP 214

Query: 159 --------------EYCKGDVTVTREIFKRLEPLSSKEQELWYLDQTINDRGYCVDVALA 204
                         +YCK DV     +   L  LS +E E W +DQ +N RG   D+ +A
Sbjct: 215 IVYHETEEDLHRLWDYCKQDVFAEHALSLSLPELSEQELETWKMDQWLNWRGARFDLTMA 274

Query: 205 HTLNQIVDVERTKLDQELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLS 264
                +    R +L+  LE+LT G+ S+++    +K WL  E  L L D    T +  L 
Sbjct: 275 KQALSMASEWRKRLNSILEALT-GITSATK-RAAVKEWLVEEEDLDLPDTAADTLKHYLE 332

Query: 265 SNKKLTPQAIQVFNNRMRASRSAVLKLNTLVE-AMNSDGRLRGTLQFLGASRTGRWSGCV 323
            N++L+ +A +V       ++++  K N +++ A   D R R  + + GA  TGRW+G  
Sbjct: 333 -NEELSARARRVLEIVRDVNKTSTRKYNAMIDKAWEGDERARDLMMYHGAG-TGRWAGKG 390

Query: 324 FPPQNLPRPSRSHEELDQ-----IITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVV 378
               N P      ++ D+     +   L        D +  +S  +R  ++A EG++L+V
Sbjct: 391 IQVHNFPARDLVVKDFDEAAELILDGDLDWCHALYGDVMAFLSHALRGAILAEEGRELMV 450

Query: 379 ADLAGIEARVLAWMAGEQWKLKAFETGEDLY--VTTYARSFNVAPAQVTKDQ-------- 428
           AD A IEAR + W A +Q  L  F  G+D+Y  + T    F V   ++ KD         
Sbjct: 451 ADYAAIEARCVLWEADDQQGLGVFRRGDDIYCDMATGIYGFEVQ-KKIAKDWTHPDYTLH 509

Query: 429 ---RAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVKTNSAPEEWEDAENFCR 483
              R  GK   L LGY  G   F       G+  +  A +++    PE+ +  E + R
Sbjct: 510 SGCRQFGKQAILGLGYGMGYMTFLLTCRKYGITFSR-AEVLRI-MGPEKLDKTEEWVR 565



 Score = 99.0 bits (245), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 57/130 (43%), Positives = 74/130 (56%), Gaps = 17/130 (13%)

Query: 562 LPSGRSLVYRDV---------GNNRSYL-----NTTTRQLTREYTYGGKLTENIVQAVSR 607
           LPSGR + Y D          G  +  L     +  TR+  R  TYGGK+ ENI QAV+R
Sbjct: 710 LPSGRRMSYCDPQIKLTKTSWGETKPALRYMSVDGVTRKWVRTATYGGKIVENITQAVAR 769

Query: 608 DILAEGMMNATKAG--YDIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKA 665
           DI+AE M+N+ K G  YD +++VHDE+VCE  D D+ +      LM+  P WA G P+ A
Sbjct: 770 DIMAEAMLNSVKEGCPYDPIMSVHDELVCEV-DEDKGDLEEFETLMSDLPIWAAGCPIVA 828

Query: 666 EGYESKRYRK 675
           E    KRYRK
Sbjct: 829 EAERFKRYRK 838


>gi|15838882|ref|NP_299570.1| hypothetical protein XF2291 [Xylella fastidiosa 9a5c]
 gi|9107455|gb|AAF85090.1|AE004041_2 phage-related protein [Xylella fastidiosa 9a5c]
          Length = 252

 Score =  154 bits (390), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 108/259 (41%), Positives = 138/259 (53%), Gaps = 15/259 (5%)

Query: 424 VTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVKTNSAPEEWEDAENFCR 483
           +TK+QR IGKV ELALGY GG  AF   A+   ++L   A   +    P   ++A     
Sbjct: 1   MTKEQRQIGKVQELALGYGGGVGAFAAFAALYHIDLEAMA--AQAVFPPLLLQEATELLE 58

Query: 484 WMQENH-PEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELHQAFEQTIENGKAIIARK 542
           W + NH P   + D     AC+  K+AWR  H  ++  W  L  A    I + +      
Sbjct: 59  WTKANHRPTFDLSDR-AWLACDVFKRAWRNAHPAIAAFWQALQFAVTDAIHHPETT---- 113

Query: 543 RRDVPLVYMKKDKNNLILMLPSGRSLVYR----DVGNNRSYLNT--TTRQLTREYTYGGK 596
                 + ++  +  L L LPSGR L Y     D     SY+ T   TR+ TR  TYGGK
Sbjct: 114 -HTCCGITVQYRRAWLRLRLPSGRVLYYAAPRVDEHGALSYMGTHPITRKWTRLTTYGGK 172

Query: 597 LTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPS 656
           L ENI QAVSRD+LA  M     AGY IVLTVHDEI+ E  D   FNA+ L  LM + P 
Sbjct: 173 LVENITQAVSRDVLAACMPAIEAAGYSIVLTVHDEIITEADDHPCFNAAHLAALMATPPP 232

Query: 657 WAKGLPLKAEGYESKRYRK 675
           WA+GLPL AEG+++ RYRK
Sbjct: 233 WAEGLPLAAEGFDTYRYRK 251


>gi|254443055|ref|ZP_05056531.1| DNA polymerase I domain protein [Verrucomicrobiae bacterium DG1235]
 gi|198257363|gb|EDY81671.1| DNA polymerase I domain protein [Verrucomicrobiae bacterium DG1235]
          Length = 596

 Score =  154 bits (388), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 113/389 (29%), Positives = 159/389 (40%), Gaps = 90/389 (23%)

Query: 291 LNTLVEAMNSDGRLRGTLQFLGASRTGRWSG-CVFPPQNLPRPSRSHEELDQIITHLPTS 349
           L T+      DG L   L++ GA  TGRW+G      QN  R +                
Sbjct: 294 LETMQSRCRRDGSLPFGLKYFGAIATGRWAGDAGLNFQNFNREA---------------Y 338

Query: 350 ITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLY 409
              DP          R C++A  G KL++ADL+ IE RVLAW+AG++        G  +Y
Sbjct: 339 YGVDP----------RKCLVARPGHKLIIADLSQIEPRVLAWIAGDRELFDKIRNGLPIY 388

Query: 410 VTTYARSFNVAPAQVTKDQR---AIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLV 466
                 S N     + K+      + K   + LGY  G K FQ +A   GL ++      
Sbjct: 389 QAHAETSMNWKGGDLKKENSNLYLLAKCRVIGLGYGAGCKTFQSLARGYGLEMS------ 442

Query: 467 KTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELHQ 526
                                           IG A +R    +R+ + R+  LW  +  
Sbjct: 443 --------------------------------IGEA-KRTVDDFRKANPRIVSLWQAVED 469

Query: 527 AFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNNRSYLNTTTRQ 586
           +    I                       +   + LPS RS+ Y DV        TT R 
Sbjct: 470 SMRYHI----------------------GSTFFMYLPSLRSIRYFDVQEEEGLTATTERG 507

Query: 587 LTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETPDTDEFNASM 646
             R + YGGKLTEN+VQA +RD+ AEG++   KAG  I+ TVHDE++CE P+  +     
Sbjct: 508 GRRLHWYGGKLTENLVQATARDVFAEGLLRIHKAGIRILWTVHDEVICEVPENSDITVET 567

Query: 647 LYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           +  L+   P W  GLP+ AEG E+  Y K
Sbjct: 568 VTDLLAQTPDWIPGLPVAAEGIETSCYTK 596


>gi|325662096|ref|ZP_08150714.1| hypothetical protein HMPREF0490_01452 [Lachnospiraceae bacterium
           4_1_37FAA]
 gi|325471545|gb|EGC74765.1| hypothetical protein HMPREF0490_01452 [Lachnospiraceae bacterium
           4_1_37FAA]
          Length = 356

 Score =  151 bits (381), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 120/404 (29%), Positives = 180/404 (44%), Gaps = 72/404 (17%)

Query: 290 KLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSR----SHEELDQIITH 345
           K   +  A  +D R RG  QF GA+RTGRW+G +   QNLP+       +  EL +I  +
Sbjct: 6   KYQAMQNAACTDHRTRGMFQFYGANRTGRWAGRLIQLQNLPQNHMDDLDAARELVRIGDY 65

Query: 346 LPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETG 405
              S+  D  P   +S  +R+  IA  G K  VAD + IEARV+A +AGE W+   F+ G
Sbjct: 66  DSLSMLYDDIP-DTLSQLIRTAFIAKPGYKFYVADFSAIEARVIAHLAGESWRADVFKNG 124

Query: 406 EDLYVTTYARSFNVAPAQ--VTKDQRAIGKVMELALGYQGGAKAFQKMAST-TGLNLNTF 462
            D+Y  + ++ F+V   +  +    R  GK+ ELALGY G   A + M +   GL  +  
Sbjct: 125 GDIYCASASQMFHVTVEKHGINGHLRQKGKIAELALGYGGSVGALKAMGALEMGLTEDEL 184

Query: 463 AHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWN 522
             LV                                          AWRQ +  +  LW 
Sbjct: 185 QPLV-----------------------------------------DAWRQSNPNIVALWW 203

Query: 523 ELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRD--VGNNR--- 577
           +   A +  I   K   +     +   +       L++ LPSGR L Y    +G N+   
Sbjct: 204 DFDTAIKNAI---KMHCSTASHGIKFTWR---SGMLLITLPSGRKLTYVKPRIGENKFGG 257

Query: 578 ---SYLNT-TTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLT--VHDE 631
              +Y     T++  R   YG K  EN+VQA+SRD+L    MNA K      +   VHDE
Sbjct: 258 ESVTYEGIGATKKWERLEIYGPKFVENVVQAISRDLL----MNAMKTLSHCFICGHVHDE 313

Query: 632 IVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           ++ E   +++ +  +L   M   P W   + L+A+GY ++ Y+K
Sbjct: 314 LIIEC--SEKVSLEVLCQQMARTPDWMPDILLRADGYVTEFYKK 355


>gi|71902389|ref|ZP_00684353.1| phage-related DNA polymerase [Xylella fastidiosa Ann-1]
 gi|71727877|gb|EAO30114.1| phage-related DNA polymerase [Xylella fastidiosa Ann-1]
          Length = 300

 Score =  145 bits (365), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 92/233 (39%), Positives = 122/233 (52%), Gaps = 47/233 (20%)

Query: 251 LEDLTETTCQRVLSSNKKLTPQAI-QVFNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQ 309
           L D+ + T +R L  +  L P+ + ++ + R +AS ++  K   L+   + DGRLRGTLQ
Sbjct: 13  LPDMQQHTVERCL--DDPLLPETVRELLSIRRQASTTSTAKYQALLNCTSGDGRLRGTLQ 70

Query: 310 FLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTS---ITSDPDPLQIISDCVRS 366
           F GASRTGRW+G +F P NLPRP+ S   +   I  +      +  D D + + S  +RS
Sbjct: 71  FNGASRTGRWAGRLFQPHNLPRPTLSQPVIAVGIDAMKAGCVDVVFD-DVMALTSSALRS 129

Query: 367 CVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAF------------------------ 402
           C+IA   KKLVVADL+ IE RVLAW+AGE  KL+AF                        
Sbjct: 130 CLIAPTHKKLVVADLSNIEGRVLAWLAGETPKLQAFGDFDTCQGVDGTWHSGEAITHGAL 189

Query: 403 ----------------ETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELAL 439
                             G+D+Y   YA SF +AP  VTK QR IGKV ELAL
Sbjct: 190 RGAPITLQWNAEHEPIRKGDDIYKRAYAHSFGIAPQAVTKQQRQIGKVQELAL 242


>gi|62327352|ref|YP_224065.1| hypothetical protein BPKS7gp43 [Salmonella phage SS3e]
 gi|57472386|gb|AAW51248.1| hypothetical protein [Salmonella phage SS3e]
          Length = 306

 Score =  144 bits (362), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 98/285 (34%), Positives = 130/285 (45%), Gaps = 45/285 (15%)

Query: 436 ELALGYQGGAKAFQKMASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRW--MQE-NHPEH 492
           EL LGY+GG  AF   A   GL+L   A  +        W        W  +QE   P H
Sbjct: 22  ELGLGYEGGVGAFVTFAKNLGLDLIEMAKTMDGTFPDHIWAATARGYEWARIQEAKRPPH 81

Query: 493 AIE---------DLFIGTACERVKKAWRQKHSRVSELWNELHQAFEQTIEN------GKA 537
             E         D  +   C+ +K+ WR+ H      W +L       + N        A
Sbjct: 82  PGEKDDRPSYILDKKVWRTCDAIKRMWRESHPETVAFWRDLKDGILAAVRNPGREFWAGA 141

Query: 538 IIARKRRDVPLVYMKKDKNN---------LILMLPSGRSLVYRDVG-------NNRSYLN 581
            + R       ++   + ++         L + LPSGR L Y  +G       +    +N
Sbjct: 142 HLRRNGERAIRIWRTVEFDSSGRKVPGWWLCMELPSGRILSYPGIGVSVTKETDEDGRIN 201

Query: 582 TTTR-------QLTRE----YTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHD 630
           T  R       QLTR+    YT+GGK  ENIVQA+ RD+LA  M+N    GY IVL+VHD
Sbjct: 202 TNVRIKYQGENQLTRQWTTLYTHGGKACENIVQALCRDLLAYAMLNVEAGGYPIVLSVHD 261

Query: 631 EIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           E+VCETPDT ++  + L  LM + P WA G PL AEG E KRY K
Sbjct: 262 ELVCETPDTSDYTVAELEKLMCALPEWADGFPLVAEGAELKRYAK 306


>gi|284009391|emb|CBA76577.1| phage DNA polymerase [Arsenophonus nasoniae]
          Length = 223

 Score =  137 bits (345), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 80/207 (38%), Positives = 114/207 (55%), Gaps = 7/207 (3%)

Query: 4   LFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHDPVMPQVLKEALEN 63
           LF D ET S I +  CG  +YAE+  ++LFA+ ++  PV++WD   D  MP+ LK  L++
Sbjct: 10  LFCDLETYSDIPIN-CGTHRYAENAEILLFAYAYNHEPVKVWDVTQDKTMPKDLKAYLDD 68

Query: 64  TDVTIVAHN-SYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKLSSQK 122
            ++  V HN   F+  +LK   N+D+P+ R   TLV A ++GLP AL ++ +   ++S K
Sbjct: 69  PEILTVWHNGGMFDTVILKHALNIDLPLSRVHDTLVQALAHGLPGALGSLCDIFNVNSDK 128

Query: 123 M--EEGKELIARFCKGETHECLYDRNKP-NHREAWRLFGEYCKGDVTVTREIFKRLE--P 177
              +EGK LI  FCK         R     H E W  F  Y   D+   REI++ L    
Sbjct: 129 TKDKEGKALIQLFCKPRPKNSKIQRATALTHFEEWLRFKTYAGSDILAMREIYQHLPRWN 188

Query: 178 LSSKEQELWYLDQTINDRGYCVDVALA 204
           ++  E  LW LDQ IN RG C+DV LA
Sbjct: 189 MNFNETTLWQLDQRINLRGMCMDVELA 215


>gi|253317126|ref|ZP_04840339.1| phage encoded DNA polymerase I [Staphylococcus aureus subsp. aureus
           str. CF-Marseille]
          Length = 284

 Score =  134 bits (337), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 97/276 (35%), Positives = 137/276 (49%), Gaps = 15/276 (5%)

Query: 1   MATLFIDFETRSPIDLTKCGICKY--AEDVCVILFAFGFDDHPVELWDCVHDPVMP---- 54
           M  + ID ET S  D++KCG  KY  AED  +++ A+  D   +   D       P    
Sbjct: 1   MKFMNIDIETYSSNDISKCGAYKYTEAEDFEILIIAYSIDGGAISAIDMTKVDNEPFHAD 60

Query: 55  -QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVG 113
            +  K AL +  V   A N+ FERT L   FN  +P   WICT+V +   GLP++L  VG
Sbjct: 61  YETFKIALFDPAVKKYAFNANFERTCLAKHFNKQMPPEEWICTMVNSMRIGLPASLDKVG 120

Query: 114 EALKLSSQKMEEGKELIARF---CKGETHECLYDRNKPNHR-EAWRLFGEYCKGDVTVTR 169
           E L+L SQK + GK LI  F   CK         RN P H  E W+ F +YC  DV V  
Sbjct: 121 EVLRLQSQKDKAGKNLIRYFSIPCKPTKVNGGRTRNLPEHDLEKWQQFIDYCIRDVEVEM 180

Query: 170 EIFKRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTY 227
            I  +++  P+++ EQ  W  DQ INDRG  +  +L    N +    + +L ++ + +T 
Sbjct: 181 AIANKIKDFPVTAIEQTYWVFDQHINDRGIKLSKSLMLGANVLDKQSKEELLKQAKHIT- 239

Query: 228 GLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVL 263
           GL  +     +L  WL  E GL + +L + T Q  L
Sbjct: 240 GL-ENPNSPTQLLAWLKDEQGLDIPNLQKKTVQEYL 274


>gi|188496446|ref|ZP_03003716.1| DNA polymerase [Escherichia coli 53638]
 gi|188491645|gb|EDU66748.1| DNA polymerase [Escherichia coli 53638]
 gi|323173133|gb|EFZ58764.1| DNA polymerase 1 [Escherichia coli LT-68]
          Length = 231

 Score =  132 bits (331), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 86/240 (35%), Positives = 130/240 (54%), Gaps = 23/240 (9%)

Query: 447 AFQKMASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAI----EDLFIGTA 502
           AF   A    L+L+  A+    N   +   +A++   W  E+    +     E +FI  A
Sbjct: 3   AFITFALVYSLDLDELANAALPNIPRDVIREAKS---WYYESVKRKSTYGLSERVFI--A 57

Query: 503 CERVKKAWRQKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMK--KDKNNLIL 560
           C+ +K+ WR+ H    + W EL    E+T+   +  IA  ++ +   Y+K  +D   L +
Sbjct: 58  CDSLKRLWRRAHPATCDFWYEL----ERTV---RTAIATPQKTLYCGYLKIRRDGAWLRI 110

Query: 561 MLPSGRSLVYRDV---GNNRSYL--NTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMM 615
            LPSGR++ Y        N +Y+  N+ +R+  R  TYGGKL EN+ QA +RD+LA  M 
Sbjct: 111 QLPSGRAVCYPSPVIEKGNITYMGVNSYSRKWQRLKTYGGKLVENVTQAAARDVLAGNMP 170

Query: 616 NATKAGYDIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
               AGY IVLTVHDEI+ E PD+ +++A  +  L+ + P WA  +PL A G+ES RYRK
Sbjct: 171 LIEDAGYSIVLTVHDEIISEAPDSPDYSAEHVSQLLATVPDWATSIPLNAGGFESYRYRK 230


>gi|126015340|gb|ABN70701.1| DNA polymerase 1 [Salmonella phage SETP7]
 gi|126015342|gb|ABN70702.1| DNA polymerase 1 [Salmonella phage SETP11]
          Length = 267

 Score =  130 bits (326), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 81/223 (36%), Positives = 114/223 (51%), Gaps = 34/223 (15%)

Query: 486 QENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELHQAFEQTIEN-------GKAI 538
           +++ P + I D  +   C+ +K+ WR+ H +    W +L       + N       G  I
Sbjct: 46  KDDRPSY-ILDKKVWRTCDAIKRMWRESHPQTVAFWRDLKDGILAAVRNPGRDFWAGANI 104

Query: 539 IARKRRDVPLVYMKKDKNN--------LILMLPSGRSLVYRDVG-------NNRSYLNTT 583
            +   R + +    +  ++        L + LPSGR L Y  +G       +    +NT 
Sbjct: 105 RSNGERAIRIWRTTEIDSSGRNIPGWWLCMELPSGRILSYPGIGVSVTKETDEDGRVNTN 164

Query: 584 TR-------QLTRE----YTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEI 632
            R       QLTR+    YT+GGK  ENIVQA  RD+LA  M+NA   GY IVL+VHDE+
Sbjct: 165 VRIKYQGENQLTRQWTTLYTHGGKACENIVQAFCRDLLAYAMLNAEAGGYPIVLSVHDEL 224

Query: 633 VCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           VCETPDT ++  + L  LM + P WA+G PL AEG E KRY K
Sbjct: 225 VCETPDTPDYTVAELEKLMCALPEWAEGFPLVAEGAELKRYAK 267


>gi|28199079|ref|NP_779393.1| truncated phage-related DNA polymerase [Xylella fastidiosa
           Temecula1]
 gi|28057177|gb|AAO29042.1| truncated phage-related DNA polymerase [Xylella fastidiosa
           Temecula1]
          Length = 290

 Score =  129 bits (325), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 98/246 (39%), Positives = 127/246 (51%), Gaps = 19/246 (7%)

Query: 441 YQGGAKAFQKMASTTGLNLNTFAHLVKTNSA----PEEWEDAENFCRWMQENH-PEHAIE 495
           Y+ G    +    +TGL L +   ++ T +A    P   ++A    +W + NH P   + 
Sbjct: 52  YRSGDDRRRYARRSTGLTLPSA--VIDTPNACAASPMPIQEAVEALQWTKANHRPTFGLS 109

Query: 496 DLFIGTACERVKKAWRQKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDK 555
           D     AC+  K+AWR  H  ++  W  L  A    I  G    A     + + Y    +
Sbjct: 110 DR-AWLACDVFKRAWRNAHPAIAAFWQALQCAVTDAI--GHPETAHTCCGITVQY---SR 163

Query: 556 NNLILMLPSGRSLVYR----DVGNNRSYLNT--TTRQLTREYTYGGKLTENIVQAVSRDI 609
             L L LPSGR L Y     D     SY+ T   TR+ TR  TYGGKL ENI QAVSRD+
Sbjct: 164 AWLRLRLPSGRVLYYAAPRVDEHGALSYMGTHPVTRKWTRITTYGGKLVENITQAVSRDV 223

Query: 610 LAEGMMNATKAGYDIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYE 669
           LA  M     AGY IVLTVHDEI+ E  D   FNA+ L  LM + P WA+GLPL AEG++
Sbjct: 224 LAACMPAIETAGYAIVLTVHDEIITEADDNAAFNAAHLAALMATPPPWAQGLPLAAEGFQ 283

Query: 670 SKRYRK 675
           + RYRK
Sbjct: 284 THRYRK 289


>gi|71898989|ref|ZP_00681155.1| truncated phage-related DNA polymerase [Xylella fastidiosa Ann-1]
 gi|71731235|gb|EAO33300.1| truncated phage-related DNA polymerase [Xylella fastidiosa Ann-1]
          Length = 199

 Score =  127 bits (319), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 84/180 (46%), Positives = 100/180 (55%), Gaps = 11/180 (6%)

Query: 502 ACERVKKAWRQKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILM 561
           AC+  K+AWR  H  ++  W  L  A    I  G    A     + + Y    +  L L 
Sbjct: 24  ACDVFKRAWRNAHPAIAAFWQALQCAVTDAI--GHPETAHTCCGITVQY---SRAWLRLR 78

Query: 562 LPSGRSLVYR----DVGNNRSYLNT--TTRQLTREYTYGGKLTENIVQAVSRDILAEGMM 615
           LPSGR L Y     D     SY+ T   TR+ TR  TYGGKL ENI QAVSRD+LA  M 
Sbjct: 79  LPSGRVLYYAAPRVDEHGALSYMGTHPITRKWTRITTYGGKLVENITQAVSRDVLAACMP 138

Query: 616 NATKAGYDIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
               AGY IVLTVHDEI+ E  D   FNA+ L  LM + P WA+GLPL AEG+E+ RYRK
Sbjct: 139 AIEAAGYSIVLTVHDEIITEADDNAAFNAAHLAALMATPPPWAQGLPLAAEGFETHRYRK 198


>gi|37626195|gb|AAQ96570.1| putative DNA polymerase [Vibrio phage VP16C]
          Length = 686

 Score =  127 bits (318), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 173/681 (25%), Positives = 267/681 (39%), Gaps = 157/681 (23%)

Query: 95  CTLVLARSNGLPSALKAVGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAW 154
           C +  AR   LP +L    +AL+ +++K ++GK+LI + C+  +      + +P  R  W
Sbjct: 62  CDMAKARRFSLPGSLDTAAKALR-TAEKDKKGKQLIGKLCRPVSAT----KARPEPR--W 114

Query: 155 RLFG---------EYCKGDVTVTREIFKRLEPLSSKEQELWYLDQTINDRGYCVDVALAH 205
            L+           YC  DV     +   +  ++  E+E W  DQ IN RG  VDV    
Sbjct: 115 TLYTAPQDYADLYRYCDQDVKSEDHVSALVPDMTPAERETWLADQRINARGVLVDVESLD 174

Query: 206 TLNQIVDVERTKLDQELESLTYGLVSSSRCLEKLKTWLFLET------GLHLEDLTET-- 257
               IV     +   EL ++T G V S   + KL    FL T       L  E + ET  
Sbjct: 175 NALDIVGQTTRRFTMELAAITNGAVGSVSEVAKLTD--FLATVGCRMHNLKSETVAETLE 232

Query: 258 ------TCQRVL--------SSNKKLTPQAIQVFNN-RMRAS-----------RSAVLKL 291
                 T +R+L        ++ KKL     Q+ ++ R+R              +  ++L
Sbjct: 233 RDDLNPTARRILEIREALAGANVKKLFSLKAQISSDGRLRNQYNFFGAGTGRWSAGGVQL 292

Query: 292 NTLV------EAMNSDGRLRGT---LQFLGASRTGRWSGCVFPPQN---------LPRPS 333
             L       +  N  GR+ G    ++ +GA+      G      N              
Sbjct: 293 QNLTSKGPKSKTCNGCGRIVGKSCRVEVMGAAGLCPECGANDWTDNKDWTVDAVRWALKD 352

Query: 334 RSHEELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMA 393
             H  LD II           DP+ ++S C+R   IA+ GKK V  D + IEA VLA +A
Sbjct: 353 LKHRNLDLIIDIWG-------DPITLLSGCLRGLFIAAPGKKFVCCDFSAIEAVVLAALA 405

Query: 394 GEQWKLKAFETGEDLYVTTYAR----SFNVAPAQVTKDQ------RAIGKVMELALGYQG 443
             +W+++ F T   +Y  + ++     F    A   K++      +++GKV ELA GY G
Sbjct: 406 RCEWRIEVFRTHGKIYEMSASKISGVPFEEMMAYKEKNKHDHPLRKSLGKVAELASGYGG 465

Query: 444 GAKAFQKMASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTAC 503
              A+                  K   A E +ED             + A++   +G   
Sbjct: 466 WIGAW------------------KAFGAEEHFED-------------DDAMKKAILG--- 491

Query: 504 ERVKKAWRQKHSRVSELWNELHQAFEQTIE--------NGKAIIA----RKRRDVPLVYM 551
                 WR     + E W   ++    T +         G  I+A     K   V  +  
Sbjct: 492 ------WRDASPEIVEFWGGQYRRDPYTRKWVREYYGLEGAVIMAILNPGKCYAVGDITY 545

Query: 552 KKDKNNLILMLPSGRSLVYR-------DVGNNRSY------LNTTTRQ----LTREYTYG 594
               + L   LPSGR L Y        D      Y       NT +++      R  TYG
Sbjct: 546 AVFDDVLYCRLPSGRFLQYHQPKLIESDSWKGPEYQVTFMGYNTNSQKGPVGWVRMDTYG 605

Query: 595 GKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETPDTDEFNASMLYHLMTSN 654
           G+L EN+ QA + D+ A  M      GY +V+  HDE++ E P  D  +   +  LMT  
Sbjct: 606 GRLAENVTQAAAADVQAYAMKQCENNGYPVVMHTHDELIAEVP-GDFGSVEEMAALMTGR 664

Query: 655 PSWAKGLPLKAEGYESKRYRK 675
             W +  P++A G+E  RY+K
Sbjct: 665 EPWREWWPIRAAGWEDDRYQK 685


>gi|307580241|gb|ADN64210.1| truncated phage-related DNA polymerase [Xylella fastidiosa subsp.
           fastidiosa GB514]
          Length = 205

 Score =  125 bits (315), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 89/207 (42%), Positives = 111/207 (53%), Gaps = 13/207 (6%)

Query: 476 EDAENFCRWMQENH-PEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELHQAFEQTIEN 534
           ++A    +W + NH P   + D     AC+  K+AWR  H  ++  W  L  A    I  
Sbjct: 4   QEAVEALQWTKANHRPTFGLSDR-AWLACDVFKRAWRNAHPAIAAFWQALQCAVTDAI-- 60

Query: 535 GKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYR----DVGNNRSYLNT--TTRQLT 588
           G    A     + + Y    +  L L LPSGR L Y     D     SY+ T   TR+ T
Sbjct: 61  GHPETAHTCCGITVQY---SRAWLRLRLPSGRVLYYAAPRVDEHGALSYMGTHPVTRKWT 117

Query: 589 REYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETPDTDEFNASMLY 648
           R  TYGGKL ENI QAVSRD+LA  M     AGY IVLTVHDEI+ E  D   FNA+ L 
Sbjct: 118 RITTYGGKLVENITQAVSRDVLAACMPAIETAGYAIVLTVHDEIITEADDNAAFNAAHLA 177

Query: 649 HLMTSNPSWAKGLPLKAEGYESKRYRK 675
            LM + P WA+GLPL AEG+++ RYRK
Sbjct: 178 ALMATPPPWAQGLPLAAEGFQTHRYRK 204


>gi|37626129|gb|AAQ96505.1| putative DNA polymerase [Vibrio phage VP16T]
          Length = 714

 Score =  124 bits (312), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 123/426 (28%), Positives = 184/426 (43%), Gaps = 79/426 (18%)

Query: 95  CTLVLARSNGLPSALKAVGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAW 154
           C +  AR   LP +L A  +ALK +S K ++GK+LI + C+  +      + +P  R  W
Sbjct: 152 CDMAKARRFSLPGSLDAAAQALK-TSPKDKKGKQLINKLCRPVSAT----KARPLPR--W 204

Query: 155 RLFGE---------YCKGDVTVTREIFKRLEPLSSKEQELWYLDQTINDRGYCVDVALAH 205
            L+           YC  DV     +      ++  E+E W  DQ IN RG  VDV    
Sbjct: 205 TLYTAPQDYSDLYAYCDQDVKSEDHVSALTPDMTPSERETWLADQRINARGVQVDVESLD 264

Query: 206 TLNQIVDVERTKLDQELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSS 265
               IVD    +   EL ++T G V S   + K+  +L    G  + +LT  +    L  
Sbjct: 265 NALDIVDQTTRRFTMELAAITNGAVGSVSEVAKMTDFL-AGLGCRMHNLTADSVSEALER 323

Query: 266 NKKLTPQAIQVFNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFP 325
           +  L P A +V   R   + + V KL +L   ++SDGRLR    F GA  TGRWS     
Sbjct: 324 D-DLNPTARRVLEIREALAGANVKKLFSLKAQISSDGRLRNQYNFFGAG-TGRWSAGGVQ 381

Query: 326 PQNL----PR--------------------------PSRSHEE--------LDQI----- 342
            QNL    P+                          P     E        +D +     
Sbjct: 382 LQNLTSKGPKSKTCNGCGRIVGKACTIEVMGATGLCPECGGNEWTDNKDWTVDAVRWALK 441

Query: 343 -ITH----LPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQW 397
            +TH    L  +I  D  P+ ++S C+R   IA+ GKK V  D + IEA VLA +A  +W
Sbjct: 442 DLTHRNLDLIIAIWGD--PITLLSGCLRGLFIAAPGKKFVCCDFSAIEAVVLAALARCEW 499

Query: 398 KLKAFETGEDLYVTTYARSFNVAPAQVT--KDQ--------RAIGKVMELALGYQGGAKA 447
           +L+ F T   +Y  + ++   V   ++   K+Q        +++GKV ELA GY G   A
Sbjct: 500 RLEVFRTHGKIYEMSASKISGVPFEEMMAYKEQNKHDHPLRKSLGKVAELASGYGGWLGA 559

Query: 448 FQKMAS 453
           ++   +
Sbjct: 560 WKAFGA 565


>gi|325662094|ref|ZP_08150713.1| hypothetical protein HMPREF0490_01451 [Lachnospiraceae bacterium
           4_1_37FAA]
 gi|325471757|gb|EGC74976.1| hypothetical protein HMPREF0490_01451 [Lachnospiraceae bacterium
           4_1_37FAA]
          Length = 341

 Score =  122 bits (307), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 99/316 (31%), Positives = 152/316 (48%), Gaps = 34/316 (10%)

Query: 6   IDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLKEALEN 63
           ID ET S +D+ K G+ KYAE  +  ++LFA   D   V ++D     V+P  + +A+ +
Sbjct: 9   IDLETYSDVDIKKSGVYKYAESENFEILLFAVSIDGGDVIVYDLACGDVLPDEILDAIVS 68

Query: 64  TDVTIVAHNSYFERTVLKACFNLDIPIH------------------RWICTLVLARSNGL 105
            DV   A N+ FER  L      + P                     W CT++ +   GL
Sbjct: 69  DDVIKWAFNASFERICLSYWMKRNYPDRFCSYSIPEDTVGNYLDPASWRCTMIWSAYMGL 128

Query: 106 PSALKAVGEALKLSSQKMEEGKELIARF---CKGETHECLYDRNKPNHR-EAWRLFGEYC 161
           P +L+ VG  L L  QKM+EGK+LI  F   CK         RN P H  E W +F  Y 
Sbjct: 129 PLSLEGVGAVLGLKDQKMKEGKDLIRYFCVPCKPTKSNGGRTRNFPMHAPEKWTVFKSYN 188

Query: 162 KGDVTVTREIFKRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLD 219
           K DV V   I ++L   P+     E + LDQ INDRG  VD+ +    N I   ER+K  
Sbjct: 189 KRDVEVEIGIKEKLHKFPVPDFVWEEYLLDQEINDRGILVDLQMVE--NAIAFDERSKAT 246

Query: 220 QELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAI-QVFN 278
              E L    + +   + ++K+WL  + G+ +E L     ++V++   K  P+ + QV +
Sbjct: 247 ITDEMLGLTDIDNPNSVSQMKSWLS-DQGIEVESLG----KKVVAEMIKDAPEDLAQVLS 301

Query: 279 NRMRASRSAVLKLNTL 294
            R + ++S+V ++  +
Sbjct: 302 LRQQLAKSSVNRVGEI 317


>gi|126015344|gb|ABN70703.1| DNA polymerase 4 [Salmonella phage SETP7]
 gi|126015346|gb|ABN70704.1| DNA polymerase 4 [Salmonella phage SETP11]
          Length = 237

 Score =  121 bits (303), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 78/236 (33%), Positives = 126/236 (53%), Gaps = 13/236 (5%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAEDVC--VILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M  L++D ET S  DL K G   YAE     +++  + FD+ PV++WD      MP+ L+
Sbjct: 1   MNLLYLDTETFSEADLKKVGSYAYAEHPTTEIVICTYAFDEGPVQVWDATDGSDMPRDLR 60

Query: 59  EAL-----ENTDVTIVAHNS-YFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAV 112
            A+      ++++ +V  N   F+R V+K C+  ++ +   I T+++A  + LP +L A+
Sbjct: 61  RAMLKLQKPDSNLKLVGQNFLMFDRPVIKHCWGFELLVENIIDTMIVAFRHALPGSLAAL 120

Query: 113 GEALKL--SSQKMEEGKELIARFCKGETHECLYDRNKPN-HREAWRLFGEYCKGDVTVTR 169
            E L +  S  K + GK LI RF K         R   + H + W  F  Y K D+T  R
Sbjct: 121 CEVLNIDASMAKDKRGKALIQRFSKPTPKNYKIRRYTADTHPKEWAEFIAYAKSDITSMR 180

Query: 170 EIFKRLEPLSSKEQE--LWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELE 223
           E++K++    + E E  + +LDQ INDRG+ VDVALA +  + V   + +L +E +
Sbjct: 181 EVYKKMPKWGNSEFEDRVLHLDQVINDRGFKVDVALAESAIEAVTRHKEELQEEAQ 236


>gi|126015348|gb|ABN70705.1| DNA polymerase 4 [Salmonella phage SETP13]
          Length = 237

 Score =  120 bits (301), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 78/236 (33%), Positives = 125/236 (52%), Gaps = 13/236 (5%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAEDVC--VILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M  L++D ET S  DL K G   YAE     +++  + FD+ PV++WD      MP+ L+
Sbjct: 1   MNLLYLDTETFSEADLKKVGSYAYAEHPTTEIVICTYAFDEGPVQVWDATDGSDMPRDLR 60

Query: 59  EAL-----ENTDVTIVAHNS-YFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAV 112
            A+      ++++ +V  N   F+R V+K C+  ++ +   I T+++A  + LP +L A+
Sbjct: 61  RAMLKLQKPDSNLKLVGQNFLMFDRPVIKHCWGFELLVENIIDTMIVAFRHALPGSLAAL 120

Query: 113 GEALKL--SSQKMEEGKELIARFCKGETHECLYDRNKPN-HREAWRLFGEYCKGDVTVTR 169
            E L +  S  K + GK LI RF K         R   + H + W  F  Y K D+T  R
Sbjct: 121 CEVLNIDASMAKDKRGKALIQRFSKPTPKNYKIRRYTADTHPKEWAEFIAYAKSDITSMR 180

Query: 170 EIFKRLEPLSSKEQE--LWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELE 223
           E++K++    + E E  + +LDQ INDRG+ VDVALA    + V   + +L +E +
Sbjct: 181 EVYKKMPKWGNSEFEDRVLHLDQVINDRGFKVDVALAEAAIEAVTRHKEELQEEAQ 236


>gi|331090255|ref|ZP_08339142.1| hypothetical protein HMPREF1025_02725 [Lachnospiraceae bacterium
           3_1_46FAA]
 gi|330401874|gb|EGG81449.1| hypothetical protein HMPREF1025_02725 [Lachnospiraceae bacterium
           3_1_46FAA]
          Length = 225

 Score =  119 bits (299), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 88/271 (32%), Positives = 119/271 (43%), Gaps = 60/271 (22%)

Query: 417 FNVAPAQVTKDQ--RAIGKVMELALGYQGGAKAFQKMAS-TTGLNLNTFAHLVKTNSAPE 473
           F V   ++TK    R  GK+ ELALGY G   A   M +   GL+ +    LV T     
Sbjct: 2   FGVPIEEITKGSPLRQKGKIAELALGYGGAVGALTSMGALAMGLSEDELPGLVST----- 56

Query: 474 EWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELHQAFEQTIE 533
                                               WR  +  +++ W ++ +A      
Sbjct: 57  ------------------------------------WRNANPHITQFWWDVDEAAV---- 76

Query: 534 NGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRD--VGNNRSYLNTTT------- 584
             +A+  RK   V L+  +     L  MLPSGR L Y    +G N+   +  T       
Sbjct: 77  --RAVRERKETQVGLIRFQYASGILFAMLPSGRKLAYVKPRMGVNKYGRDGLTYEGVGEN 134

Query: 585 RQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETPDTDEFNA 644
           ++  R  TYG KL ENIVQ  SRDILAE MM   KAG+ IV  VHDE V E P+    + 
Sbjct: 135 KKWERMDTYGPKLVENIVQGTSRDILAEAMMRLNKAGFSIVFHVHDEAVLEVPEGKS-SV 193

Query: 645 SMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
             +  +M   PSW  GLPL+A+GYE + Y+K
Sbjct: 194 EEVCRIMAEPPSWVHGLPLRADGYECQFYKK 224


>gi|284006861|emb|CBA72127.1| phage DNA polymerase [Arsenophonus nasoniae]
          Length = 181

 Score =  111 bits (278), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 64/176 (36%), Positives = 94/176 (53%), Gaps = 5/176 (2%)

Query: 4   LFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHDPVMPQVLKEALEN 63
           LF D ET S I +  CG  +YAE+  ++LFA+ ++  PV++WD   D  MP  LK  L++
Sbjct: 5   LFCDLETYSDIPIN-CGTHRYAENAEILLFAYSYNHGPVKVWDVTQDKTMPTDLKAYLDD 63

Query: 64  TDVTIVAHN-SYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKLSSQK 122
            ++  V HN   F+  +L    N+D+P+ R   TLV A ++GLP AL ++ +   ++S K
Sbjct: 64  PEILTVWHNGGMFDTVILSKVLNIDLPLSRVHDTLVQALAHGLPGALGSLCDIFNVNSDK 123

Query: 123 M--EEGKELIARFCKGETHECLYDRNKP-NHREAWRLFGEYCKGDVTVTREIFKRL 175
              +EGK LI  FCK         R     H E W  F  Y   D+   REI++ L
Sbjct: 124 AKDKEGKALIQLFCKPRPKNSKIQRATALTHFEEWLRFKTYAGSDILAMREIYQHL 179


>gi|307579401|gb|ADN63370.1| DNA-directed DNA polymerase [Xylella fastidiosa subsp. fastidiosa
           GB514]
          Length = 132

 Score =  111 bits (277), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 71/131 (54%), Positives = 82/131 (62%), Gaps = 6/131 (4%)

Query: 551 MKKDKNNLILMLPSGRSLVYR----DVGNNRSYLNT--TTRQLTREYTYGGKLTENIVQA 604
           M+  +  L L LPSGR L Y     D     SY+ T   TR+ TR  TYGGKL ENI QA
Sbjct: 1   MQYSRAWLRLRLPSGRVLYYAAPRVDEHGALSYMGTHPVTRKWTRITTYGGKLVENITQA 60

Query: 605 VSRDILAEGMMNATKAGYDIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLK 664
           VSRD+LA  M     AGY IVLTVHDEI+ E  D   FNA+ L  LM + P WA+GLPL 
Sbjct: 61  VSRDVLAACMPAIEAAGYAIVLTVHDEIITEADDNAAFNAAHLAALMATPPPWAQGLPLA 120

Query: 665 AEGYESKRYRK 675
           AEG+E+ RYRK
Sbjct: 121 AEGFETHRYRK 131


>gi|71897667|ref|ZP_00679912.1| phage-related DNA polymerase [Xylella fastidiosa Ann-1]
 gi|71732570|gb|EAO34623.1| phage-related DNA polymerase [Xylella fastidiosa Ann-1]
          Length = 169

 Score =  110 bits (276), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 69/124 (55%), Positives = 79/124 (63%), Gaps = 6/124 (4%)

Query: 558 LILMLPSGRSLVYR----DVGNNRSYLNT--TTRQLTREYTYGGKLTENIVQAVSRDILA 611
           L L LPSGR L Y     D     SY+ T   TR+ TR  TYGGKL ENI QAVSRD+LA
Sbjct: 45  LRLRLPSGRVLYYAAPRVDEHGALSYMGTHPITRKWTRITTYGGKLVENITQAVSRDVLA 104

Query: 612 EGMMNATKAGYDIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESK 671
             M     AGY IVLTVHDEI+ E  D   FNA+ L  LM + P WA+GLPL AEG+++ 
Sbjct: 105 ACMPAIEAAGYSIVLTVHDEIITEADDNAAFNAAHLAALMATPPPWAQGLPLAAEGFQTH 164

Query: 672 RYRK 675
           RYRK
Sbjct: 165 RYRK 168


>gi|28198296|ref|NP_778610.1| phage-related DNA polymerase [Xylella fastidiosa Temecula1]
 gi|182680933|ref|YP_001829093.1| DNA-directed DNA polymerase [Xylella fastidiosa M23]
 gi|28056366|gb|AAO28259.1| phage-related DNA polymerase [Xylella fastidiosa Temecula1]
 gi|182631043|gb|ACB91819.1| DNA-directed DNA polymerase [Xylella fastidiosa M23]
          Length = 154

 Score =  110 bits (275), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 70/124 (56%), Positives = 79/124 (63%), Gaps = 6/124 (4%)

Query: 558 LILMLPSGRSLVYR----DVGNNRSYLNT--TTRQLTREYTYGGKLTENIVQAVSRDILA 611
           L L LPSGR L Y     D     SY+ T   TR+ TR  TYGGKL ENI QAVSRD+LA
Sbjct: 30  LRLRLPSGRVLYYAAPRVDEHGALSYMGTHPVTRKWTRITTYGGKLVENITQAVSRDVLA 89

Query: 612 EGMMNATKAGYDIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESK 671
             M     AGY IVLTVHDEI+ E  D   FNA+ L  LM + P WA+GLPL AEG+E+ 
Sbjct: 90  ACMPAIEAAGYAIVLTVHDEIITEADDNAAFNAAHLAALMATPPPWAQGLPLAAEGFETH 149

Query: 672 RYRK 675
           RYRK
Sbjct: 150 RYRK 153


>gi|307700631|ref|ZP_07637659.1| conserved hypothetical protein [Mobiluncus mulieris FB024-16]
 gi|307614161|gb|EFN93402.1| conserved hypothetical protein [Mobiluncus mulieris FB024-16]
          Length = 240

 Score =  108 bits (269), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 82/286 (28%), Positives = 121/286 (42%), Gaps = 59/286 (20%)

Query: 402 FETGEDLYVTTYARSFNVAPAQ---VTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLN 458
           F+ GEDLY  T +  F V P +   V  + R  GK+  LA GY G   A + M +     
Sbjct: 1   FKNGEDLYCATASAMFGV-PVEKHGVNSELRQKGKIAVLACGYNGSVGALKAMGA----- 54

Query: 459 LNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVS 518
                  +K   + +E                             + +  AWR  +  + 
Sbjct: 55  -------LKMGLSKDE----------------------------LQPIVDAWRAANPNIV 79

Query: 519 ELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVY--RDVGNN 576
           +LW+++  A  + I  G  +  R       +  +K    L + LPSGR L Y    +G N
Sbjct: 80  QLWHDVDNAATRAISTGSPVTLRN------LGFEKKSGMLFINLPSGRRLAYVKPGIGMN 133

Query: 577 RSYLNTTT-------RQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVH 629
           R    + T       R+  +  TYGGKL ENIVQA +RD+L E +     AG  IV+ +H
Sbjct: 134 RFGGTSITYWGQGVARKWQKLETYGGKLVENIVQATARDLLVEDITRIENAGNRIVMHIH 193

Query: 630 DEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           DE+V + P       + +  L+   P    GLP+ A GYE   Y+K
Sbjct: 194 DEVVIDEPINSGITVADICALLNELPERTAGLPIDAAGYECGFYQK 239


>gi|71276173|ref|ZP_00652453.1| truncated phage-related DNA polymerase [Xylella fastidiosa Dixon]
 gi|71163091|gb|EAO12813.1| truncated phage-related DNA polymerase [Xylella fastidiosa Dixon]
          Length = 160

 Score =  108 bits (269), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 68/133 (51%), Positives = 83/133 (62%), Gaps = 6/133 (4%)

Query: 549 VYMKKDKNNLILMLPSGRSLVYR----DVGNNRSYLNT--TTRQLTREYTYGGKLTENIV 602
           + M+  +  L + LPSGR L Y     D     SY+ T   TR+ TR  TYGGKL ENI 
Sbjct: 27  ITMQYSRAWLRMHLPSGRVLYYAAPRVDEHGALSYMGTHPMTRKWTRITTYGGKLVENIT 86

Query: 603 QAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLP 662
           QAVSRD+LA  M     AGY IVLTVHDE++ E  D   FNA+ L  LM + P WA+GLP
Sbjct: 87  QAVSRDVLAACMPAIEAAGYAIVLTVHDEMITEADDNAAFNAAHLAALMATPPPWAQGLP 146

Query: 663 LKAEGYESKRYRK 675
           L AEG+++ RYRK
Sbjct: 147 LAAEGFQTHRYRK 159


>gi|323443495|gb|EGB01111.1| phage related DNA polymerase family A [Staphylococcus aureus O46]
          Length = 225

 Score = 99.8 bits (247), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 84/271 (30%), Positives = 115/271 (42%), Gaps = 60/271 (22%)

Query: 417 FNVAPAQVTKDQ--RAIGKVMELALGYQGGAKAFQKMAS-TTGLNLNTFAHLVKTNSAPE 473
           FNV    +TK    R  GKV ELALGYQGGA A + M +   G+  N    LV +     
Sbjct: 2   FNVPVESITKGDPLRQKGKVSELALGYQGGAGALKAMGALEMGIEENELQGLVDS----- 56

Query: 474 EWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELHQAFEQTIE 533
                                               WR  +  +   W    +A   T++
Sbjct: 57  ------------------------------------WRNANPNIVNFWKACQEAAINTVK 80

Query: 534 NGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVY--RDVGNNR------SYLNTT-T 584
           + K       R     YMKK    L++ LPSGR+L Y    VG N        ++     
Sbjct: 81  SRKTHHTHGLR----FYMKK--GFLMIELPSGRALAYPKASVGENSWGSQVVEFMGLDLN 134

Query: 585 RQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETPDTDEFNA 644
           R+ ++  TYGGKL ENIVQA +RD+LA  +     +G+ IV  VHDE++ E P       
Sbjct: 135 RKWSKLKTYGGKLVENIVQATARDLLAISIARLEASGFKIVGHVHDEVIVEIPRGSN-GL 193

Query: 645 SMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
             +  +M     WAKGL L ++G+ S  Y K
Sbjct: 194 KEIETIMNKPVDWAKGLNLNSDGFTSPFYMK 224


>gi|75906055|gb|ABA29401.1| DNA polymerase [Bacteriophage APSE-2]
          Length = 324

 Score = 92.0 bits (227), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 54/77 (70%)

Query: 599 ENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWA 658
           ENI QA +RD+LA  M    KAGY+IVLTVHDEI+ E PDT +F+A  L  L++ N  WA
Sbjct: 247 ENICQAAARDVLAYNMPPIEKAGYEIVLTVHDEIISEAPDTPQFSAEGLSKLLSFNSDWA 306

Query: 659 KGLPLKAEGYESKRYRK 675
             LPL A G+E+ RYRK
Sbjct: 307 WDLPLSANGFETYRYRK 323


>gi|313621758|gb|EFR92494.1| DNA polymerase [Listeria innocua FSL J1-023]
          Length = 155

 Score = 90.9 bits (224), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 50/125 (40%), Positives = 69/125 (55%), Gaps = 8/125 (6%)

Query: 558 LILMLPSGRSLVY-------RDVGNNRSYLNTTTRQLTREYTYGGKLTENIVQAVSRDIL 610
           L + LPSGR+L Y          G+   Y   T +   ++YTYGGKL ENIVQA++RD L
Sbjct: 31  LFIKLPSGRNLAYFRAKLVPGKYGHQICYEGVTDKGWRKQYTYGGKLVENIVQAIARDCL 90

Query: 611 AEGMMNATKAGYDIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYES 670
           A  +     AG   V+ VHDE + E P++ E +   L  ++    SWA GLPL+ +G+ S
Sbjct: 91  AVSLRRIEDAGISTVMHVHDEAITEVPES-ESSVDKLNAILAEPISWAPGLPLQGDGFSS 149

Query: 671 KRYRK 675
             Y K
Sbjct: 150 DFYMK 154


>gi|227540973|ref|ZP_03971022.1| conserved hypothetical protein [Corynebacterium glucuronolyticum
           ATCC 51866]
 gi|227183233|gb|EEI64205.1| conserved hypothetical protein [Corynebacterium glucuronolyticum
           ATCC 51866]
          Length = 100

 Score = 90.5 bits (223), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 44/91 (48%), Positives = 55/91 (60%)

Query: 585 RQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETPDTDEFNA 644
           R + R  +YGGKL ENIVQAV+RD+    M    + G+ IV+ VHDEIV + P    F  
Sbjct: 9   RLVVRLESYGGKLVENIVQAVARDLFVHAMTLVAQTGHKIVMHVHDEIVIDEPVGSGFTV 68

Query: 645 SMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           +    LM + P WA GLPL A+GYE   YRK
Sbjct: 69  ADACVLMATLPDWAAGLPLDADGYECDYYRK 99


>gi|167461235|ref|ZP_02326324.1| Phage-related DNA polymerase [Paenibacillus larvae subsp. larvae
           BRL-230010]
 gi|322383556|ref|ZP_08057314.1| hypothetical protein PL1_0952 [Paenibacillus larvae subsp. larvae
           B-3650]
 gi|321152024|gb|EFX44960.1| hypothetical protein PL1_0952 [Paenibacillus larvae subsp. larvae
           B-3650]
          Length = 222

 Score = 90.1 bits (222), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 81/270 (30%), Positives = 114/270 (42%), Gaps = 61/270 (22%)

Query: 417 FNVAPAQ--VTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVKTNSAPEE 474
           FNVA  +  V    R  GK+ ELALGY G   A + M +                     
Sbjct: 2   FNVAVEKHGVNGHLRQKGKIAELALGYGGSVGALKSMGAL-------------------- 41

Query: 475 WEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELHQAFEQTIEN 534
                           E  IE+       + +  AWRQ +S +++LW ++ +A +  +  
Sbjct: 42  ----------------EMGIEE----EELQPLVTAWRQSNSNITKLWWDVDRAVKVCV-- 79

Query: 535 GKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDV--------GNNRSYLNTT-TR 585
            K     +   +  +Y       L ++LPSGR L Y           G + +Y     T+
Sbjct: 80  -KQKTPTETHGIKFIY---QSGMLFIVLPSGRRLAYVKPRMGENVFGGESVTYEGVGGTK 135

Query: 586 QLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETPDTDEFNAS 645
           +  R  +YG K  ENIV A+SRDIL   M   T     IV  VHDEI+ E      F+A 
Sbjct: 136 KWERIESYGPKFVENIVHAISRDILYHAMQ--TLKNCSIVAHVHDEIIIEADMRMSFSA- 192

Query: 646 MLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
            +   M   PSWA GL L A+GYE + Y+K
Sbjct: 193 -ICEQMARTPSWANGLLLSADGYECQFYQK 221


>gi|260439053|ref|ZP_05792869.1| prophage LambdaSa04, DNA polymerase [Butyrivibrio crossotus DSM
           2876]
 gi|292808509|gb|EFF67714.1| prophage LambdaSa04, DNA polymerase [Butyrivibrio crossotus DSM
           2876]
          Length = 239

 Score = 89.4 bits (220), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 80/289 (27%), Positives = 121/289 (41%), Gaps = 63/289 (21%)

Query: 399 LKAFETGEDLYVTTYARSFNVAPAQ--VTKDQRAIGKVMELALGYQGGAKAFQKMAS-TT 455
           +K F+   D+Y  + +  F+V   +  V    R  GK+ ELALGY G   A   + +  T
Sbjct: 1   MKVFKENGDIYCASASAMFHVPVEKHGVNGHLRQKGKIAELALGYGGSVGALTAIGALDT 60

Query: 456 GLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHS 515
           GL+ +    LV +                                         WR  + 
Sbjct: 61  GLSEDELQPLVDS-----------------------------------------WRASNP 79

Query: 516 RVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVY--RDV 573
            + + W ++ +  +  I   K   A +   +  VY       L ++LPSGR L Y    +
Sbjct: 80  NIVQFWWDVDRCVKTAI---KQRTATETHGIRFVY---QNGILFIVLPSGRRLCYVKPKI 133

Query: 574 GNNR------SYLNT-TTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVL 626
           G N+      +Y    T ++  R  +YG K  ENIVQA+SRDIL   M   +     IV 
Sbjct: 134 GENKFGGESVTYEGVGTNKKWGRIESYGPKFVENIVQAISRDILCHSMRTLSHC--FIVG 191

Query: 627 TVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
            VHDE++ ETP   +  A  +   +   P W  GL L+A+GYE+  Y+K
Sbjct: 192 HVHDELIIETPMDADLTA--ICEQIGRTPKWIYGLLLRADGYETAFYKK 238


>gi|259502604|ref|ZP_05745506.1| prophage LambdaSa04 DNA-directed DNA polymerase [Lactobacillus
           antri DSM 16041]
 gi|259169419|gb|EEW53914.1| prophage LambdaSa04 DNA-directed DNA polymerase [Lactobacillus
           antri DSM 16041]
          Length = 169

 Score = 86.3 bits (212), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 55/166 (33%), Positives = 83/166 (50%), Gaps = 6/166 (3%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M  + ID ET S  +L + G+ +YA+  D  ++LF +  D  PV++ D      +P  + 
Sbjct: 1   MKQISIDIETYSSTNLNQTGVYRYADSDDFELLLFGYSTDFGPVKVVDLTQGEKIPPQII 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGEALKL 118
           EAL+N ++   A N+ FER  L       +    W C+ V + + GLP +L+ VG  L L
Sbjct: 61  EALDNPNIIKSAFNAQFERVCLSRFVGHRLKPTGWHCSRVWSATLGLPLSLRDVGSVLGL 120

Query: 119 SSQKMEEGKELIARF---CKGETHECLYDRNKPNHR-EAWRLFGEY 160
             QK+  GKEL+  F   CK         RN P H  + W+ F +Y
Sbjct: 121 PRQKITAGKELVRYFCTPCKPTKANQNRTRNFPYHAPDKWQQFKQY 166


>gi|331087492|ref|ZP_08336428.1| hypothetical protein HMPREF1025_00011 [Lachnospiraceae bacterium
           3_1_46FAA]
 gi|330410472|gb|EGG89903.1| hypothetical protein HMPREF1025_00011 [Lachnospiraceae bacterium
           3_1_46FAA]
          Length = 164

 Score = 83.2 bits (204), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 49/136 (36%), Positives = 73/136 (53%), Gaps = 6/136 (4%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           +  L ID ET S ++L K G+ +YAE  D  V+LF +  D   V++ D V    +P+ + 
Sbjct: 20  LLNLEIDIETFSSVNLAKAGVYRYAESPDFEVLLFGYSVDGGEVKVGDLVKGEKIPEEVM 79

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLDIPIH----RWICTLVLARSNGLPSALKAVGE 114
            ALE+  VT  A N+ FER  +      +   +     W C++V +   GLP +L+ VG 
Sbjct: 80  SALEDEAVTKWAFNAQFERICISRMLGYEAGTYLVPASWKCSMVWSAYMGLPLSLEGVGA 139

Query: 115 ALKLSSQKMEEGKELI 130
            L L  QK+ EGK+LI
Sbjct: 140 VLGLEKQKLTEGKDLI 155


>gi|227544274|ref|ZP_03974323.1| conserved hypothetical protein [Lactobacillus reuteri CF48-3A]
 gi|227185748|gb|EEI65819.1| conserved hypothetical protein [Lactobacillus reuteri CF48-3A]
          Length = 93

 Score = 82.0 bits (201), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 44/95 (46%), Positives = 55/95 (57%), Gaps = 6/95 (6%)

Query: 583 TTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETPDTDEF 642
           T ++  R  TYG KL ENIVQA SRD+LAE M      G  +V+ +HDE V + P    F
Sbjct: 2   TVKKWDRIETYGAKLVENIVQATSRDLLAEAMRRLEATGNTVVMHIHDEAVIDAP----F 57

Query: 643 NASM--LYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           N S+  +  LMT  P WA GL L A G+ S  Y+K
Sbjct: 58  NRSLDTMVQLMTKVPDWANGLILNAAGFVSDFYKK 92


>gi|300775482|ref|ZP_07085343.1| DNA-directed DNA polymerase I [Chryseobacterium gleum ATCC 35910]
 gi|300505509|gb|EFK36646.1| DNA-directed DNA polymerase I [Chryseobacterium gleum ATCC 35910]
          Length = 944

 Score = 77.4 bits (189), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 93/414 (22%), Positives = 174/414 (42%), Gaps = 46/414 (11%)

Query: 55  QVLKEALENTDVTIVAHNSYFERTVLKACFNLDIPIHRWICTLVLARSNGLPSALKAVGE 114
           ++ +   E  D+  VAHN  F+  VLK     DI +   +   ++A     P        
Sbjct: 419 EIFRPFFEKEDLLKVAHNLKFDYKVLK---QYDITVKGAMFDTMIAHYLLNPDG------ 469

Query: 115 ALKLSSQKMEEGKELIARFCKGETHECLYDRNKP--NHREA-WRLFGEYCKGDVTVTREI 171
                   M+   E+   +        +  + K   N R+A  R   +Y   D  VT ++
Sbjct: 470 -----RHGMDYLSEVYLNYKPVSIETIIGKKGKKQGNFRDADLRTQTDYAAEDADVTFQL 524

Query: 172 FKRLEPLSSKE--QELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGL 229
           ++   P   KE  +EL+Y           +++ L   L ++ ++    LD++   L    
Sbjct: 525 YELFAPQLKKENLEELFY----------NIEMPLMEVLAKM-ELSGISLDEKW--LAQES 571

Query: 230 VSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVL 289
           V     L+ L+  +F  +G      +      +L    +L P+A +    +   S   + 
Sbjct: 572 VDLENDLKGLEAKIFELSGEEFNMNSPRQLGEILFEKMQLDPKAKKTKTGQYATSEDVLQ 631

Query: 290 KLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTS 349
           KL++  E       ++  L++    +         P Q     +R H    Q        
Sbjct: 632 KLSSKHEI------IKHILEYRTYQKLKSTYVDALPSQIDKDDNRVHTNFSQTTAATGRL 685

Query: 350 ITSDPD----PLQII-SDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFET 404
            + +P+    P++ +    +R   ++ EGKK++ AD + IE R++A ++GE+  +KAF+ 
Sbjct: 686 ASVNPNLQNIPIRTLRGQQIRGAFVSGEGKKIISADYSQIELRLIAEISGEENMIKAFQD 745

Query: 405 GEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLN 458
           GED++ +T A+ F +  A+V+K QR+  K +   + Y  GA A   +A  TGL+
Sbjct: 746 GEDIHASTAAKLFKIPLAEVSKTQRSQAKTVNFGIIYGQGAFA---LAEQTGLS 796


>gi|313905679|ref|ZP_07839040.1| conserved hypothetical protein [Eubacterium cellulosolvens 6]
 gi|313469503|gb|EFR64844.1| conserved hypothetical protein [Eubacterium cellulosolvens 6]
          Length = 180

 Score = 77.0 bits (188), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 58/177 (32%), Positives = 88/177 (49%), Gaps = 21/177 (11%)

Query: 509 AWRQKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSL 568
           +WR  +  ++  W ++ +A + TI      I  + R +   Y       L + LPSGR L
Sbjct: 14  SWRNSNPMITAFWWDIDRAVKTTITQR---IQTEVRGICFFY---KSGMLFIKLPSGRLL 67

Query: 569 VYRD--VGNNR------SYLNT-TTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATK 619
            Y    +G N+      +Y    +T++  R  +YG K  ENIVQAVSRDIL   M     
Sbjct: 68  SYVKPRIGENQYGGESVTYEGVGSTKKWERIESYGPKFVENIVQAVSRDILCYAMKTLRH 127

Query: 620 AGYDIVLTVHDEIVCE-TPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
               IV  VHDE++ E +PD D    +++   M  +P W   + L+A+GYE+  Y+K
Sbjct: 128 CF--IVGHVHDELIIECSPDVD---TNVICKQMGRSPDWMPDILLRADGYETNFYKK 179


>gi|303248854|ref|ZP_07335103.1| DNA polymerase I [Desulfovibrio fructosovorans JJ]
 gi|302489723|gb|EFL49656.1| DNA polymerase I [Desulfovibrio fructosovorans JJ]
          Length = 874

 Score = 74.7 bits (182), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 76/270 (28%), Positives = 116/270 (42%), Gaps = 37/270 (13%)

Query: 196 GYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLT 255
           G  VD+         V  + T+L++EL +L  G   + R  ++L   LF E GL  +  T
Sbjct: 491 GIGVDLRSLAAFGAEVATDLTRLEKELHTLA-GHPFNPRSSQQLGEILFTEMGLTPKGKT 549

Query: 256 E----TTCQRVLSSNKKLTPQAIQVFNNR-MRASRSAVLKLNTLVEAMNSDGRLRGTLQF 310
                +T Q  L       P   ++   R +   RS  L  + L +  ++DGR+  TL  
Sbjct: 550 PGGAASTSQDALERLAGSNPLVDRILEFRKLEKLRSTYL--DPLPKLADADGRIHTTLNN 607

Query: 311 LGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITSDPDPLQIISDCVRSCVIA 370
           + A+ TGR S              S+  L  I    P            +   +R C +A
Sbjct: 608 M-ATATGRLSS-------------SNPNLQNIPIRGP------------LGRRMRECFVA 641

Query: 371 SEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRA 430
             GK LV AD + IE RVLA ++GE   L AF  G D++  T +  F+   A++  D+R 
Sbjct: 642 GPGKTLVAADYSQIELRVLAHLSGEPALLSAFAAGADIHARTASLLFDKPEAEIGPDERR 701

Query: 431 IGKVMELALGYQGGAKAFQKMASTTGLNLN 460
             K +   L Y  G    QK++   G+ L+
Sbjct: 702 QAKTINFGLLYGMGP---QKLSRDLGIKLD 728


>gi|295700821|ref|YP_003608714.1| DNA polymerase I [Burkholderia sp. CCGE1002]
 gi|295440034|gb|ADG19203.1| DNA polymerase I [Burkholderia sp. CCGE1002]
          Length = 913

 Score = 74.7 bits (182), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 48/134 (35%), Positives = 71/134 (52%), Gaps = 10/134 (7%)

Query: 330 PRPSRSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLVVADLAG 383
           PR  R H    Q +       ++DP+ LQ I         +R   IA  G KLV AD + 
Sbjct: 635 PRTGRVHTNYAQAVAVTGRLASNDPN-LQNIPVRTGEGRRIREAFIAPPGHKLVSADYSQ 693

Query: 384 IEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQG 443
           IE R++A ++G++  ++AF  GED++  T +  FNV P +V+ DQR + KV+   L Y  
Sbjct: 694 IELRIMAHISGDESLMRAFSQGEDIHRATASEIFNVTPLEVSSDQRRVAKVINFGLIY-- 751

Query: 444 GAKAFQKMASTTGL 457
           G  AF  +AS  G+
Sbjct: 752 GMSAF-GLASNLGI 764


>gi|227544665|ref|ZP_03974714.1| conserved hypothetical protein [Lactobacillus reuteri CF48-3A]
 gi|227185353|gb|EEI65424.1| conserved hypothetical protein [Lactobacillus reuteri CF48-3A]
          Length = 93

 Score = 74.3 bits (181), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 41/93 (44%), Positives = 53/93 (56%), Gaps = 2/93 (2%)

Query: 583 TTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGYDIVLTVHDEIVCETPDTDEF 642
           T ++  R  TYG KL ENIVQA SRD+LA  M     AG  +V+ +HDE V + P TD  
Sbjct: 2   TVKKWDRIETYGAKLVENIVQATSRDLLAGAMRRLETAGNPVVMHIHDEAVIDAP-TDR- 59

Query: 643 NASMLYHLMTSNPSWAKGLPLKAEGYESKRYRK 675
           +   +  +MT  P WA GL L A G+    Y+K
Sbjct: 60  SLDTIVKIMTEVPDWADGLILNAAGFVGGFYKK 92


>gi|313205711|ref|YP_004044888.1| DNA polymerase i [Riemerella anatipestifer DSM 15868]
 gi|312445027|gb|ADQ81382.1| DNA polymerase I [Riemerella anatipestifer DSM 15868]
 gi|315022894|gb|EFT35918.1| DNA polymerase I [Riemerella anatipestifer RA-YM]
 gi|325336847|gb|ADZ13121.1| DNA polymerase I - 3'-5' exonuclease and polymerase domains
           [Riemerella anatipestifer RA-GD]
          Length = 935

 Score = 74.3 bits (181), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 74/316 (23%), Positives = 141/316 (44%), Gaps = 27/316 (8%)

Query: 159 EYCKGDVTVTREIFKRLEPLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKL 218
           +Y   D  +T ++++   P   KE+        + +  Y +++ L   L ++ ++    L
Sbjct: 503 QYAAEDADITFQLYEIFSPQLKKEE--------VEEVFYKIEMPLVKVLAKM-ELTGVAL 553

Query: 219 DQELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFN 278
           D+E   L    +S  + L+ L+  +F + G      +      +L    KL P+A +   
Sbjct: 554 DEEW--LKDESISLEQDLKILEGQIFEQAGEEFNINSPKQLGDILFEKLKLDPKAKKTKT 611

Query: 279 NRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEE 338
            +   S   + KL+   E       ++  L++    +         P Q  P   R H  
Sbjct: 612 GQYSTSEDVLQKLSHKHEI------IKLILEYRQLQKLKSTYVDALPNQISPIDGRVHTS 665

Query: 339 LDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLVVADLAGIEARVLAWM 392
             Q +       +++P+ LQ I         VR   +A +G K+V AD + IE R++A +
Sbjct: 666 FAQTVAATGRLASNNPN-LQNIPIRTERGQQVRGAFVAPKGSKIVSADYSQIELRLIAEI 724

Query: 393 AGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMA 452
           +GE+  +KAF+ G+D++ +T ++ F+V   +V+K QR+  K +   + Y  G  AF  +A
Sbjct: 725 SGEETMIKAFKEGQDIHASTASKLFDVPLNEVSKTQRSQAKTVNFGIIY--GQSAF-ALA 781

Query: 453 STTGLNLNTFAHLVKT 468
             TGL+      L+ +
Sbjct: 782 DQTGLSRTDAKQLIDS 797


>gi|255534870|ref|YP_003095241.1| DNA polymerase I [Flavobacteriaceae bacterium 3519-10]
 gi|255341066|gb|ACU07179.1| DNA polymerase I [Flavobacteriaceae bacterium 3519-10]
          Length = 949

 Score = 73.2 bits (178), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 96/413 (23%), Positives = 173/413 (41%), Gaps = 44/413 (10%)

Query: 55  QVLKEALENTDVTIVAHNSYFERTVLKAC-FNLDIPIHRWICTLVLARSNGLPSALKAVG 113
           ++ +E  E  DV+ VAHN  F+  +L+   F+L   +   +    L   +G    +  + 
Sbjct: 424 EIFREFFEKEDVSKVAHNLKFDYKILQQYGFSLKGLLFDTMIAHYLLNPDG-KHVIDYLS 482

Query: 114 EA-LKLSSQKMEEGKELIARFCKGE-THECLYDRNKPNHREAWRLFGEYCKGDVTVTREI 171
           E  L      +E    LI +  K + T   L    + N          Y   D  +T ++
Sbjct: 483 EIYLNYKPVALES---LIGKKGKNQLTFRSLTVEEQTN----------YAAEDADITWQL 529

Query: 172 FKRLEPLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQE-LESLTYGLV 230
           ++   P   KE         + D  Y V++ L   L ++ ++E   LD++ L   +  L 
Sbjct: 530 YEVFAPQLKKE--------NLEDLFYKVEMPLLRVLAKM-ELEGVALDEKWLAQESIDLE 580

Query: 231 SSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLK 290
           +  R LE     +F    +     +      +L    KL P+A +    +   S   + K
Sbjct: 581 NDLRGLE---AKIFELADVEFNVNSPRQLGEILFEKLKLDPKAKKTKTGQYATSEDVLQK 637

Query: 291 LNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSI 350
           L+           ++  L++    +         P Q     +R H    Q         
Sbjct: 638 LSA------KHDIIKYILEYRTYQKLKSTYVDALPLQIDKDDNRVHTSFSQTTAATGRLA 691

Query: 351 TSDPD----PLQII-SDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETG 405
           + +P+    P++ +    +R   +A+EGKK++ AD + IE R++A ++ E+  + AF+ G
Sbjct: 692 SVNPNLQNIPIRTLRGQQIRGAFVAAEGKKIISADYSQIELRLIAEISNEENMILAFQNG 751

Query: 406 EDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLN 458
           ED++V+T AR F++   +VTK QR   K +   + Y  GA A   +A  TGL+
Sbjct: 752 EDIHVSTAARLFDIPLEEVTKTQRGQAKTVNFGIIYGQGAFA---LAEQTGLS 801


>gi|332142369|ref|YP_004428107.1| phage-related DNA polymerase [Alteromonas macleodii str. 'Deep
           ecotype']
 gi|327552391|gb|AEA99109.1| phage-related DNA polymerase [Alteromonas macleodii str. 'Deep
           ecotype']
          Length = 310

 Score = 72.4 bits (176), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 92/365 (25%), Positives = 142/365 (38%), Gaps = 98/365 (26%)

Query: 274 IQVFNNRMRA-SRSAVLKLNTLVEAMN----SDGRLRGTLQFLGASRTGRWSGC-VFPPQ 327
           + +F  R RA S  AV +   LV+A+N    +D +L   L + GA  TGR+ G      Q
Sbjct: 9   LPIFEARERAKSNQAVSRAKKLVQAVNGRPNNDNKLVVPLVYYGA-HTGRYGGNEGLNLQ 67

Query: 328 NLPRPSRSHEELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEAR 387
           NL R S                               R  + A  G+ + VAD + IEAR
Sbjct: 68  NLQRGSEH-----------------------------RKALTAPFGQLVYVADSSNIEAR 98

Query: 388 VLAWMAGEQWKLKAFETGEDLYVT--TYARSFNVAPAQVTKDQRAIGKVMELALGYQGGA 445
           ++AW A E   L  F+ G D Y T  T    F V   Q  + +R +GKV  L L Y  GA
Sbjct: 99  IVAWFAQETALLNQFKNGIDTYATLATDIYGFPVT-KQTHQLERNVGKVARLGLQYGMGA 157

Query: 446 KAFQKMASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACER 505
           + F +   +  + +            P  W   E                        E+
Sbjct: 158 RTFHRTMESGPMGI-----------PPMPWAFPE-----------------------IEK 183

Query: 506 VKKAWRQKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSG 565
           + K +R+ H  + + W   +Q  ++ I          R+D    +      +  L LP+G
Sbjct: 184 IVKTYRRTHPMIKKCWEIGNQIIQKMI----------RKDTLETWRCLTVRHQCLELPNG 233

Query: 566 RSLVYRDVGNNR--------------SYLNTTTRQLTREYTYGGKLTENIVQAVSRDILA 611
             L + ++ N                SY +  +++L  +  YGGKL ENI QA++   + 
Sbjct: 234 MYLQFPNLRNKEIQTAQGPQYEVVYDSY-DYKSKKLVEKRLYGGKLLENIAQALAGLAMK 292

Query: 612 EGMMN 616
           E M++
Sbjct: 293 EMMLD 297


>gi|167583897|ref|ZP_02376285.1| DNA polymerase I [Burkholderia ubonensis Bu]
          Length = 917

 Score = 72.4 bits (176), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 69/135 (51%), Gaps = 10/135 (7%)

Query: 330 PRPSRSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLVVADLAG 383
           P   R H    Q +       ++DP+ LQ I         +R   IAS G ++V AD + 
Sbjct: 639 PETGRVHTNYAQAVAVTGRLASNDPN-LQNIPVRTAEGRRIREAFIASPGHQIVSADYSQ 697

Query: 384 IEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQG 443
           IE R++A ++G+   L+AF  GED++  T A  F V P +VT DQR I KV+   L Y  
Sbjct: 698 IELRIMAHISGDASLLRAFSNGEDIHRATAAEVFGVTPLEVTADQRRIAKVINFGLIY-- 755

Query: 444 GAKAFQKMASTTGLN 458
           G  AF  +AS  G+ 
Sbjct: 756 GMSAF-GLASNLGIT 769


>gi|209517786|ref|ZP_03266621.1| DNA polymerase I [Burkholderia sp. H160]
 gi|209501732|gb|EEA01753.1| DNA polymerase I [Burkholderia sp. H160]
          Length = 913

 Score = 72.4 bits (176), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 57/95 (60%), Gaps = 3/95 (3%)

Query: 364 VRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQ 423
           +R   IA  G KLV AD + IE R++A ++G++  ++AF  GED++  T +  FNV P +
Sbjct: 674 IREAFIAPPGHKLVSADYSQIELRIMAHISGDESLMRAFSQGEDIHRATASEIFNVTPLE 733

Query: 424 VTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLN 458
           V+ DQR + KV+   L Y  G  AF  +AS  G+ 
Sbjct: 734 VSSDQRRVAKVINFGLIY--GMSAF-GLASNLGIT 765


>gi|241663633|ref|YP_002981993.1| DNA polymerase I [Ralstonia pickettii 12D]
 gi|240865660|gb|ACS63321.1| DNA polymerase I [Ralstonia pickettii 12D]
          Length = 937

 Score = 72.4 bits (176), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 54/176 (30%), Positives = 85/176 (48%), Gaps = 13/176 (7%)

Query: 330 PRPSRSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLVVADLAG 383
           PR  R H    Q         ++DP+ LQ I         +R   IA EG  +V AD + 
Sbjct: 659 PRTGRVHTTYGQATAVTGRLASTDPN-LQNIPVRTEEGRRIREAFIAPEGSVIVSADYSQ 717

Query: 384 IEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQG 443
           IE R++A ++ ++  ++AF  G+D++  T A  FNV P +VT DQR + KV+   L Y  
Sbjct: 718 IELRIMAHLSQDEGLMRAFREGQDVHRATAAEVFNVTPLEVTPDQRRVAKVINFGLIY-- 775

Query: 444 GAKAFQKMASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHA-IEDLF 498
           G  AF  +AS  G+  +     +    A   +  A N+    +++  EH  +E +F
Sbjct: 776 GMSAF-GLASNLGIGRDAAKLYIDRYFA--RYPGAANYMEETRQSAREHGYVETVF 828


>gi|256830888|ref|YP_003159616.1| DNA polymerase I [Desulfomicrobium baculatum DSM 4028]
 gi|256580064|gb|ACU91200.1| DNA polymerase I [Desulfomicrobium baculatum DSM 4028]
          Length = 861

 Score = 72.0 bits (175), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 107/456 (23%), Positives = 169/456 (37%), Gaps = 119/456 (26%)

Query: 192 INDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSSSRCLEKLKTWLFLETGLHL 251
           +  RG  +D A  H    +V  E  +L + +     G   + R  ++L   LF   GL  
Sbjct: 475 MQKRGIRIDAARFHDFLGMVQAELDRLTRTIHE-QAGEEFNIRSSQQLAEVLFSRLGLAC 533

Query: 252 EDLT----ETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLNTLVEAMNSDGRLRGT 307
           +  T    ++T   VL       P    V   RM     +   L  + +  + +GR+  T
Sbjct: 534 KQKTPGGAQSTSSSVLEGLAAEHPIVADVLEFRMYEKLRSTY-LEPMPQLADKNGRIHTT 592

Query: 308 LQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITSDPDPLQIISDCVRSC 367
              L A+ TGR S      QN+P                   I     P       +RSC
Sbjct: 593 FNQL-ATATGRLSSSNPNLQNIP-------------------IRGALGP------RMRSC 626

Query: 368 VIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKD 427
            +AS G +LV AD + IE RVLA M+G+Q   +AF  G+D++  T    F+    +V+ D
Sbjct: 627 FVASPGNRLVAADYSQIELRVLAHMSGDQTLTEAFAAGDDIHARTAGILFDT--TEVSAD 684

Query: 428 QRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQE 487
           +R   K +   L Y  G    QK+    G++L                ++A+ F      
Sbjct: 685 ERRKAKTINFGLLYGMGP---QKLGRELGISL----------------KEAKEFI----- 720

Query: 488 NHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVP 547
                                 +  K SRV E + E+ +A  +++     +  R+R    
Sbjct: 721 --------------------AVYFSKLSRVREFYEEI-EAGAKSLGYVTTLAGRRR---- 755

Query: 548 LVYMKKDKNNLILMLPSGRSLVYRDVGNNRSYLNTTTRQLTREYTYGGKLTENIVQAVSR 607
                        MLP           N+R   NT   Q  R           +VQ  + 
Sbjct: 756 -------------MLPE---------INSR---NTNMAQQARRMA-----INTVVQGSAA 785

Query: 608 DILAEGMMNATKA------GYDIVLTVHDEIVCETP 637
           DI+ + M+   K+      G  ++L +HDE++ E P
Sbjct: 786 DIIKKAMLEVDKSPVIGELGASLILQIHDELLLEAP 821


>gi|269976594|ref|ZP_06183579.1| DNA polymerase [Mobiluncus mulieris 28-1]
 gi|269935395|gb|EEZ91944.1| DNA polymerase [Mobiluncus mulieris 28-1]
          Length = 143

 Score = 72.0 bits (175), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 47/124 (37%), Positives = 67/124 (54%), Gaps = 6/124 (4%)

Query: 97  LVLARSNGLPSALKAVGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREA-WR 155
           +V A + GLP +LK VG+ L L +QKM+EGK+LI  FC  + +     R  P+   A W+
Sbjct: 1   MVWAATLGLPLSLKDVGKVLNLDAQKMDEGKDLIKHFCVPDDNS---QRRLPSSDPAGWK 57

Query: 156 LFGEYCKGDVTVTREIFKRLE--PLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDV 213
           LF  Y   DV V   I ++L   P+     E + +DQ INDRG  +D  LA +   I + 
Sbjct: 58  LFQSYNARDVQVETAIRQKLANFPVPEYVWEQYEVDQRINDRGIRIDTTLAASAITIDEK 117

Query: 214 ERTK 217
            R +
Sbjct: 118 HRAQ 121


>gi|108805947|ref|YP_645884.1| DNA-directed DNA polymerase [Rubrobacter xylanophilus DSM 9941]
 gi|108767190|gb|ABG06072.1| DNA-directed DNA polymerase [Rubrobacter xylanophilus DSM 9941]
          Length = 582

 Score = 71.6 bits (174), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 66/128 (51%), Gaps = 5/128 (3%)

Query: 330 PRPSRSHEELDQIITHLPTS--ITSDPDPLQII-SDCVRSCVIASEGKKLVVADLAGIEA 386
           P+  R H    Q    +PT     ++P+  QI   D  R C +A EG  LV+AD + IE 
Sbjct: 309 PKTGRIHASFLQ--CRVPTGRLACTNPNVQQIPHEDEFRRCFVAGEGNVLVIADYSQIEL 366

Query: 387 RVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAK 446
           R+LA ++G+   ++AF  GEDL+  T A  F V   +VTK+QR+  K +   L Y  G +
Sbjct: 367 RILAEVSGDPGFVEAFRRGEDLHRVTAATMFGVPKEEVTKEQRSAAKRINFGLAYGRGPR 426

Query: 447 AFQKMAST 454
           +      T
Sbjct: 427 SLAAQLGT 434


>gi|170691111|ref|ZP_02882277.1| DNA polymerase I [Burkholderia graminis C4D1M]
 gi|170144360|gb|EDT12522.1| DNA polymerase I [Burkholderia graminis C4D1M]
          Length = 913

 Score = 71.2 bits (173), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 57/94 (60%), Gaps = 3/94 (3%)

Query: 364 VRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQ 423
           +R   IA  G KLV AD + IE R++A ++G++  L+AF  GED++  T A  F+V P +
Sbjct: 674 IREAFIAPPGHKLVSADYSQIELRIMAHISGDESLLRAFSEGEDIHRATAAEIFSVTPLE 733

Query: 424 VTKDQRAIGKVMELALGYQGGAKAFQKMASTTGL 457
           V+ DQR + KV+   L Y  G  +F  +AS  G+
Sbjct: 734 VSNDQRRVAKVINFGLIY--GMSSF-GLASNLGI 764


>gi|323529237|ref|YP_004231389.1| DNA polymerase I [Burkholderia sp. CCGE1001]
 gi|323386239|gb|ADX58329.1| DNA polymerase I [Burkholderia sp. CCGE1001]
          Length = 913

 Score = 71.2 bits (173), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 57/95 (60%), Gaps = 3/95 (3%)

Query: 364 VRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQ 423
           +R   IA  G KLV AD + IE R++A ++G++  L+AF  GED++  T A  F+V P +
Sbjct: 674 IREAFIAPPGHKLVSADYSQIELRIMAHISGDESLLRAFSQGEDIHRATAAEIFSVTPLE 733

Query: 424 VTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLN 458
           V+ DQR + KV+   L Y  G  +F  +AS  G+ 
Sbjct: 734 VSNDQRRVAKVINFGLIY--GMSSF-GLASNLGIT 765


>gi|186473237|ref|YP_001860579.1| DNA polymerase I [Burkholderia phymatum STM815]
 gi|184195569|gb|ACC73533.1| DNA polymerase I [Burkholderia phymatum STM815]
          Length = 915

 Score = 71.2 bits (173), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 58/94 (61%), Gaps = 3/94 (3%)

Query: 364 VRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQ 423
           +R   IA  G KLV AD + IE R++A ++G++  L+AF+ GED++  T +  F+V P +
Sbjct: 676 IREAFIAPPGHKLVSADYSQIELRIMAHISGDEALLRAFKQGEDIHRATASEVFSVTPLE 735

Query: 424 VTKDQRAIGKVMELALGYQGGAKAFQKMASTTGL 457
           V+ DQR I KV+   L Y  G  +F  +AS  G+
Sbjct: 736 VSNDQRRIAKVINFGLIY--GMSSF-GLASNLGI 766


>gi|307726557|ref|YP_003909770.1| DNA polymerase I [Burkholderia sp. CCGE1003]
 gi|307587082|gb|ADN60479.1| DNA polymerase I [Burkholderia sp. CCGE1003]
          Length = 913

 Score = 70.9 bits (172), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 57/94 (60%), Gaps = 3/94 (3%)

Query: 364 VRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQ 423
           +R   IA  G KLV AD + IE R++A ++G++  L+AF  GED++  T A  F+V P +
Sbjct: 674 IREAFIAPPGHKLVSADYSQIELRIMAHISGDESLLRAFSQGEDIHRATAAEIFSVTPLE 733

Query: 424 VTKDQRAIGKVMELALGYQGGAKAFQKMASTTGL 457
           V+ DQR + KV+   L Y  G  +F  +AS  G+
Sbjct: 734 VSNDQRRVAKVINFGLIY--GMSSF-GLASNLGI 764


>gi|187929514|ref|YP_001900001.1| DNA polymerase I [Ralstonia pickettii 12J]
 gi|309781710|ref|ZP_07676443.1| DNA polymerase I [Ralstonia sp. 5_7_47FAA]
 gi|187726404|gb|ACD27569.1| DNA polymerase I [Ralstonia pickettii 12J]
 gi|308919351|gb|EFP65015.1| DNA polymerase I [Ralstonia sp. 5_7_47FAA]
          Length = 937

 Score = 70.9 bits (172), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 47/135 (34%), Positives = 69/135 (51%), Gaps = 10/135 (7%)

Query: 330 PRPSRSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLVVADLAG 383
           PR  R H    Q         ++DP+ LQ I         +R   IA EG  +V AD + 
Sbjct: 659 PRTGRVHTTYGQATAVTGRLASTDPN-LQNIPVRTEEGRRIREAFIAPEGSVIVSADYSQ 717

Query: 384 IEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQG 443
           IE R++A ++ ++  ++AF  G+D++  T A  FNV P +VT DQR + KV+   L Y  
Sbjct: 718 IELRIMAHLSQDEGLMRAFREGQDVHRATAAEVFNVTPLEVTPDQRRVAKVINFGLIY-- 775

Query: 444 GAKAFQKMASTTGLN 458
           G  AF  +AS  G+ 
Sbjct: 776 GMSAF-GLASNLGIG 789


>gi|78063065|ref|YP_372973.1| DNA polymerase I [Burkholderia sp. 383]
 gi|77970950|gb|ABB12329.1| DNA polymerase A [Burkholderia sp. 383]
          Length = 917

 Score = 70.9 bits (172), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 48/135 (35%), Positives = 68/135 (50%), Gaps = 10/135 (7%)

Query: 330 PRPSRSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLVVADLAG 383
           P   R H    Q +       ++DP+ LQ I         +R   IAS G ++V AD + 
Sbjct: 639 PSTGRVHTNYAQAVAVTGRLASNDPN-LQNIPVRTAEGRRIREAFIASPGHRIVSADYSQ 697

Query: 384 IEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQG 443
           IE R++A ++G+   L+AF  GED++  T A  F V P +V  DQR I KV+   L Y  
Sbjct: 698 IELRIMAHISGDASLLRAFSQGEDIHRATAAEVFGVTPLEVNSDQRRIAKVINFGLIY-- 755

Query: 444 GAKAFQKMASTTGLN 458
           G  AF  +AS  G+ 
Sbjct: 756 GMSAF-GLASNLGIT 769


>gi|107026837|ref|YP_624348.1| DNA polymerase I [Burkholderia cenocepacia AU 1054]
 gi|116691969|ref|YP_837502.1| DNA polymerase I [Burkholderia cenocepacia HI2424]
 gi|170736037|ref|YP_001777297.1| DNA polymerase I [Burkholderia cenocepacia MC0-3]
 gi|105896211|gb|ABF79375.1| DNA polymerase I [Burkholderia cenocepacia AU 1054]
 gi|116649969|gb|ABK10609.1| DNA polymerase I [Burkholderia cenocepacia HI2424]
 gi|169818225|gb|ACA92807.1| DNA polymerase I [Burkholderia cenocepacia MC0-3]
          Length = 917

 Score = 70.5 bits (171), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 48/135 (35%), Positives = 68/135 (50%), Gaps = 10/135 (7%)

Query: 330 PRPSRSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLVVADLAG 383
           P   R H    Q +       ++DP+ LQ I         +R   IAS G ++V AD + 
Sbjct: 639 PTTGRVHTNYAQAVAVTGRLASNDPN-LQNIPVRTAEGRRIREAFIASPGHRIVSADYSQ 697

Query: 384 IEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQG 443
           IE R++A ++G+   L+AF  GED++  T A  F V P +V  DQR I KV+   L Y  
Sbjct: 698 IELRIMAHISGDASLLRAFSQGEDIHRATAAEVFGVTPLEVNSDQRRIAKVINFGLIY-- 755

Query: 444 GAKAFQKMASTTGLN 458
           G  AF  +AS  G+ 
Sbjct: 756 GMSAF-GLASNLGIT 769


>gi|254248787|ref|ZP_04942107.1| DNA polymerase A [Burkholderia cenocepacia PC184]
 gi|124875288|gb|EAY65278.1| DNA polymerase A [Burkholderia cenocepacia PC184]
          Length = 920

 Score = 70.5 bits (171), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 48/135 (35%), Positives = 68/135 (50%), Gaps = 10/135 (7%)

Query: 330 PRPSRSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLVVADLAG 383
           P   R H    Q +       ++DP+ LQ I         +R   IAS G ++V AD + 
Sbjct: 642 PTTGRVHTNYAQAVAVTGRLASNDPN-LQNIPVRTAEGRRIREAFIASPGHRIVSADYSQ 700

Query: 384 IEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQG 443
           IE R++A ++G+   L+AF  GED++  T A  F V P +V  DQR I KV+   L Y  
Sbjct: 701 IELRIMAHISGDASLLRAFSQGEDIHRATAAEVFGVTPLEVNSDQRRIAKVINFGLIY-- 758

Query: 444 GAKAFQKMASTTGLN 458
           G  AF  +AS  G+ 
Sbjct: 759 GMSAF-GLASNLGIT 772


>gi|325521672|gb|EGD00436.1| DNA polymerase I [Burkholderia sp. TJI49]
          Length = 641

 Score = 70.5 bits (171), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 48/135 (35%), Positives = 68/135 (50%), Gaps = 10/135 (7%)

Query: 330 PRPSRSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLVVADLAG 383
           P   R H    Q +       ++DP+ LQ I         +R   IAS G ++V AD + 
Sbjct: 363 PATGRVHTNYAQAVAVTGRLASNDPN-LQNIPVRTAEGRRIREAFIASPGHRIVSADYSQ 421

Query: 384 IEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQG 443
           IE R++A ++G+   L+AF  GED++  T A  F V P +V  DQR I KV+   L Y  
Sbjct: 422 IELRIMAHISGDASLLRAFSQGEDIHRATAAEVFGVTPLEVNADQRRIAKVINFGLIY-- 479

Query: 444 GAKAFQKMASTTGLN 458
           G  AF  +AS  G+ 
Sbjct: 480 GMSAF-GLASNLGIT 493


>gi|171321673|ref|ZP_02910595.1| DNA polymerase I [Burkholderia ambifaria MEX-5]
 gi|171093053|gb|EDT38279.1| DNA polymerase I [Burkholderia ambifaria MEX-5]
          Length = 917

 Score = 70.1 bits (170), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 48/135 (35%), Positives = 68/135 (50%), Gaps = 10/135 (7%)

Query: 330 PRPSRSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLVVADLAG 383
           P   R H    Q +       ++DP+ LQ I         +R   IAS G ++V AD + 
Sbjct: 639 PATGRVHTNYAQAVAVTGRLASNDPN-LQNIPVRTAEGRRIREAFIASPGHRIVSADYSQ 697

Query: 384 IEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQG 443
           IE R++A ++G+   L+AF  GED++  T A  F V P +V  DQR I KV+   L Y  
Sbjct: 698 IELRIMAHISGDASLLRAFAQGEDIHRATAAEVFGVTPLEVNSDQRRIAKVINFGLIY-- 755

Query: 444 GAKAFQKMASTTGLN 458
           G  AF  +AS  G+ 
Sbjct: 756 GMSAF-GLASNLGIT 769


>gi|172062801|ref|YP_001810452.1| DNA polymerase I [Burkholderia ambifaria MC40-6]
 gi|171995318|gb|ACB66236.1| DNA polymerase I [Burkholderia ambifaria MC40-6]
          Length = 917

 Score = 70.1 bits (170), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 48/135 (35%), Positives = 68/135 (50%), Gaps = 10/135 (7%)

Query: 330 PRPSRSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLVVADLAG 383
           P   R H    Q +       ++DP+ LQ I         +R   IAS G ++V AD + 
Sbjct: 639 PATGRVHTNYAQAVAVTGRLASNDPN-LQNIPVRTAEGRRIREAFIASPGHRIVSADYSQ 697

Query: 384 IEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQG 443
           IE R++A ++G+   L+AF  GED++  T A  F V P +V  DQR I KV+   L Y  
Sbjct: 698 IELRIMAHISGDASLLRAFAQGEDIHRATAAEVFGVTPLEVNSDQRRIAKVINFGLIY-- 755

Query: 444 GAKAFQKMASTTGLN 458
           G  AF  +AS  G+ 
Sbjct: 756 GMSAF-GLASNLGIT 769


>gi|115357994|ref|YP_775132.1| DNA polymerase I [Burkholderia ambifaria AMMD]
 gi|115283282|gb|ABI88798.1| DNA polymerase I [Burkholderia ambifaria AMMD]
          Length = 917

 Score = 70.1 bits (170), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 48/135 (35%), Positives = 68/135 (50%), Gaps = 10/135 (7%)

Query: 330 PRPSRSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLVVADLAG 383
           P   R H    Q +       ++DP+ LQ I         +R   IAS G ++V AD + 
Sbjct: 639 PATGRVHTNYAQAVAVTGRLASNDPN-LQNIPVRTAEGRRIREAFIASPGHRIVSADYSQ 697

Query: 384 IEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQG 443
           IE R++A ++G+   L+AF  GED++  T A  F V P +V  DQR I KV+   L Y  
Sbjct: 698 IELRIMAHISGDASLLRAFAQGEDIHRATAAEVFGVTPLEVNSDQRRIAKVINFGLIY-- 755

Query: 444 GAKAFQKMASTTGLN 458
           G  AF  +AS  G+ 
Sbjct: 756 GMSAF-GLASNLGIT 769


>gi|170701220|ref|ZP_02892190.1| DNA polymerase I [Burkholderia ambifaria IOP40-10]
 gi|170133887|gb|EDT02245.1| DNA polymerase I [Burkholderia ambifaria IOP40-10]
          Length = 917

 Score = 70.1 bits (170), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 55/95 (57%), Gaps = 3/95 (3%)

Query: 364 VRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQ 423
           +R   IAS G ++V AD + IE R++A ++G+   L+AF  GED++  T A  F V P +
Sbjct: 678 IREAFIASPGHRIVSADYSQIELRIMAHISGDASLLRAFAQGEDIHRATAAEVFGVTPLE 737

Query: 424 VTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLN 458
           V  DQR I KV+   L Y  G  AF  +AS  G+ 
Sbjct: 738 VNSDQRRIAKVINFGLIY--GMSAF-GLASNLGIT 769


>gi|238024946|ref|YP_002909178.1| DNA polymerase I [Burkholderia glumae BGR1]
 gi|237879611|gb|ACR31943.1| DNA polymerase I [Burkholderia glumae BGR1]
          Length = 917

 Score = 70.1 bits (170), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 57/95 (60%), Gaps = 3/95 (3%)

Query: 364 VRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQ 423
           +R   IA+ G K+V AD + IE R++A ++G++  L+AF  GED++  T A  F V P +
Sbjct: 678 IREAFIAAPGCKIVSADYSQIELRIMAHISGDESLLRAFSQGEDIHRATAAEVFGVTPLE 737

Query: 424 VTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLN 458
           V+ DQR I KV+   L Y  G  AF  +AS  G+ 
Sbjct: 738 VSTDQRRIAKVINFGLIY--GMSAF-GLASNLGIT 769


>gi|317484592|ref|ZP_07943496.1| DNA polymerase I [Bilophila wadsworthia 3_1_6]
 gi|316924132|gb|EFV45314.1| DNA polymerase I [Bilophila wadsworthia 3_1_6]
          Length = 874

 Score = 70.1 bits (170), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 53/170 (31%), Positives = 76/170 (44%), Gaps = 29/170 (17%)

Query: 291 LNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSI 350
           L  L   M  DGR+R T   L A+ TGR S      QN+P                    
Sbjct: 584 LEPLPRLMGGDGRIRTTFNQL-ATATGRLSSSNPNLQNIPVRG----------------- 625

Query: 351 TSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYV 410
                    +   +R+C  A EGKKL+ AD + IE RVLA ++ ++  L AF  G D++ 
Sbjct: 626 --------ALGRRMRACFTAPEGKKLISADYSQIELRVLAHLSRDETLLAAFREGADIHA 677

Query: 411 TTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLN 460
            T +  F+  P+++T DQR   K +   L Y  G    QK+A    + L+
Sbjct: 678 RTASLLFDAPPSEITPDQRRNAKTINFGLIYGMGP---QKLAQELKIPLS 724


>gi|187921421|ref|YP_001890453.1| DNA polymerase I [Burkholderia phytofirmans PsJN]
 gi|187719859|gb|ACD21082.1| DNA polymerase I [Burkholderia phytofirmans PsJN]
          Length = 913

 Score = 70.1 bits (170), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 37/95 (38%), Positives = 57/95 (60%), Gaps = 3/95 (3%)

Query: 364 VRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQ 423
           +R   IA  G KLV AD + IE R++A ++G++  L+AF  GED++  T A  F+V P +
Sbjct: 674 IREAFIAPPGHKLVSADYSQIELRIMAHISGDESLLRAFSQGEDIHRATAAEIFSVTPLE 733

Query: 424 VTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLN 458
           V+ DQR + KV+   L Y  G  +F  +A+  G+ 
Sbjct: 734 VSNDQRRVAKVINFGLIY--GMSSF-GLAANLGIT 765


>gi|134292957|ref|YP_001116693.1| DNA polymerase I [Burkholderia vietnamiensis G4]
 gi|134136114|gb|ABO57228.1| DNA polymerase I [Burkholderia vietnamiensis G4]
          Length = 917

 Score = 69.7 bits (169), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 55/95 (57%), Gaps = 3/95 (3%)

Query: 364 VRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQ 423
           +R   IAS G ++V AD + IE R++A ++G+   L+AF  GED++  T A  F V P +
Sbjct: 678 IREAFIASPGHRIVSADYSQIELRIMAHISGDASLLRAFAHGEDIHRATAAEVFGVTPLE 737

Query: 424 VTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLN 458
           V  DQR I KV+   L Y  G  AF  +AS  G+ 
Sbjct: 738 VNSDQRRIAKVINFGLIY--GMSAF-GLASNLGIT 769


>gi|220904332|ref|YP_002479644.1| DNA polymerase I [Desulfovibrio desulfuricans subsp. desulfuricans
           str. ATCC 27774]
 gi|219868631|gb|ACL48966.1| DNA polymerase I [Desulfovibrio desulfuricans subsp. desulfuricans
           str. ATCC 27774]
          Length = 921

 Score = 69.7 bits (169), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 50/156 (32%), Positives = 75/156 (48%), Gaps = 26/156 (16%)

Query: 291 LNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSI 350
           L+ L   M+ +GR+  T     A+ TGR S      QN+P                   +
Sbjct: 631 LDPLPRLMDGNGRIHTTFN-QKATATGRLSSSNPNLQNIP-------------------V 670

Query: 351 TSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYV 410
             D      +   +R+C IA+ G  LV AD + +E RVLA M+ ++  L+AF  GED++ 
Sbjct: 671 RGD------LGKRMRTCFIANPGSALVSADYSQVELRVLAHMSQDKALLEAFRNGEDIHA 724

Query: 411 TTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAK 446
            T A  +++AP QV+ DQR   K +   L Y  GA+
Sbjct: 725 RTAALVYDLAPDQVSPDQRRNAKTINFGLIYGMGAQ 760


>gi|296159650|ref|ZP_06842473.1| DNA polymerase I [Burkholderia sp. Ch1-1]
 gi|295890094|gb|EFG69889.1| DNA polymerase I [Burkholderia sp. Ch1-1]
          Length = 913

 Score = 69.7 bits (169), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 37/95 (38%), Positives = 57/95 (60%), Gaps = 3/95 (3%)

Query: 364 VRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQ 423
           +R   IA  G KLV AD + IE R++A ++G++  L++F  GED++  T A  F+V P +
Sbjct: 674 IREAFIAPPGHKLVSADYSQIELRIMAHISGDESLLRSFSQGEDIHRATAAEIFSVTPLE 733

Query: 424 VTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLN 458
           V+ DQR + KV+   L Y  G  +F  +AS  G+ 
Sbjct: 734 VSNDQRRVAKVINFGLIY--GMSSF-GLASNLGIT 765


>gi|221197067|ref|ZP_03570114.1| DNA polymerase I [Burkholderia multivorans CGD2M]
 gi|221203739|ref|ZP_03576757.1| DNA polymerase I [Burkholderia multivorans CGD2]
 gi|221175905|gb|EEE08334.1| DNA polymerase I [Burkholderia multivorans CGD2]
 gi|221183621|gb|EEE16021.1| DNA polymerase I [Burkholderia multivorans CGD2M]
          Length = 920

 Score = 69.7 bits (169), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 47/134 (35%), Positives = 68/134 (50%), Gaps = 10/134 (7%)

Query: 330 PRPSRSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLVVADLAG 383
           P   R H    Q +       ++DP+ LQ I         +R   IA+ G ++V AD + 
Sbjct: 642 PSTGRVHTNYAQAVAVTGRLASNDPN-LQNIPVRTAEGRRIREAFIAAPGHRIVSADYSQ 700

Query: 384 IEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQG 443
           IE R++A ++G+   L+AF  GED++  T A  F V P +V  DQR I KV+   L Y  
Sbjct: 701 IELRIMAHISGDASLLRAFSQGEDIHRATAAEVFGVTPLEVNADQRRIAKVINFGLIY-- 758

Query: 444 GAKAFQKMASTTGL 457
           G  AF  +AS  G+
Sbjct: 759 GMSAF-GLASNLGI 771


>gi|221212339|ref|ZP_03585316.1| DNA polymerase I [Burkholderia multivorans CGD1]
 gi|221167438|gb|EED99907.1| DNA polymerase I [Burkholderia multivorans CGD1]
          Length = 920

 Score = 69.7 bits (169), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 47/135 (34%), Positives = 68/135 (50%), Gaps = 10/135 (7%)

Query: 330 PRPSRSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLVVADLAG 383
           P   R H    Q +       ++DP+ LQ I         +R   IA+ G ++V AD + 
Sbjct: 642 PSTGRVHTNYAQAVAVTGRLASNDPN-LQNIPVRTAEGRRIREAFIAAPGHRIVSADYSQ 700

Query: 384 IEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQG 443
           IE R++A ++G+   L+AF  GED++  T A  F V P +V  DQR I KV+   L Y  
Sbjct: 701 IELRIMAHISGDASLLRAFSQGEDIHRATAAEVFGVTPLEVNADQRRIAKVINFGLIY-- 758

Query: 444 GAKAFQKMASTTGLN 458
           G  AF  +AS  G+ 
Sbjct: 759 GMSAF-GLASNLGIT 772


>gi|283853836|ref|ZP_06371055.1| DNA polymerase I [Desulfovibrio sp. FW1012B]
 gi|283570771|gb|EFC18812.1| DNA polymerase I [Desulfovibrio sp. FW1012B]
          Length = 878

 Score = 69.7 bits (169), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 53/177 (29%), Positives = 83/177 (46%), Gaps = 11/177 (6%)

Query: 364 VRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQ 423
           +R C +A+ GKKLV AD + IE RVLA ++GE   L AFE G D++  T A  F+ A A 
Sbjct: 639 MRECFVAAAGKKLVAADYSQIELRVLAHLSGEPALLAAFEQGADIHARTAAILFDKAEAD 698

Query: 424 VTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVKTNSAPEEWEDAENFCR 483
           +  D+R   K +   L Y  G    QK++   G+ L+     ++     E       F +
Sbjct: 699 IRPDERRQAKTINFGLLYGMGP---QKLSRDLGIKLDAAKAFIEKYF--ERLSGLSTFYQ 753

Query: 484 WMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNEL-HQAFEQTIENGKAII 539
            + +          F+ T   R ++   + HS  S+L ++   QA    ++ G A I
Sbjct: 754 GIVDTAKAQG----FVTTLAGR-RRLLPEIHSANSQLASQARRQAINTVVQGGAADI 805


>gi|161521363|ref|YP_001584790.1| DNA polymerase I [Burkholderia multivorans ATCC 17616]
 gi|189352470|ref|YP_001948097.1| DNA polymerase I [Burkholderia multivorans ATCC 17616]
 gi|160345413|gb|ABX18498.1| DNA polymerase I [Burkholderia multivorans ATCC 17616]
 gi|189336492|dbj|BAG45561.1| DNA polymerase I [Burkholderia multivorans ATCC 17616]
          Length = 917

 Score = 69.7 bits (169), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 47/134 (35%), Positives = 68/134 (50%), Gaps = 10/134 (7%)

Query: 330 PRPSRSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLVVADLAG 383
           P   R H    Q +       ++DP+ LQ I         +R   IA+ G ++V AD + 
Sbjct: 639 PSTGRVHTNYAQAVAVTGRLASNDPN-LQNIPVRTAEGRRIREAFIAAPGHRIVSADYSQ 697

Query: 384 IEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQG 443
           IE R++A ++G+   L+AF  GED++  T A  F V P +V  DQR I KV+   L Y  
Sbjct: 698 IELRIMAHISGDASLLRAFSQGEDIHRATAAEVFGVTPLEVNADQRRIAKVINFGLIY-- 755

Query: 444 GAKAFQKMASTTGL 457
           G  AF  +AS  G+
Sbjct: 756 GMSAF-GLASNLGI 768


>gi|206562759|ref|YP_002233522.1| DNA polymerase I [Burkholderia cenocepacia J2315]
 gi|198038799|emb|CAR54761.1| DNA polymerase I [Burkholderia cenocepacia J2315]
          Length = 917

 Score = 69.3 bits (168), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 47/135 (34%), Positives = 68/135 (50%), Gaps = 10/135 (7%)

Query: 330 PRPSRSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLVVADLAG 383
           P   R H    Q +       ++DP+ LQ I         +R   IA+ G ++V AD + 
Sbjct: 639 PTTGRVHTNYAQAVAVTGRLASNDPN-LQNIPVRTAEGRRIREAFIAAPGHRIVSADYSQ 697

Query: 384 IEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQG 443
           IE R++A ++G+   L+AF  GED++  T A  F V P +V  DQR I KV+   L Y  
Sbjct: 698 IELRIMAHISGDASLLRAFSQGEDIHRATAAEVFGVTPLEVNSDQRRIAKVINFGLIY-- 755

Query: 444 GAKAFQKMASTTGLN 458
           G  AF  +AS  G+ 
Sbjct: 756 GMSAF-GLASNLGIT 769


>gi|311693184|gb|ADP96057.1| LOW QUALITY PROTEIN: DNA polymerase I [marine bacterium HP15]
          Length = 868

 Score = 69.3 bits (168), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 46/124 (37%), Positives = 64/124 (51%), Gaps = 9/124 (7%)

Query: 331 RPSRSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLVVADLAGI 384
           R  R H    Q +T      +S+P+ LQ I         +R   IA EG KLV AD + I
Sbjct: 590 RTGRVHTSYHQAVTATGRLSSSEPN-LQNIPIRSEQGRRIRQAFIAPEGYKLVAADYSQI 648

Query: 385 EARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGG 444
           E R++A ++G++  LKAFE GED++  T +  F V+   V+ DQR   K +   L Y  G
Sbjct: 649 ELRIMAHLSGDKGLLKAFEKGEDIHKATASEVFGVSLDDVSSDQRRSAKAINFGLIY--G 706

Query: 445 AKAF 448
             AF
Sbjct: 707 MSAF 710


>gi|86157736|ref|YP_464521.1| DNA polymerase I [Anaeromyxobacter dehalogenans 2CP-C]
 gi|85774247|gb|ABC81084.1| DNA polymerase I [Anaeromyxobacter dehalogenans 2CP-C]
          Length = 897

 Score = 68.9 bits (167), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 51/149 (34%), Positives = 70/149 (46%), Gaps = 28/149 (18%)

Query: 300 SDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITSDPDPLQI 359
           +DGR+  T    GA+ TGR S      QN+P           + T L             
Sbjct: 620 ADGRIHTTFHQAGAA-TGRLSSSDPNLQNIP-----------VRTEL------------- 654

Query: 360 ISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNV 419
            S  +R   +A  G +L+ AD + IE R+LA  + +   L+AF   ED++  T A +F V
Sbjct: 655 -SRRIRQAFVAPAGARLLSADYSQIELRILAHYSDDPGLLQAFRDREDVHTRTAAETFGV 713

Query: 420 APAQVTKDQRAIGKVMELALGYQGGAKAF 448
           AP QVT DQR I KV+   + Y  G  AF
Sbjct: 714 APEQVTPDQRRIAKVLNFGIAY--GLSAF 740


>gi|197122953|ref|YP_002134904.1| DNA polymerase I [Anaeromyxobacter sp. K]
 gi|196172802|gb|ACG73775.1| DNA polymerase I [Anaeromyxobacter sp. K]
          Length = 897

 Score = 68.9 bits (167), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 51/149 (34%), Positives = 70/149 (46%), Gaps = 28/149 (18%)

Query: 300 SDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITSDPDPLQI 359
           +DGR+  T    GA+ TGR S      QN+P           + T L             
Sbjct: 620 ADGRIHTTFHQAGAA-TGRLSSSDPNLQNIP-----------VRTEL------------- 654

Query: 360 ISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNV 419
            S  +R   +A  G +L+ AD + IE R+LA  + +   L+AF   ED++  T A +F V
Sbjct: 655 -SRRIRQAFVAPAGARLLSADYSQIELRILAHYSDDPGLLQAFRDREDVHTRTAAETFGV 713

Query: 420 APAQVTKDQRAIGKVMELALGYQGGAKAF 448
           AP QVT DQR I KV+   + Y  G  AF
Sbjct: 714 APEQVTPDQRRIAKVLNFGIAY--GLSAF 740


>gi|167577153|ref|ZP_02370027.1| DNA polymerase I [Burkholderia thailandensis TXDOH]
          Length = 926

 Score = 68.6 bits (166), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 47/135 (34%), Positives = 68/135 (50%), Gaps = 10/135 (7%)

Query: 330 PRPSRSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLVVADLAG 383
           P   R H    Q +       ++DP+ LQ I         +R   IA  G K+V AD + 
Sbjct: 648 PNTGRVHTNYAQAVAVTGRLASNDPN-LQNIPVRTAEGRRIREAFIAPPGSKIVSADYSQ 706

Query: 384 IEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQG 443
           IE R++A ++ ++  L+AF  GED++  T A  F V P +VT DQR I KV+   L Y  
Sbjct: 707 IELRIMAHISEDESLLRAFANGEDIHRATAAEVFGVTPLEVTSDQRRIAKVINFGLIY-- 764

Query: 444 GAKAFQKMASTTGLN 458
           G  +F  +AS  G+ 
Sbjct: 765 GMSSF-GLASNLGIT 778


>gi|159028763|emb|CAO89934.1| polA [Microcystis aeruginosa PCC 7806]
          Length = 956

 Score = 68.6 bits (166), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 74/319 (23%), Positives = 128/319 (40%), Gaps = 76/319 (23%)

Query: 330 PRPSRSHEELDQIITHLPTSITSDPDPLQI-----ISDCVRSCVIASEGKKLVVADLAGI 384
           P+ +R H + +Q IT      +S+P+   I      S  +R   I  +G  LV AD + I
Sbjct: 664 PKTARVHTDFNQTITSTGRLSSSNPNLQNIPVRSEFSRRIRQAFIPEDGYLLVSADYSQI 723

Query: 385 EARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGG 444
           E R+LA ++ E   L+A+ + +D++  T    F+    ++T ++R++GK +   + Y  G
Sbjct: 724 ELRILAHLSQEPVLLEAYRSNQDVHKVTAQLLFD--KGEITPEERSLGKTINFGVIYGMG 781

Query: 445 AKAFQKMASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACE 504
           A+ F + +  T                                                E
Sbjct: 782 AQKFARESKLT-----------------------------------------------VE 794

Query: 505 RVKKAWRQKHSRVSELWNELHQAFEQTIENG--KAIIARKRRDVPLVYMKKDKNNLILML 562
           + +K   + H R ++++  L  + +Q I  G  + I+ R+R      Y   D N L+  L
Sbjct: 795 QGRKFIEKYHQRYAQVFQYLENSKKQAIAQGYVETILGRRR------YFNFD-NPLLKRL 847

Query: 563 PSGRSLVYRDVGNNRSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGY 622
              R L   D+  +   LN    QL R            +Q  S DI+   M+   +   
Sbjct: 848 ---RGLSLHDIDLDSLKLNNEEAQLLRSAANAP------IQGSSADIIKVAMVKLAEVLQ 898

Query: 623 D----IVLTVHDEIVCETP 637
           +    ++L VHDE+V E P
Sbjct: 899 NYRARLLLQVHDELVLEVP 917


>gi|91777303|ref|YP_552511.1| DNA polymerase I [Burkholderia xenovorans LB400]
 gi|91689963|gb|ABE33161.1| DNA polymerase A [Burkholderia xenovorans LB400]
          Length = 913

 Score = 68.6 bits (166), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 37/95 (38%), Positives = 56/95 (58%), Gaps = 3/95 (3%)

Query: 364 VRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQ 423
           +R   IA  G KLV AD + IE R++A ++G++  L +F  GED++  T A  F+V P +
Sbjct: 674 IREAFIAPAGHKLVSADYSQIELRIMAHISGDESLLHSFSQGEDIHRATAAEIFSVTPLE 733

Query: 424 VTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLN 458
           V+ DQR + KV+   L Y  G  +F  +AS  G+ 
Sbjct: 734 VSNDQRRVAKVINFGLIY--GMSSF-GLASNLGIT 765


>gi|254253595|ref|ZP_04946912.1| DNA polymerase A [Burkholderia dolosa AUO158]
 gi|124898240|gb|EAY70083.1| DNA polymerase A [Burkholderia dolosa AUO158]
          Length = 248

 Score = 68.2 bits (165), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 55/94 (58%), Gaps = 3/94 (3%)

Query: 364 VRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQ 423
           +R   IA+ G ++V AD + IE R++A ++G+   L+AF  GED++  T A  F V P +
Sbjct: 9   IREAFIAAPGHRIVSADYSQIELRIMAHISGDASLLRAFSQGEDIHRATAAEVFGVTPLE 68

Query: 424 VTKDQRAIGKVMELALGYQGGAKAFQKMASTTGL 457
           V  DQR I KV+   L Y  G  AF  +AS  G+
Sbjct: 69  VNADQRRIAKVINFGLIY--GMSAF-GLASNLGI 99


>gi|149378378|ref|ZP_01896080.1| DNA polymerase I [Marinobacter algicola DG893]
 gi|149357343|gb|EDM45863.1| DNA polymerase I [Marinobacter algicola DG893]
          Length = 911

 Score = 68.2 bits (165), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 46/124 (37%), Positives = 63/124 (50%), Gaps = 9/124 (7%)

Query: 331 RPSRSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLVVADLAGI 384
           R  R H    Q +T      +S+P+ LQ I         +R   +A EG KLV AD + I
Sbjct: 633 RTGRIHTSYHQAVTATGRLSSSEPN-LQNIPIRSEQGRRIRQAFVAPEGYKLVAADYSQI 691

Query: 385 EARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGG 444
           E R++A ++G++  L AFE GED++  T A  F VA   V+ DQR   K +   L Y  G
Sbjct: 692 ELRIMAHLSGDKGLLTAFEKGEDIHRATAAEVFGVAVDDVSGDQRRSAKAINFGLIY--G 749

Query: 445 AKAF 448
             AF
Sbjct: 750 MSAF 753


>gi|225849884|ref|YP_002730118.1| DNA polymerase I [Persephonella marina EX-H1]
 gi|225644858|gb|ACO03044.1| DNA polymerase I [Persephonella marina EX-H1]
          Length = 584

 Score = 68.2 bits (165), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 112/444 (25%), Positives = 174/444 (39%), Gaps = 94/444 (21%)

Query: 44  LWDCVHDPVMPQVLKEALENTDVTIVAHNSYFERTVLKACFNL--DIPIHRWICTLVLAR 101
           ++D    P   + LKE LEN  V  + HN  F+   LK  F +   I     I + +L+ 
Sbjct: 59  VYDMFRIPQFSEHLKELLENKGV--IGHNLKFDIKFLKTNFGIFPQIVFDTMIASQLLSE 116

Query: 102 SNGLPSALKAVGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYC 161
            +    +L A+  + +L+   +++ ++      K  T E L                 Y 
Sbjct: 117 DSREKHSLSAL--SYRLTDNHLDKSQQRSPWGIKNLTEEQL----------------RYA 158

Query: 162 KGDVTVTREIF-------KRLE---PLSSKEQELWYLDQ--------------TINDRGY 197
             DV V REIF        R+E     + K  E + LD                I  RG 
Sbjct: 159 AKDVQVLREIFPVLRDELNRIETPHKATGKIHETFGLDNGVAVVEMAFVPQLADIELRGM 218

Query: 198 CVDVALAHTLNQIV--DVERTKLDQELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLT 255
            VD  L   + Q V  D +R  +D       YG+   S   +K+  WL  + GL L    
Sbjct: 219 PVDEKLLKDMLQKVSTDYQREYIDF---VRRYGVDPFSP--QKVTNWLTSKLGLKLP--- 270

Query: 256 ETTCQRVLSSNKKLTPQAIQVFNNR----MRASRSAVLKLNTLVEAMNSDGRLRGTLQFL 311
            TT +  LSS      + I     R    +R+ +  + KL  L +A   +GR+    + +
Sbjct: 271 -TTQKGSLSSQDSALRRYIDREEVRKLLHIRSEKKILDKLKEL-KAHLINGRIYTQFKQI 328

Query: 312 GASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITSDPDPLQIISDCVRSCVIAS 371
           GA  TGR +          RP+                       LQ I+  +R      
Sbjct: 329 GAP-TGRMASM--------RPN-----------------------LQNITRDLRVLFRPP 356

Query: 372 EGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAI 431
           EGKKL+VAD + IE R+ A    ++  +KAF  G+DL+  T +        Q+TKD+R +
Sbjct: 357 EGKKLIVADYSQIELRIAAEYVNDETMIKAFSEGKDLHRFTASLILGKEYDQITKDERQM 416

Query: 432 GKVMELALGYQGGAKAFQKMASTT 455
            K +   L Y    ++  + A  +
Sbjct: 417 AKAINFGLIYGISPRSLMEYARNS 440


>gi|83648986|ref|YP_437421.1| DNA polymerase I [Hahella chejuensis KCTC 2396]
 gi|83637029|gb|ABC32996.1| DNA polymerase I [Hahella chejuensis KCTC 2396]
          Length = 911

 Score = 67.8 bits (164), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 50/150 (33%), Positives = 72/150 (48%), Gaps = 9/150 (6%)

Query: 305 RGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITSDPDPLQII---- 360
           R  L++ G S+         P    PR  R H    Q +       +SDP+ LQ I    
Sbjct: 607 RVLLEYRGLSKLKSTYTDKLPEMINPRTGRVHTSYQQAVAATGRLSSSDPN-LQNIPVRN 665

Query: 361 --SDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFN 418
                +R   IA +G KL+ AD + IE R++A ++G++  LKAF  G D++  T A  FN
Sbjct: 666 EQGRRIRQAFIAPKGCKLISADYSQIELRIMAHLSGDEGLLKAFSEGLDVHQATAAEVFN 725

Query: 419 VAPAQVTKDQRAIGKVMELALGYQGGAKAF 448
           VA  +V+ +QR   K +   L Y  G  AF
Sbjct: 726 VAFDEVSSEQRRKAKAINFGLIY--GMSAF 753


>gi|237749335|ref|ZP_04579815.1| DNA polymerase I [Oxalobacter formigenes OXCC13]
 gi|229380697|gb|EEO30788.1| DNA polymerase I [Oxalobacter formigenes OXCC13]
          Length = 914

 Score = 67.8 bits (164), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 49/157 (31%), Positives = 75/157 (47%), Gaps = 10/157 (6%)

Query: 308 LQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITSDPDPLQII------S 361
           L + G S+         P    P   R H    Q +       ++DP+ LQ I       
Sbjct: 614 LDYRGMSKLKTTYTDKLPRMVNPETGRVHTNYAQAVAVTGRLASNDPN-LQNIPIRSEEG 672

Query: 362 DCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAP 421
             +R   IAS G K++ AD + IE R++A ++ +   LKAF  G+D++  T +  F++ P
Sbjct: 673 RRIREAFIASPGNKIISADYSQIELRIMAHLSDDASLLKAFHDGQDVHRATASEIFDITP 732

Query: 422 AQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLN 458
            +VT DQR   KV+   L Y  G  AF  +AS  G++
Sbjct: 733 LEVTSDQRRYAKVINFGLIY--GMSAF-GVASNLGIS 766


>gi|167842181|ref|ZP_02468865.1| DNA polymerase I [Burkholderia thailandensis MSMB43]
          Length = 926

 Score = 67.8 bits (164), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 47/135 (34%), Positives = 68/135 (50%), Gaps = 10/135 (7%)

Query: 330 PRPSRSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLVVADLAG 383
           P   R H    Q +       ++DP+ LQ I         +R   IA  G K+V AD + 
Sbjct: 648 PNTGRVHTNYAQAVAVTGRLASNDPN-LQNIPVRTAEGRRIREAFIAPPGSKIVSADYSQ 706

Query: 384 IEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQG 443
           IE R++A ++ ++  L+AF  GED++  T A  F V P +VT DQR I KV+   L Y  
Sbjct: 707 IELRIMAHISEDESLLRAFAHGEDIHRATAAEVFGVTPLEVTSDQRRIAKVINFGLIY-- 764

Query: 444 GAKAFQKMASTTGLN 458
           G  +F  +AS  G+ 
Sbjct: 765 GMSSF-GLASNLGIT 778


>gi|83716432|ref|YP_438805.1| DNA polymerase I [Burkholderia thailandensis E264]
 gi|257141887|ref|ZP_05590149.1| DNA polymerase I [Burkholderia thailandensis E264]
 gi|83650257|gb|ABC34321.1| DNA polymerase I [Burkholderia thailandensis E264]
          Length = 926

 Score = 67.8 bits (164), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 47/135 (34%), Positives = 68/135 (50%), Gaps = 10/135 (7%)

Query: 330 PRPSRSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLVVADLAG 383
           P   R H    Q +       ++DP+ LQ I         +R   IA  G K+V AD + 
Sbjct: 648 PNTGRVHTNYAQAVAVTGRLASNDPN-LQNIPVRTAEGRRIREAFIAPPGSKIVSADYSQ 706

Query: 384 IEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQG 443
           IE R++A ++ ++  L+AF  GED++  T A  F V P +VT DQR I KV+   L Y  
Sbjct: 707 IELRIMAHISEDESLLRAFAHGEDIHRATAAEVFGVTPLEVTSDQRRIAKVINFGLIY-- 764

Query: 444 GAKAFQKMASTTGLN 458
           G  +F  +AS  G+ 
Sbjct: 765 GMSSF-GLASNLGIT 778


>gi|167615322|ref|ZP_02383957.1| DNA polymerase I [Burkholderia thailandensis Bt4]
          Length = 926

 Score = 67.8 bits (164), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 47/135 (34%), Positives = 68/135 (50%), Gaps = 10/135 (7%)

Query: 330 PRPSRSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLVVADLAG 383
           P   R H    Q +       ++DP+ LQ I         +R   IA  G K+V AD + 
Sbjct: 648 PNTGRVHTNYAQAVAVTGRLASNDPN-LQNIPVRTAEGRRIREAFIAPPGSKIVSADYSQ 706

Query: 384 IEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQG 443
           IE R++A ++ ++  L+AF  GED++  T A  F V P +VT DQR I KV+   L Y  
Sbjct: 707 IELRIMAHISEDESLLRAFAHGEDIHRATAAEVFGVTPLEVTSDQRRIAKVINFGLIY-- 764

Query: 444 GAKAFQKMASTTGLN 458
           G  +F  +AS  G+ 
Sbjct: 765 GMSSF-GLASNLGIT 778


>gi|307823067|ref|ZP_07653297.1| DNA polymerase I [Methylobacter tundripaludum SV96]
 gi|307735842|gb|EFO06689.1| DNA polymerase I [Methylobacter tundripaludum SV96]
          Length = 930

 Score = 67.8 bits (164), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 46/136 (33%), Positives = 69/136 (50%), Gaps = 6/136 (4%)

Query: 364 VRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQ 423
           +R   IA EGKK+V AD + IE R++A ++ ++  LKAF   +D++  T A  F VAP Q
Sbjct: 691 IRQAFIAPEGKKIVAADYSQIELRIMAHLSADEGLLKAFSEEQDVHRATAAEVFGVAPEQ 750

Query: 424 VTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVKTNSAPEEWEDAENFCR 483
           VT D R   K +   L Y  G  +F  +A   GL+ +     +    A   +   +N+  
Sbjct: 751 VTTDLRRSAKAINFGLIY--GMSSF-GLAQQLGLSRSQAQSYIDLYFA--RYPGVKNYMD 805

Query: 484 WMQENHPEHA-IEDLF 498
            ++E   E   IE LF
Sbjct: 806 RIREQAREQGYIETLF 821


>gi|330821221|ref|YP_004350083.1| DNA polymerase I [Burkholderia gladioli BSR3]
 gi|327373216|gb|AEA64571.1| DNA polymerase I [Burkholderia gladioli BSR3]
          Length = 919

 Score = 67.4 bits (163), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 56/95 (58%), Gaps = 3/95 (3%)

Query: 364 VRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQ 423
           +R   IAS G ++V AD + IE R++A ++ ++  L+AF  GED++  T A  F V P +
Sbjct: 680 IREAFIASPGCRIVSADYSQIELRIMAHISEDESLLRAFSQGEDIHRATAAEVFGVTPLE 739

Query: 424 VTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLN 458
           V+ DQR I KV+   L Y  G  AF  +AS  G+ 
Sbjct: 740 VSNDQRRIAKVINFGLIY--GMSAF-GLASNLGIT 771


>gi|212702438|ref|ZP_03310566.1| hypothetical protein DESPIG_00455 [Desulfovibrio piger ATCC 29098]
 gi|212674099|gb|EEB34582.1| hypothetical protein DESPIG_00455 [Desulfovibrio piger ATCC 29098]
          Length = 919

 Score = 67.4 bits (163), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 81/291 (27%), Positives = 121/291 (41%), Gaps = 49/291 (16%)

Query: 170 EIFKRLEPLSSKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGL 229
           E+F+RLE        L  +   +   G  +D A        +D  + +LDQ L +  Y L
Sbjct: 512 ELFRRLE------MPLLPVLAGMEQSGVAIDAA---AFRAFLDDVQGQLDQ-LTAHVYEL 561

Query: 230 VSSS---RCLEKLKTWLFLETGLHLEDLTE----TTCQRVLSSNKKLTPQAIQVFNNR-M 281
             +    R  ++L   LF   GL     T+    +T Q+ L       P    +   R +
Sbjct: 562 AGTQFNIRSAQQLGDVLFNGLGLPAPRKTKGGQASTSQQTLEKLAGQHPVVDSILQYRKL 621

Query: 282 RASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQ 341
              RS  L  + L   ++  GR+  T     A+ TGR S              S+  L  
Sbjct: 622 EKMRSTYL--DPLPRLVDPQGRIHTTFN-QKATATGRLSS-------------SNPNLQN 665

Query: 342 IITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKA 401
           I    P            +   +RSC IA  G+ LV AD + +E RVLA ++ +   L+A
Sbjct: 666 IPVRGP------------LGKRMRSCFIAGPGRLLVSADYSQVELRVLAHVSQDPALLEA 713

Query: 402 FETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMA 452
           F  GED++  T A  +++ P QV+ DQR   K +   L Y  GA   QK+A
Sbjct: 714 FRNGEDIHARTAALVYDLPPDQVSPDQRRNAKTINFGLIYGMGA---QKLA 761


>gi|317121267|ref|YP_004101270.1| DNA polymerase I [Thermaerobacter marianensis DSM 12885]
 gi|315591247|gb|ADU50543.1| DNA polymerase I [Thermaerobacter marianensis DSM 12885]
          Length = 1060

 Score = 67.4 bits (163), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 69/237 (29%), Positives = 100/237 (42%), Gaps = 43/237 (18%)

Query: 216 TKLDQELESLTYGLVSSS---RCLEKLKTWLFLETGLHLEDLTET---TCQRVLSSNKKL 269
           T+  QEL    Y L   +      ++L   LF   GL +   T+T   T   VL +    
Sbjct: 688 TRRSQELAEQIYQLAGETFNINSTQQLGQILFERLGLPVVKKTKTGYSTDAEVLETLAAR 747

Query: 270 TPQAIQVFNNRMRASRSAVLKL-----NTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVF 324
            P A  V   R      +++KL     + L E +  DGR+  T Q   A+ TGR S    
Sbjct: 748 HPIAELVLEYR------SLVKLQGTYVDGLAEHIGPDGRVHTTFQQTVAA-TGRLSSTQP 800

Query: 325 PPQNLPRPSRSHEELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGI 384
             QN+P                   I  +P         +R   +A  G +LV AD + I
Sbjct: 801 NLQNIP-------------------IRDEP------GRSLRRAFVAPPGHRLVAADYSQI 835

Query: 385 EARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGY 441
           E RVLA  +G++  L+AF  G+D++  T +  F V   QVT +QR + K +   L Y
Sbjct: 836 ELRVLAHYSGDEGLLEAFARGQDVHARTASEIFGVPLEQVTPEQRRVAKAVNFGLAY 892


>gi|289450265|ref|YP_003475168.1| DNA-directed DNA polymerase [Clostridiales genomosp. BVAB3 str.
           UPII9-5]
 gi|289184812|gb|ADC91237.1| DNA-directed DNA polymerase [Clostridiales genomosp. BVAB3 str.
           UPII9-5]
          Length = 922

 Score = 67.4 bits (163), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 63/120 (52%), Gaps = 7/120 (5%)

Query: 334 RSHEELDQIITHLPTSITSDPDPLQIISDC-----VRSCVIASEGKKLVVADLAGIEARV 388
           R H    Q +T      +SDP+   I +       +R+  IA+ G  L+ AD + IE R+
Sbjct: 647 RIHTTFHQTLTQTGRLSSSDPNLQNIPARTEEGRRIRAAFIAAPGCILIDADYSQIELRL 706

Query: 389 LAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAF 448
           LA ++G+   LKAF   ED++  T AR F++ P  VT + R +GK +  ++ Y  G  AF
Sbjct: 707 LAHLSGDTAMLKAFAAKEDIHALTAARVFHMDPVDVTSEHRRVGKTINFSIVY--GISAF 764


>gi|309784631|ref|ZP_07679266.1| DNA polymerase domain protein [Shigella dysenteriae 1617]
 gi|308927528|gb|EFP73000.1| DNA polymerase domain protein [Shigella dysenteriae 1617]
          Length = 66

 Score = 67.4 bits (163), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 31/58 (53%), Positives = 41/58 (70%), Gaps = 5/58 (8%)

Query: 357 LQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFE-----TGEDLY 409
           +++ S  +R C+IA  GKKLVV+DL+ IE R+LAW+AGE+WKL AF      T  DLY
Sbjct: 1   MELTSSALRGCIIAPTGKKLVVSDLSNIEGRMLAWLAGEEWKLNAFREYDAGTDPDLY 58


>gi|167573600|ref|ZP_02366474.1| DNA polymerase I [Burkholderia oklahomensis C6786]
          Length = 923

 Score = 67.4 bits (163), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 47/135 (34%), Positives = 69/135 (51%), Gaps = 10/135 (7%)

Query: 330 PRPSRSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLVVADLAG 383
           P   R H    Q +       ++DP+ LQ I         +R   IA+ G K+V AD + 
Sbjct: 645 PNTGRVHTNYAQAVAVTGRLASNDPN-LQNIPVRTAEGRRIREAFIAAPGCKIVSADYSQ 703

Query: 384 IEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQG 443
           IE R++A ++ ++  L+AF  GED++  T A  F V P +VT DQR I KV+   L Y  
Sbjct: 704 IELRIMAHISEDESLLRAFAHGEDIHRATAAEVFGVTPLEVTSDQRRIAKVINFGLIY-- 761

Query: 444 GAKAFQKMASTTGLN 458
           G  +F  +AS  G+ 
Sbjct: 762 GMSSF-GLASNLGIT 775


>gi|167566520|ref|ZP_02359436.1| DNA polymerase I [Burkholderia oklahomensis EO147]
          Length = 923

 Score = 67.0 bits (162), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 47/135 (34%), Positives = 69/135 (51%), Gaps = 10/135 (7%)

Query: 330 PRPSRSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLVVADLAG 383
           P   R H    Q +       ++DP+ LQ I         +R   IA+ G K+V AD + 
Sbjct: 645 PNTGRVHTNYAQAVAVTGRLASNDPN-LQNIPVRTAEGRRIREAFIAAPGCKIVSADYSQ 703

Query: 384 IEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQG 443
           IE R++A ++ ++  L+AF  GED++  T A  F V P +VT DQR I KV+   L Y  
Sbjct: 704 IELRIMAHISEDESLLRAFAHGEDIHRATAAEVFGVTPLEVTSDQRRIAKVINFGLIY-- 761

Query: 444 GAKAFQKMASTTGLN 458
           G  +F  +AS  G+ 
Sbjct: 762 GMSSF-GLASNLGIT 775


>gi|220917745|ref|YP_002493049.1| DNA polymerase I [Anaeromyxobacter dehalogenans 2CP-1]
 gi|219955599|gb|ACL65983.1| DNA polymerase I [Anaeromyxobacter dehalogenans 2CP-1]
          Length = 897

 Score = 67.0 bits (162), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 50/149 (33%), Positives = 69/149 (46%), Gaps = 28/149 (18%)

Query: 300 SDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITSDPDPLQI 359
           +DGR+  T    GA+ TGR S      QN+P           + T L             
Sbjct: 620 ADGRIHTTFHQAGAA-TGRLSSSDPNLQNIP-----------VRTEL------------- 654

Query: 360 ISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNV 419
            S  +R   +A  G +L+ AD + IE R+LA  + +   L+AF   ED++  T A +F V
Sbjct: 655 -SRRIRQAFVAPAGARLLSADYSQIELRILAHYSDDPGLLQAFRDREDVHTRTAAETFGV 713

Query: 420 APAQVTKDQRAIGKVMELALGYQGGAKAF 448
            P QVT DQR I KV+   + Y  G  AF
Sbjct: 714 PPEQVTPDQRRIAKVLNFGIAY--GLSAF 740


>gi|269837619|ref|YP_003319847.1| DNA polymerase I [Sphaerobacter thermophilus DSM 20745]
 gi|269786882|gb|ACZ39025.1| DNA polymerase I [Sphaerobacter thermophilus DSM 20745]
          Length = 915

 Score = 67.0 bits (162), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 87/331 (26%), Positives = 140/331 (42%), Gaps = 68/331 (20%)

Query: 158 GEYCKGDVTVTREIFKRLEP-LSSKEQELWYLDQTINDRGYCVD---VALAHTLNQIVDV 213
           G+Y   DV  T  + + L+P L +++QE  + +  +      +D   V +A  ++ + D+
Sbjct: 473 GDYACADVEATYRLVEVLQPDLEAQQQERLFREIEMPLIDVLIDMEKVGIAVDVDLLRDL 532

Query: 214 ERTKLDQ--ELESLTYGL------VSSSRCLEKLKTWLFLETGLHLEDLTET---TCQRV 262
            R    Q  ELE   YGL      ++S+R   +L T LF E GL     T+T     Q V
Sbjct: 533 SRQLTGQLAELEREIYGLAKHEFNINSTR---QLATVLFDELGLPAGRRTKTGYSVSQEV 589

Query: 263 LSSNKKLTPQAIQVFNNRMRASRSAVLKL-NTLVEAMNSDGRLRGTLQFLGASRTGRWSG 321
           L + +   P    +   R       +LKL +T V+A+                       
Sbjct: 590 LENLRHAHPIVDCILEYRQ------LLKLKSTYVDAL----------------------- 620

Query: 322 CVFPPQNLPRPSRSHEELDQIITHLPTSITSDPDPLQI-----ISDCVRSCVIAS----- 371
              P Q  P   R H   +Q I       ++DP+   I     +   VR   IA      
Sbjct: 621 ---PEQVNPETGRIHTSFNQTIAATGRLSSTDPNLQNIPVRTELGRSVRRAFIADNRPGY 677

Query: 372 ----EGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKD 427
               E   L+ AD + IE R++A ++G++  + AF  G+D++  T A  F V   QVT D
Sbjct: 678 RPFDEEAVLLSADYSQIELRLMAHLSGDERLVHAFREGQDIHAATAADVFGVPLEQVTPD 737

Query: 428 QRAIGKVMELALGYQGGAKAFQKMASTTGLN 458
            R + K +   + Y  G +A+  +A  TG++
Sbjct: 738 MRRVAKTVNFGIMY--GMQAY-GLARDTGMS 765


>gi|167899173|ref|ZP_02486574.1| DNA polymerase I [Burkholderia pseudomallei 7894]
          Length = 625

 Score = 67.0 bits (162), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 37/95 (38%), Positives = 55/95 (57%), Gaps = 3/95 (3%)

Query: 364 VRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQ 423
           +R   +A  G K+V AD + IE R++A ++ ++  L+AF  GED++  T A  F V P +
Sbjct: 386 IREAFVAPPGSKIVSADYSQIELRIMAHISEDESLLRAFAHGEDIHRATAAEVFGVTPLE 445

Query: 424 VTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLN 458
           VT DQR I KV+   L Y  G  +F  +AS  G+ 
Sbjct: 446 VTSDQRRIAKVINFGLIY--GMSSF-GLASNLGIT 477


>gi|167829103|ref|ZP_02460574.1| DNA polymerase I [Burkholderia pseudomallei 9]
          Length = 923

 Score = 67.0 bits (162), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 37/95 (38%), Positives = 55/95 (57%), Gaps = 3/95 (3%)

Query: 364 VRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQ 423
           +R   +A  G K+V AD + IE R++A ++ ++  L+AF  GED++  T A  F V P +
Sbjct: 684 IREAFVAPPGSKIVSADYSQIELRIMAHISEDESLLRAFAHGEDIHRATAAEVFGVTPLE 743

Query: 424 VTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLN 458
           VT DQR I KV+   L Y  G  +F  +AS  G+ 
Sbjct: 744 VTSDQRRIAKVINFGLIY--GMSSF-GLASNLGIT 775


>gi|109896347|ref|YP_659602.1| DNA polymerase I [Pseudoalteromonas atlantica T6c]
 gi|109698628|gb|ABG38548.1| DNA polymerase I [Pseudoalteromonas atlantica T6c]
          Length = 928

 Score = 67.0 bits (162), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 45/125 (36%), Positives = 64/125 (51%), Gaps = 9/125 (7%)

Query: 330 PRPSRSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLVVADLAG 383
           PR  R H    Q IT      +++P+ LQ I         VR   IA  G K+V AD + 
Sbjct: 649 PRSGRVHTSYHQAITATGRLSSTEPN-LQNIPIRTEQGRRVRQAFIARPGYKIVAADYSQ 707

Query: 384 IEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQG 443
           IE R++A ++ ++  LKAF  G+D++  T A  FNV+  +VT +QR   K +   L Y  
Sbjct: 708 IELRIMAHLSQDEGLLKAFSQGKDIHTATAAEVFNVSLTEVTTEQRRNAKAINFGLIY-- 765

Query: 444 GAKAF 448
           G  AF
Sbjct: 766 GMSAF 770


>gi|268608093|ref|ZP_06141821.1| DNA polymerase I [Ruminococcus flavefaciens FD-1]
          Length = 845

 Score = 67.0 bits (162), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 67/271 (24%), Positives = 118/271 (43%), Gaps = 37/271 (13%)

Query: 191 TINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSSSRCL---EKLKTWLFLET 247
           ++ D G C+D          +    T++ +E + + Y     S  +   ++L T LF E 
Sbjct: 457 SMEDIGICIDKQGVEDFGTYL----TEMIEETQQMVYDDAGHSFNIASPKQLGTVLFEEM 512

Query: 248 GLHLEDLTET---TCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLNTLVEAMNSDGRL 304
           GL  +  T++   T   VL   +   P    V   R     ++   +  L++ +  DGR+
Sbjct: 513 GLPAKKKTKSGYSTNAEVLEELRNDAPIVDNVLKFRQYTKLNSTYVVG-LLDKIADDGRI 571

Query: 305 RGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITSDPDPLQIISDCV 364
               +    +RTGR S      QN+P           + T L   +              
Sbjct: 572 HTWFR-QTETRTGRISSTEPNMQNIP-----------VRTELGAQM-------------- 605

Query: 365 RSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQV 424
           R   +A +G+KLV AD + IE RV+A + G++  ++AF +GED++ +T A+ F++    V
Sbjct: 606 RKFFVAPKGRKLVDADYSQIELRVMAHLCGDKNMIEAFNSGEDIHTSTAAQVFDMPSIMV 665

Query: 425 TKDQRAIGKVMELALGYQGGAKAFQKMASTT 455
           T + R+  K +   + Y  GA +  K   T+
Sbjct: 666 TPEMRSAAKAVNFGIIYGIGAFSLAKDIGTS 696


>gi|167915856|ref|ZP_02502947.1| DNA polymerase I [Burkholderia pseudomallei 112]
          Length = 618

 Score = 67.0 bits (162), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 37/95 (38%), Positives = 55/95 (57%), Gaps = 3/95 (3%)

Query: 364 VRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQ 423
           +R   +A  G K+V AD + IE R++A ++ ++  L+AF  GED++  T A  F V P +
Sbjct: 379 IREAFVAPPGSKIVSADYSQIELRIMAHISEDESLLRAFAHGEDIHRATAAEVFGVTPLE 438

Query: 424 VTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLN 458
           VT DQR I KV+   L Y  G  +F  +AS  G+ 
Sbjct: 439 VTSDQRRIAKVINFGLIY--GMSSF-GLASNLGIT 470


>gi|126443368|ref|YP_001063539.1| DNA polymerase I [Burkholderia pseudomallei 668]
 gi|126222859|gb|ABN86364.1| DNA-directed DNA polymerase [Burkholderia pseudomallei 668]
          Length = 923

 Score = 67.0 bits (162), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 37/95 (38%), Positives = 55/95 (57%), Gaps = 3/95 (3%)

Query: 364 VRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQ 423
           +R   +A  G K+V AD + IE R++A ++ ++  L+AF  GED++  T A  F V P +
Sbjct: 684 IREAFVAPPGSKIVSADYSQIELRIMAHISEDESLLRAFAHGEDIHRATAAEVFGVTPLE 743

Query: 424 VTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLN 458
           VT DQR I KV+   L Y  G  +F  +AS  G+ 
Sbjct: 744 VTSDQRRIAKVINFGLIY--GMSSF-GLASNLGIT 775


>gi|237507804|ref|ZP_04520519.1| DNA polymerase I [Burkholderia pseudomallei MSHR346]
 gi|235000009|gb|EEP49433.1| DNA polymerase I [Burkholderia pseudomallei MSHR346]
          Length = 923

 Score = 67.0 bits (162), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 37/95 (38%), Positives = 55/95 (57%), Gaps = 3/95 (3%)

Query: 364 VRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQ 423
           +R   +A  G K+V AD + IE R++A ++ ++  L+AF  GED++  T A  F V P +
Sbjct: 684 IREAFVAPPGSKIVSADYSQIELRIMAHISEDESLLRAFAHGEDIHRATAAEVFGVTPLE 743

Query: 424 VTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLN 458
           VT DQR I KV+   L Y  G  +F  +AS  G+ 
Sbjct: 744 VTSDQRRIAKVINFGLIY--GMSSF-GLASNLGIT 775


>gi|254193866|ref|ZP_04900298.1| DNA polymerase I [Burkholderia pseudomallei S13]
 gi|169650617|gb|EDS83310.1| DNA polymerase I [Burkholderia pseudomallei S13]
          Length = 923

 Score = 67.0 bits (162), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 37/95 (38%), Positives = 55/95 (57%), Gaps = 3/95 (3%)

Query: 364 VRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQ 423
           +R   +A  G K+V AD + IE R++A ++ ++  L+AF  GED++  T A  F V P +
Sbjct: 684 IREAFVAPPGSKIVSADYSQIELRIMAHISEDESLLRAFAHGEDIHRATAAEVFGVTPLE 743

Query: 424 VTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLN 458
           VT DQR I KV+   L Y  G  +F  +AS  G+ 
Sbjct: 744 VTSDQRRIAKVINFGLIY--GMSSF-GLASNLGIT 775


>gi|167724604|ref|ZP_02407840.1| DNA polymerase I [Burkholderia pseudomallei DM98]
          Length = 620

 Score = 67.0 bits (162), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 37/95 (38%), Positives = 55/95 (57%), Gaps = 3/95 (3%)

Query: 364 VRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQ 423
           +R   +A  G K+V AD + IE R++A ++ ++  L+AF  GED++  T A  F V P +
Sbjct: 381 IREAFVAPPGSKIVSADYSQIELRIMAHISEDESLLRAFAHGEDIHRATAAEVFGVTPLE 440

Query: 424 VTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLN 458
           VT DQR I KV+   L Y  G  +F  +AS  G+ 
Sbjct: 441 VTSDQRRIAKVINFGLIY--GMSSF-GLASNLGIT 472


>gi|167743555|ref|ZP_02416329.1| DNA polymerase I [Burkholderia pseudomallei 14]
          Length = 619

 Score = 67.0 bits (162), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 37/95 (38%), Positives = 55/95 (57%), Gaps = 3/95 (3%)

Query: 364 VRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQ 423
           +R   +A  G K+V AD + IE R++A ++ ++  L+AF  GED++  T A  F V P +
Sbjct: 380 IREAFVAPPGSKIVSADYSQIELRIMAHISEDESLLRAFAHGEDIHRATAAEVFGVTPLE 439

Query: 424 VTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLN 458
           VT DQR I KV+   L Y  G  +F  +AS  G+ 
Sbjct: 440 VTSDQRRIAKVINFGLIY--GMSSF-GLASNLGIT 471


>gi|226195875|ref|ZP_03791462.1| DNA polymerase I [Burkholderia pseudomallei Pakistan 9]
 gi|225932360|gb|EEH28360.1| DNA polymerase I [Burkholderia pseudomallei Pakistan 9]
          Length = 876

 Score = 67.0 bits (162), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 37/95 (38%), Positives = 55/95 (57%), Gaps = 3/95 (3%)

Query: 364 VRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQ 423
           +R   +A  G K+V AD + IE R++A ++ ++  L+AF  GED++  T A  F V P +
Sbjct: 637 IREAFVAPPGSKIVSADYSQIELRIMAHISEDESLLRAFAHGEDIHRATAAEVFGVTPLE 696

Query: 424 VTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLN 458
           VT DQR I KV+   L Y  G  +F  +AS  G+ 
Sbjct: 697 VTSDQRRIAKVINFGLIY--GMSSF-GLASNLGIT 728


>gi|167850580|ref|ZP_02476088.1| DNA polymerase I [Burkholderia pseudomallei B7210]
          Length = 622

 Score = 67.0 bits (162), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 37/95 (38%), Positives = 55/95 (57%), Gaps = 3/95 (3%)

Query: 364 VRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQ 423
           +R   +A  G K+V AD + IE R++A ++ ++  L+AF  GED++  T A  F V P +
Sbjct: 383 IREAFVAPPGSKIVSADYSQIELRIMAHISEDESLLRAFAHGEDIHRATAAEVFGVTPLE 442

Query: 424 VTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLN 458
           VT DQR I KV+   L Y  G  +F  +AS  G+ 
Sbjct: 443 VTSDQRRIAKVINFGLIY--GMSSF-GLASNLGIT 474


>gi|254301196|ref|ZP_04968640.1| DNA polymerase I [Burkholderia pseudomallei 406e]
 gi|157811158|gb|EDO88328.1| DNA polymerase I [Burkholderia pseudomallei 406e]
          Length = 923

 Score = 67.0 bits (162), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 37/95 (38%), Positives = 55/95 (57%), Gaps = 3/95 (3%)

Query: 364 VRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQ 423
           +R   +A  G K+V AD + IE R++A ++ ++  L+AF  GED++  T A  F V P +
Sbjct: 684 IREAFVAPPGSKIVSADYSQIELRIMAHISEDESLLRAFAHGEDIHRATAAEVFGVTPLE 743

Query: 424 VTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLN 458
           VT DQR I KV+   L Y  G  +F  +AS  G+ 
Sbjct: 744 VTSDQRRIAKVINFGLIY--GMSSF-GLASNLGIT 775


>gi|167820743|ref|ZP_02452423.1| DNA polymerase I [Burkholderia pseudomallei 91]
          Length = 622

 Score = 67.0 bits (162), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 37/95 (38%), Positives = 55/95 (57%), Gaps = 3/95 (3%)

Query: 364 VRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQ 423
           +R   +A  G K+V AD + IE R++A ++ ++  L+AF  GED++  T A  F V P +
Sbjct: 383 IREAFVAPPGSKIVSADYSQIELRIMAHISEDESLLRAFAHGEDIHRATAAEVFGVTPLE 442

Query: 424 VTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLN 458
           VT DQR I KV+   L Y  G  +F  +AS  G+ 
Sbjct: 443 VTSDQRRIAKVINFGLIY--GMSSF-GLASNLGIT 474


>gi|126456399|ref|YP_001076435.1| DNA polymerase I [Burkholderia pseudomallei 1106a]
 gi|242312260|ref|ZP_04811277.1| DNA polymerase I [Burkholderia pseudomallei 1106b]
 gi|126230167|gb|ABN93580.1| DNA polymerase I [Burkholderia pseudomallei 1106a]
 gi|242135499|gb|EES21902.1| DNA polymerase I [Burkholderia pseudomallei 1106b]
          Length = 923

 Score = 67.0 bits (162), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 37/95 (38%), Positives = 55/95 (57%), Gaps = 3/95 (3%)

Query: 364 VRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQ 423
           +R   +A  G K+V AD + IE R++A ++ ++  L+AF  GED++  T A  F V P +
Sbjct: 684 IREAFVAPPGSKIVSADYSQIELRIMAHISEDESLLRAFAHGEDIHRATAAEVFGVTPLE 743

Query: 424 VTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLN 458
           VT DQR I KV+   L Y  G  +F  +AS  G+ 
Sbjct: 744 VTSDQRRIAKVINFGLIY--GMSSF-GLASNLGIT 775


>gi|53722791|ref|YP_111776.1| DNA polymerase I [Burkholderia pseudomallei K96243]
 gi|134278161|ref|ZP_01764875.1| DNA polymerase I [Burkholderia pseudomallei 305]
 gi|52213205|emb|CAH39245.1| DNA polymerase I [Burkholderia pseudomallei K96243]
 gi|134249945|gb|EBA50025.1| DNA polymerase I [Burkholderia pseudomallei 305]
          Length = 923

 Score = 66.6 bits (161), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 37/95 (38%), Positives = 55/95 (57%), Gaps = 3/95 (3%)

Query: 364 VRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQ 423
           +R   +A  G K+V AD + IE R++A ++ ++  L+AF  GED++  T A  F V P +
Sbjct: 684 IREAFVAPPGSKIVSADYSQIELRIMAHISEDESLLRAFAHGEDIHRATAAEVFGVTPLE 743

Query: 424 VTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLN 458
           VT DQR I KV+   L Y  G  +F  +AS  G+ 
Sbjct: 744 VTSDQRRIAKVINFGLIY--GMSSF-GLASNLGIT 775


>gi|167923694|ref|ZP_02510785.1| DNA polymerase I [Burkholderia pseudomallei BCC215]
          Length = 923

 Score = 66.6 bits (161), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 37/95 (38%), Positives = 55/95 (57%), Gaps = 3/95 (3%)

Query: 364 VRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQ 423
           +R   +A  G K+V AD + IE R++A ++ ++  L+AF  GED++  T A  F V P +
Sbjct: 684 IREAFVAPPGSKIVSADYSQIELRIMAHISEDESLLRAFAHGEDIHRATAAEVFGVTPLE 743

Query: 424 VTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLN 458
           VT DQR I KV+   L Y  G  +F  +AS  G+ 
Sbjct: 744 VTSDQRRIAKVINFGLIY--GMSSF-GLASNLGIT 775


>gi|219850431|ref|YP_002464864.1| DNA polymerase I [Chloroflexus aggregans DSM 9485]
 gi|219544690|gb|ACL26428.1| DNA polymerase I [Chloroflexus aggregans DSM 9485]
          Length = 936

 Score = 66.6 bits (161), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 43/125 (34%), Positives = 66/125 (52%), Gaps = 9/125 (7%)

Query: 330 PRPSRSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLVVADLAG 383
           PR  R H   +QI        +++P+ LQ I         +R   +A+ G + V AD + 
Sbjct: 657 PRTGRIHTSYNQIGAATGRLSSNNPN-LQNIPVRTEEGREIRRAFVAAPGHRFVAADYSQ 715

Query: 384 IEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQG 443
           IE RVLA ++G++  + AF+ G D++  T +R F VAP QV K+QR + K +   + Y  
Sbjct: 716 IELRVLAHISGDENLIAAFQQGLDIHAATASRLFGVAPDQVDKNQRRVAKTVVFGVIY-- 773

Query: 444 GAKAF 448
           G  AF
Sbjct: 774 GISAF 778


>gi|76818134|ref|YP_336009.1| DNA polymerase I [Burkholderia pseudomallei 1710b]
 gi|254186142|ref|ZP_04892660.1| DNA polymerase I [Burkholderia pseudomallei Pasteur 52237]
 gi|254264752|ref|ZP_04955617.1| DNA polymerase I [Burkholderia pseudomallei 1710a]
 gi|76582607|gb|ABA52081.1| DNA polymerase I [Burkholderia pseudomallei 1710b]
 gi|157933828|gb|EDO89498.1| DNA polymerase I [Burkholderia pseudomallei Pasteur 52237]
 gi|254215754|gb|EET05139.1| DNA polymerase I [Burkholderia pseudomallei 1710a]
          Length = 923

 Score = 66.6 bits (161), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 37/95 (38%), Positives = 55/95 (57%), Gaps = 3/95 (3%)

Query: 364 VRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQ 423
           +R   +A  G K+V AD + IE R++A ++ ++  L+AF  GED++  T A  F V P +
Sbjct: 684 IREAFVAPPGSKIVSADYSQIELRIMAHISEDESLLRAFAHGEDIHRATAAEVFGVTPLE 743

Query: 424 VTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLN 458
           VT DQR I KV+   L Y  G  +F  +AS  G+ 
Sbjct: 744 VTSDQRRIAKVINFGLIY--GMSSF-GLASNLGIT 775


>gi|167907515|ref|ZP_02494720.1| DNA polymerase I [Burkholderia pseudomallei NCTC 13177]
 gi|217422462|ref|ZP_03453965.1| DNA-directed DNA polymerase [Burkholderia pseudomallei 576]
 gi|254184913|ref|ZP_04891502.1| DNA polymerase I [Burkholderia pseudomallei 1655]
 gi|184215505|gb|EDU12486.1| DNA polymerase I [Burkholderia pseudomallei 1655]
 gi|217394693|gb|EEC34712.1| DNA-directed DNA polymerase [Burkholderia pseudomallei 576]
          Length = 923

 Score = 66.6 bits (161), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 37/95 (38%), Positives = 55/95 (57%), Gaps = 3/95 (3%)

Query: 364 VRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQ 423
           +R   +A  G K+V AD + IE R++A ++ ++  L+AF  GED++  T A  F V P +
Sbjct: 684 IREAFVAPPGSKIVSADYSQIELRIMAHISEDESLLRAFAHGEDIHRATAAEVFGVTPLE 743

Query: 424 VTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLN 458
           VT DQR I KV+   L Y  G  +F  +AS  G+ 
Sbjct: 744 VTSDQRRIAKVINFGLIY--GMSSF-GLASNLGIT 775


>gi|53716619|ref|YP_105127.1| DNA polymerase I [Burkholderia mallei ATCC 23344]
 gi|121597404|ref|YP_991095.1| DNA polymerase I [Burkholderia mallei SAVP1]
 gi|124381759|ref|YP_001025495.1| DNA polymerase I [Burkholderia mallei NCTC 10229]
 gi|126446346|ref|YP_001077557.1| DNA polymerase I [Burkholderia mallei NCTC 10247]
 gi|167000295|ref|ZP_02266114.1| DNA polymerase I [Burkholderia mallei PRL-20]
 gi|238561508|ref|ZP_00441953.2| DNA polymerase I [Burkholderia mallei GB8 horse 4]
 gi|254177233|ref|ZP_04883889.1| DNA polymerase I [Burkholderia mallei ATCC 10399]
 gi|254203066|ref|ZP_04909428.1| DNA polymerase I [Burkholderia mallei FMH]
 gi|254208399|ref|ZP_04914748.1| DNA polymerase I [Burkholderia mallei JHU]
 gi|254359414|ref|ZP_04975686.1| DNA polymerase I [Burkholderia mallei 2002721280]
 gi|52422589|gb|AAU46159.1| DNA polymerase I [Burkholderia mallei ATCC 23344]
 gi|121225202|gb|ABM48733.1| DNA polymerase I [Burkholderia mallei SAVP1]
 gi|126239200|gb|ABO02312.1| DNA-directed DNA polymerase [Burkholderia mallei NCTC 10247]
 gi|147746111|gb|EDK53189.1| DNA polymerase I [Burkholderia mallei FMH]
 gi|147751086|gb|EDK58154.1| DNA polymerase I [Burkholderia mallei JHU]
 gi|148028601|gb|EDK86561.1| DNA polymerase I [Burkholderia mallei 2002721280]
 gi|160698273|gb|EDP88243.1| DNA polymerase I [Burkholderia mallei ATCC 10399]
 gi|238524488|gb|EEP87921.1| DNA polymerase I [Burkholderia mallei GB8 horse 4]
 gi|243063777|gb|EES45963.1| DNA polymerase I [Burkholderia mallei PRL-20]
 gi|261826488|gb|ABN00542.2| DNA-directed DNA polymerase [Burkholderia mallei NCTC 10229]
          Length = 926

 Score = 66.6 bits (161), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 37/95 (38%), Positives = 55/95 (57%), Gaps = 3/95 (3%)

Query: 364 VRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQ 423
           +R   +A  G K+V AD + IE R++A ++ ++  L+AF  GED++  T A  F V P +
Sbjct: 687 IREAFVAPPGSKIVSADYSQIELRIMAHISEDESLLRAFAHGEDIHRATAAEVFGVTPLE 746

Query: 424 VTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLN 458
           VT DQR I KV+   L Y  G  +F  +AS  G+ 
Sbjct: 747 VTSDQRRIAKVINFGLIY--GMSSF-GLASNLGIT 778


>gi|166364552|ref|YP_001656825.1| DNA polymerase I [Microcystis aeruginosa NIES-843]
 gi|166086925|dbj|BAG01633.1| DNA polymerase I [Microcystis aeruginosa NIES-843]
          Length = 956

 Score = 66.6 bits (161), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 74/319 (23%), Positives = 127/319 (39%), Gaps = 76/319 (23%)

Query: 330 PRPSRSHEELDQIITHLPTSITSDPDPLQI-----ISDCVRSCVIASEGKKLVVADLAGI 384
           P+ +R H + +Q IT      +S+P+   I      S  +R   I   G  LV AD + I
Sbjct: 664 PKTARVHTDFNQTITSTGRLSSSNPNLQNIPIRSEFSRRIRQAFIPENGYLLVSADYSQI 723

Query: 385 EARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGG 444
           E R+LA ++ E   L+A+ + +D++  T    F+    ++T ++R++GK +   + Y  G
Sbjct: 724 ELRILAHLSQEPVLLEAYRSNQDVHKVTAQLLFD--KREITPEERSLGKTINFGVIYGMG 781

Query: 445 AKAFQKMASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACE 504
           A+ F + +  T                                                E
Sbjct: 782 AQKFARESKLT-----------------------------------------------VE 794

Query: 505 RVKKAWRQKHSRVSELWNELHQAFEQTIENG--KAIIARKRRDVPLVYMKKDKNNLILML 562
           + +K   + H R ++++  L  + +Q I  G  + I+ R+R      Y   D N L+  L
Sbjct: 795 QGRKFIEKYHQRYAQVFEYLENSKKQAITQGYVETILGRRR------YFNFD-NPLLKRL 847

Query: 563 PSGRSLVYRDVGNNRSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKAGY 622
              R L   D+  +   LN    QL R            +Q  S DI+   M+   +   
Sbjct: 848 ---RGLSLHDIDLDSLKLNNEEAQLLRSAANAP------IQGSSADIIKVAMVKLAEVLQ 898

Query: 623 D----IVLTVHDEIVCETP 637
           +    ++L VHDE+V E P
Sbjct: 899 NYRARLLLQVHDELVLEVP 917


>gi|284009397|emb|CBA76584.1| phage DNA polymerase [Arsenophonus nasoniae]
          Length = 92

 Score = 66.2 bits (160), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 32/88 (36%), Positives = 50/88 (56%), Gaps = 2/88 (2%)

Query: 4  LFIDFETRSPIDLTKCGICKYAEDVCVILFAFGFDDHPVELWDCVHDPVMPQVLKEALEN 63
          LF D ET S I +  CG  +YAE+  ++LFA+ ++   V++WD   D  MP  LK   + 
Sbjct: 5  LFCDLETYSDIPIN-CGTHRYAENAEILLFAYAYNHGSVKVWDVTEDKTMPTDLKSYFDA 63

Query: 64 TDVTIVAHN-SYFERTVLKACFNLDIPI 90
           ++  V HN   F+  +LK   N+D+P+
Sbjct: 64 PEILTVWHNGGMFDTVILKHVLNIDLPL 91


>gi|219815950|gb|ACL37074.1| DNA polymerase I [uncultured bacterium]
          Length = 803

 Score = 65.9 bits (159), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 68/274 (24%), Positives = 117/274 (42%), Gaps = 34/274 (12%)

Query: 182 EQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSSSRCLEKLKT 241
           EQ L  + Q IN  G  +D A    L+  +  E T L+ ++ +   G   +    +++  
Sbjct: 394 EQPLMEVLQHINATGITLDTAYLAGLSVTMHTELTALEGKIYTHA-GREFNINSPKQMGE 452

Query: 242 WLFLETGLHLEDLTET------TCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLNTLV 295
            LF E GL  ++  +T      T +  L   ++  P   ++   R    +     ++ L 
Sbjct: 453 VLFDEMGLKPKNQKKTAGGQRSTKESELEKMREDHPIITEILRYR-ELQKLVSTYIDNLP 511

Query: 296 EAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITSDPD 355
             +++DGRLR T    GA+ TGR +      QN+P   R+ E                  
Sbjct: 512 PLVSADGRLRTTFVQTGAA-TGRMASQNPNLQNIP--IRTEE------------------ 550

Query: 356 PLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYAR 415
                S  +R   +AS G  +V  D + IE R+ A ++ ++  ++ F  GED++     R
Sbjct: 551 -----SKAIRQAFVASPGYSIVSIDYSQIELRIAAILSRDEKMVEIFARGEDVHTGVAVR 605

Query: 416 SFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQ 449
            F V P +VT++ R   KV+   + Y  G  A +
Sbjct: 606 VFGVTPEEVTREMRRKAKVINFGILYGMGVNALR 639


>gi|254492177|ref|ZP_05105351.1| DNA polymerase I superfamily [Methylophaga thiooxidans DMS010]
 gi|224462502|gb|EEF78777.1| DNA polymerase I superfamily [Methylophaga thiooxydans DMS010]
          Length = 894

 Score = 65.9 bits (159), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 46/149 (30%), Positives = 69/149 (46%), Gaps = 7/149 (4%)

Query: 308 LQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITSDPDPLQII------S 361
           +Q+ G S+         P Q      R H    Q +T      +SDP+ LQ I       
Sbjct: 594 MQYRGLSKLKSTYTDKLPLQVNKSSGRVHTSYHQAVTATGRLSSSDPN-LQNIPIRSENG 652

Query: 362 DCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAP 421
             +R   +AS G  L+ AD + IE R++A ++G++  LKAF  GED++  T +  F++A 
Sbjct: 653 RRIREAFVASNGYTLLAADYSQIELRIMAHLSGDESLLKAFAAGEDIHRHTASEIFDIAL 712

Query: 422 AQVTKDQRAIGKVMELALGYQGGAKAFQK 450
             V+ DQR   K +   L Y   A    K
Sbjct: 713 EDVSSDQRRSAKAINFGLIYGMSAHGLSK 741


>gi|227499957|ref|ZP_03930050.1| possible DNA-directed DNA polymerase I [Anaerococcus tetradius ATCC
           35098]
 gi|227218066|gb|EEI83339.1| possible DNA-directed DNA polymerase I [Anaerococcus tetradius ATCC
           35098]
          Length = 880

 Score = 65.9 bits (159), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 45/148 (30%), Positives = 72/148 (48%), Gaps = 26/148 (17%)

Query: 294 LVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITSD 353
           L +A++ DGR+R T +    + TGR S      QNLP                   I +D
Sbjct: 597 LEKAIDDDGRIRSTFR-QNIAATGRLSSQDPNLQNLP-------------------IKTD 636

Query: 354 PDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTY 413
              L      +R    A +GK L+ AD + IE R+LA ++G++  ++AF  GED++  T 
Sbjct: 637 EGRL------IRKAFKAGQGKILIDADYSQIELRILASLSGDEHMIEAFRNGEDIHAKTA 690

Query: 414 ARSFNVAPAQVTKDQRAIGKVMELALGY 441
           ++ F+    +VTK QR+  K +   + Y
Sbjct: 691 SKVFHTPLDEVTKRQRSDAKAVNFGIIY 718


>gi|120553478|ref|YP_957829.1| DNA polymerase I [Marinobacter aquaeolei VT8]
 gi|120323327|gb|ABM17642.1| DNA polymerase I [Marinobacter aquaeolei VT8]
          Length = 908

 Score = 65.9 bits (159), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 45/124 (36%), Positives = 63/124 (50%), Gaps = 9/124 (7%)

Query: 331 RPSRSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLVVADLAGI 384
           R  R H    Q +T      +S+P+ LQ I         +R   IA +G KL+ AD + I
Sbjct: 630 RTGRVHTSYHQAVTATGRLSSSEPN-LQNIPIRTQEGRRIRQAFIAPKGYKLLAADYSQI 688

Query: 385 EARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGG 444
           E R++A ++G++  L AFE GED++  T A  F V   +VT DQR   K +   L Y  G
Sbjct: 689 ELRIMAHLSGDRGLLTAFEHGEDIHKATAAEVFGVTVDEVTGDQRRSAKAINFGLIY--G 746

Query: 445 AKAF 448
             AF
Sbjct: 747 MSAF 750


>gi|258406522|ref|YP_003199264.1| DNA polymerase I [Desulfohalobium retbaense DSM 5692]
 gi|257798749|gb|ACV69686.1| DNA polymerase I [Desulfohalobium retbaense DSM 5692]
          Length = 845

 Score = 65.9 bits (159), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 45/140 (32%), Positives = 68/140 (48%), Gaps = 8/140 (5%)

Query: 326 PQNLPRPSRSHEELDQIITHLPTSITSDPDPLQI-----ISDCVRSCVIASEGKKLVVAD 380
           PQ +   SR H   +Q+ T      +S P+   I         +R C +A EG +LV AD
Sbjct: 563 PQKVDDTSRLHTHFNQLATATGRLSSSGPNLQNIPIRGEFGPRMRQCFVAPEGSRLVAAD 622

Query: 381 LAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALG 440
            + IE RVLA ++ +   L+AF  GED++  T A   ++A   V  + R   K +   L 
Sbjct: 623 YSQIELRVLAHLSQDPTLLEAFTQGEDIHSRTAAVIMDIADEHVDSEARRQAKTINFGLL 682

Query: 441 YQGGAKAFQKMASTTGLNLN 460
           Y  G    QK++   G++LN
Sbjct: 683 YGMGP---QKLSRELGISLN 699


>gi|329897110|ref|ZP_08271855.1| DNA polymerase I [gamma proteobacterium IMCC3088]
 gi|328921434|gb|EGG28823.1| DNA polymerase I [gamma proteobacterium IMCC3088]
          Length = 908

 Score = 65.9 bits (159), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 43/124 (34%), Positives = 61/124 (49%), Gaps = 7/124 (5%)

Query: 330 PRPSRSHEELDQIITHLPTSITSDPD----PLQIISD-CVRSCVIASEGKKLVVADLAGI 384
           PR  R H    Q +T      +SDP+    P++ +    +R   IA E   +V AD + I
Sbjct: 630 PRTGRIHTSYHQAVTATGRLSSSDPNLQNIPIRSVEGRAIRKAFIAPENHVIVAADYSQI 689

Query: 385 EARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGG 444
           E R++A ++G+   L AF  G D++  T A  F VA  +VT DQR   K +   L Y  G
Sbjct: 690 ELRIMAHLSGDAGLLTAFNEGLDVHAATAAEVFGVALDEVTSDQRRSAKAINFGLIY--G 747

Query: 445 AKAF 448
             AF
Sbjct: 748 MSAF 751


>gi|226942232|ref|YP_002797305.1| DNA polymerase I [Azotobacter vinelandii DJ]
 gi|226717159|gb|ACO76330.1| DNA polymerase I [Azotobacter vinelandii DJ]
          Length = 908

 Score = 65.5 bits (158), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 47/131 (35%), Positives = 62/131 (47%), Gaps = 9/131 (6%)

Query: 324 FPPQNLPRPSRSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLV 377
            P Q  PR  R H    Q +T      +SDP+ LQ I         +R   +A EG +LV
Sbjct: 624 LPQQINPRTGRIHTSYHQAVTATGRLSSSDPN-LQNIPIRTTEGRRIRQAFVAPEGYRLV 682

Query: 378 VADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMEL 437
            AD + IE R++A +A +   L AF    D++  T A  F VAP  V+ DQR   K +  
Sbjct: 683 AADYSQIELRIMAHLAQDTSLLHAFRNDLDVHRATAAEVFGVAPEAVSADQRRSAKAINF 742

Query: 438 ALGYQGGAKAF 448
            L Y  G  AF
Sbjct: 743 GLIY--GMSAF 751


>gi|154498262|ref|ZP_02036640.1| hypothetical protein BACCAP_02250 [Bacteroides capillosus ATCC
           29799]
 gi|150272809|gb|EDM99977.1| hypothetical protein BACCAP_02250 [Bacteroides capillosus ATCC
           29799]
          Length = 889

 Score = 65.1 bits (157), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 73/260 (28%), Positives = 109/260 (41%), Gaps = 41/260 (15%)

Query: 196 GYCVDVALAHTLNQIVDVERTKLDQ----ELESLTYGLVSSSRCLEKLKTWLFLETGLHL 251
           G  VD         ++D ER   DQ    EL   T+ + S+    ++L   LF + GL  
Sbjct: 506 GMLVDRKALSEFGDMLD-ERIAADQAEIYELAGETFNINST----QQLGKILFDKLGLPP 560

Query: 252 EDLTET---TCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLNTLVEAMNSDGRLRGTL 308
              T+T   T   VL   +   P   ++   R      +   ++ L + +  DGR+  + 
Sbjct: 561 VKKTKTGYSTNAEVLEKLRGQHPIIDKILEYRQYTKLKSTY-VDGLGKVIAPDGRIHTSF 619

Query: 309 QFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITSDPDPLQIISDCVRSCV 368
           Q    + TGR S      QN+P  +    EL                         R   
Sbjct: 620 QNT-VTATGRLSSTEPNLQNIPVRTELGAEL-------------------------RKMF 653

Query: 369 IASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQ 428
           +A  GK LV AD + IE R+LA +AG++  ++AF TGED++  T A+ F V   QVTK  
Sbjct: 654 VAPAGKVLVDADYSQIELRLLAHIAGDEHMIEAFRTGEDIHTVTAAQVFGVPVDQVTKHM 713

Query: 429 RAIGKVMELALGYQGGAKAF 448
           R+  K +   + Y  G  AF
Sbjct: 714 RSSAKAVNFGIVY--GISAF 731


>gi|313902130|ref|ZP_07835540.1| DNA polymerase I [Thermaerobacter subterraneus DSM 13965]
 gi|313467593|gb|EFR63097.1| DNA polymerase I [Thermaerobacter subterraneus DSM 13965]
          Length = 1072

 Score = 65.1 bits (157), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 66/232 (28%), Positives = 95/232 (40%), Gaps = 33/232 (14%)

Query: 216 TKLDQELESLTYGLVSSS---RCLEKLKTWLFLETGLHLEDLTET---TCQRVLSSNKKL 269
           T+  QEL    Y L   +      ++L   LF   GL +   T+T   T   VL +    
Sbjct: 700 TRRSQELAEQIYELAGQTFNINSTQQLGQILFERLGLPVVKKTKTGYSTDAEVLETLAAR 759

Query: 270 TPQAIQVFNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNL 329
            P A  V   R          ++ L E +  DGR+  T Q   A+ TGR S      QN+
Sbjct: 760 HPIAELVLEYRSLVKLQGTY-VDGLAEHIGPDGRIHTTFQQTVAA-TGRLSSTQPNLQNI 817

Query: 330 PRPSRSHEELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVL 389
           P                   I  +P         +R   +A  G +LV AD + IE RVL
Sbjct: 818 P-------------------IRDEP------GRSLRRAFVAPPGHRLVAADYSQIELRVL 852

Query: 390 AWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGY 441
           A  +G+   ++AF  G+D++  T +  F V   QVT +QR + K +   L Y
Sbjct: 853 AHYSGDPGLVEAFAQGQDVHARTASEIFGVPLEQVTPEQRRVAKAVNFGLAY 904


>gi|242280423|ref|YP_002992552.1| DNA polymerase I [Desulfovibrio salexigens DSM 2638]
 gi|242123317|gb|ACS81013.1| DNA polymerase I [Desulfovibrio salexigens DSM 2638]
          Length = 904

 Score = 65.1 bits (157), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 52/170 (30%), Positives = 76/170 (44%), Gaps = 29/170 (17%)

Query: 291 LNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSI 350
           L  L + +N++GR+      L A+ TGR S      QN+P                   I
Sbjct: 618 LEPLPKLVNANGRIHTNFNQL-ATATGRLSSSGPNLQNIP-------------------I 657

Query: 351 TSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYV 410
             D          +R+C  A EG +L  AD + +E RVLA  +G+   + AFE  ED++ 
Sbjct: 658 RGDQ------GKRMRACFTAGEGLRLAAADYSQVELRVLAHFSGDPALVSAFEHDEDIHS 711

Query: 411 TTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLN 460
            T A  F+  PA VT D+R   K +   L Y  G    QK++   G+ +N
Sbjct: 712 RTAALLFDRDPADVTSDERRNAKTINFGLIYGMGP---QKLSRELGIKIN 758


>gi|167771297|ref|ZP_02443350.1| hypothetical protein ANACOL_02655 [Anaerotruncus colihominis DSM
           17241]
 gi|167666548|gb|EDS10678.1| hypothetical protein ANACOL_02655 [Anaerotruncus colihominis DSM
           17241]
          Length = 874

 Score = 64.7 bits (156), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 66/252 (26%), Positives = 110/252 (43%), Gaps = 32/252 (12%)

Query: 237 EKLKTWLFLETGLHLEDLTET---TCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLNT 293
           ++L   LF++ GL  +  T+T   T   VL + +   P   ++   R + S+     ++ 
Sbjct: 532 KQLGDVLFVKLGLPAKKKTKTGYSTNVDVLEALRPQHPIIGEILEYR-KLSKLKSTYVDG 590

Query: 294 LVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITSD 353
           L++ +  DGR+R T Q    +RTGR S      QN+P  +     + +  T  P      
Sbjct: 591 LLKVVGPDGRVRSTFQQT-ETRTGRISSTEPNLQNIPIRTEEGSRMRRFFTARP------ 643

Query: 354 PDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTY 413
                              G KLV AD + IE RVLA +A +Q  + AF++GED++ TT 
Sbjct: 644 -------------------GWKLVDADYSQIELRVLADLADDQNMIAAFQSGEDIHATTA 684

Query: 414 ARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTF--AHLVKTNSA 471
           A+ F +    VT   R+  K +   + Y  GA +  +    T    +++  ++L      
Sbjct: 685 AQVFGMPGGTVTPLMRSRAKAVNFGIVYGIGAFSLSQDIGVTVSEADSYIKSYLAHYAGV 744

Query: 472 PEEWEDAENFCR 483
            +  ED   F R
Sbjct: 745 RKYMEDTIAFAR 756


>gi|9858145|gb|AAG01015.1|AF288383_1 DNA polymerase I [Burkholderia pseudomallei]
          Length = 615

 Score = 64.7 bits (156), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 67/135 (49%), Gaps = 10/135 (7%)

Query: 330 PRPSRSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLVVADLAG 383
           P   R H    Q +       ++DP+ LQ I         +R   +A  G K+V AD + 
Sbjct: 337 PDTGRVHTNYAQAVAVTGRLASNDPN-LQNIPVRTAEGRRIREAFVAPPGSKIVSADYSQ 395

Query: 384 IEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQG 443
           IE R++  ++ ++  L+AF  GED++  T A  F V P +VT DQR I KV+   L Y  
Sbjct: 396 IELRIMLHISEDESLLRAFAHGEDIHRATAAEVFGVTPLEVTSDQRRIAKVINFGLIY-- 453

Query: 444 GAKAFQKMASTTGLN 458
           G  +F  +AS  G+ 
Sbjct: 454 GMSSF-GLASNLGIT 467


>gi|253987782|ref|YP_003039138.1| DNA polymerase I [Photorhabdus asymbiotica subsp. asymbiotica ATCC
           43949]
 gi|211638660|emb|CAR67279.1| dna polymerase I polA [Photorhabdus asymbiotica subsp. asymbiotica
           ATCC 43949]
 gi|253779232|emb|CAQ82392.1| dna polymerase I polA [Photorhabdus asymbiotica]
          Length = 929

 Score = 64.7 bits (156), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 46/130 (35%), Positives = 66/130 (50%), Gaps = 10/130 (7%)

Query: 326 PQNL-PRPSRSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLVV 378
           PQ + P   R H    Q +T      + DP+ LQ I         +R   IASEG +++ 
Sbjct: 646 PQMVHPLTKRVHTSYHQAVTATGRLSSRDPN-LQNIPVRNEEGRRIRQAFIASEGYRIMA 704

Query: 379 ADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELA 438
           AD + IE R++A ++ +Q  LKAF  G+D++  T A  F+V   QVT +QR   K +   
Sbjct: 705 ADYSQIELRIMAHLSQDQGLLKAFAEGQDIHRATAAEVFDVPLEQVTSEQRRSAKAINFG 764

Query: 439 LGYQGGAKAF 448
           L Y  G  AF
Sbjct: 765 LIY--GMSAF 772


>gi|322417979|ref|YP_004197202.1| DNA polymerase I [Geobacter sp. M18]
 gi|320124366|gb|ADW11926.1| DNA polymerase I [Geobacter sp. M18]
          Length = 892

 Score = 64.3 bits (155), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 43/127 (33%), Positives = 64/127 (50%), Gaps = 7/127 (5%)

Query: 330 PRPSRSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLVVADLAG 383
           P+  R H   +Q IT+     +SDP+ LQ I         +R   IA  G  ++ AD + 
Sbjct: 614 PKTGRVHTSYNQAITNTGRLSSSDPN-LQNIPVRGEEGRGIRRAFIAEPGSLILSADYSQ 672

Query: 384 IEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQG 443
           IE RVLA ++G++   +AF  GED++  T A  F + P  VT + R   KV+   + Y  
Sbjct: 673 IELRVLAHLSGDRVLCEAFAAGEDIHRRTAAEVFGMFPELVTAEMRRQAKVINFGVIYGQ 732

Query: 444 GAKAFQK 450
           GA +  K
Sbjct: 733 GAFSLAK 739


>gi|261378116|ref|ZP_05982689.1| DNA polymerase I [Neisseria cinerea ATCC 14685]
 gi|269145571|gb|EEZ71989.1| DNA polymerase I [Neisseria cinerea ATCC 14685]
          Length = 930

 Score = 64.3 bits (155), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 42/145 (28%), Positives = 66/145 (45%), Gaps = 7/145 (4%)

Query: 324 FPPQNLPRPSRSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLV 377
            P    P+  R H    Q +       +++P+ LQ I         VR    A +G  +V
Sbjct: 644 LPEMIFPKDGRVHTTYAQAVAITGRLASNNPN-LQNIPIRTAEGRRVRRAFTAPQGSVIV 702

Query: 378 VADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMEL 437
            AD + IE R++A ++G++  + AF+ GED++  T A  F +AP  V+ +QR   K +  
Sbjct: 703 SADYSQIELRIMAHLSGDKTLIAAFQNGEDVHRRTAAEVFGIAPENVSPEQRRYAKTINF 762

Query: 438 ALGYQGGAKAFQKMASTTGLNLNTF 462
            L Y  G     K      L+  TF
Sbjct: 763 GLIYGMGQYGLAKSLGIDNLSAKTF 787


>gi|331006814|ref|ZP_08330074.1| DNA polymerase I [gamma proteobacterium IMCC1989]
 gi|330419366|gb|EGG93772.1| DNA polymerase I [gamma proteobacterium IMCC1989]
          Length = 782

 Score = 63.9 bits (154), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 46/141 (32%), Positives = 72/141 (51%), Gaps = 9/141 (6%)

Query: 326 PQNL-PRPSRSHEELDQIITHLPTSITSDPDPLQI-ISDC----VRSCVIASEGKKLVVA 379
           PQ + P   R H    Q +T      +SDP+   I I +     +R   +A +G K++ A
Sbjct: 493 PQMINPATGRIHTSYHQAVTATGRLSSSDPNLQNIPIRNAEGRRIRQAFVAPKGYKILAA 552

Query: 380 DLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELAL 439
           D + IE R++A ++G++  L+AF  G+D++  T A  F V   QVT++QR   K +   L
Sbjct: 553 DYSQIELRIMAHLSGDEGLLEAFNQGKDVHSATAAEVFGVELDQVTQEQRRRAKAINFGL 612

Query: 440 GYQGGAKAFQKMASTTGLNLN 460
            Y  G  AF  +A   G+  N
Sbjct: 613 IY--GMSAF-GLAKQLGVGRN 630


>gi|313679946|ref|YP_004057685.1| DNA polymerase I [Oceanithermus profundus DSM 14977]
 gi|313152661|gb|ADR36512.1| DNA polymerase I [Oceanithermus profundus DSM 14977]
          Length = 839

 Score = 63.9 bits (154), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 78/289 (26%), Positives = 123/289 (42%), Gaps = 47/289 (16%)

Query: 169 REIFKRLEPLSSKEQELWYLDQTIND-----------RGYCVDVALAHTLNQIVDVERTK 217
           RE+  RLE     E+ LW+L + +             RG  +DV     L+Q +  E  +
Sbjct: 422 REMSDRLE----GEERLWWLYREVERPLQGVLAAMERRGVKLDVDYLLALSQELAAELER 477

Query: 218 LDQELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVF 277
           L+ E+  L  G   +    ++L+T L+ E GL     T  T +R  S++   T       
Sbjct: 478 LEAEIHRLA-GHPFNLNSRDQLETVLYDELGLAAGRRTAKTGKRSTSASVLET------- 529

Query: 278 NNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHE 337
              +R +   V K+    E      +L+GT  +L             P    PR  R H 
Sbjct: 530 ---LRGAHPIVEKILQYREL----AKLKGT--YLDP----------LPKLVHPRTGRLHT 570

Query: 338 ELDQIITHLPTSITSDPD----PLQI-ISDCVRSCVIASEGKKLVVADLAGIEARVLAWM 392
              Q  T      +SDP+    P++  I   +R   +A EG  LVVAD + IE RVLA +
Sbjct: 571 RFHQTGTATGRLSSSDPNLQNIPIRTEIGRRIRKGFVAGEGYLLVVADYSQIELRVLAHL 630

Query: 393 AGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGY 441
           +G++  ++ F+ G D++  T A  F V   +V   +R   K +   + Y
Sbjct: 631 SGDENLIRIFQEGRDIHTQTAAWMFGVEDVEVDPFRRRAAKTINFGVLY 679


>gi|210623711|ref|ZP_03293995.1| hypothetical protein CLOHIR_01946 [Clostridium hiranonis DSM 13275]
 gi|210153399|gb|EEA84405.1| hypothetical protein CLOHIR_01946 [Clostridium hiranonis DSM 13275]
          Length = 891

 Score = 63.9 bits (154), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 37/117 (31%), Positives = 66/117 (56%), Gaps = 5/117 (4%)

Query: 330 PRPSRSHEELDQIITHLPTSITSDPD----PLQI-ISDCVRSCVIASEGKKLVVADLAGI 384
           P   R H   +Q IT      +++P+    P+++ I   +R+  ++ + K+LV AD + +
Sbjct: 613 PIDGRIHSTFNQTITTTGRISSTEPNLQNIPVRMEIGRRLRAVFVSDDEKRLVDADYSQV 672

Query: 385 EARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGY 441
           E RVLA M+G+Q  + AF+ GED++  T ++ FNV   +VT + R+  K +   + Y
Sbjct: 673 ELRVLAHMSGDQNMIDAFKHGEDIHRKTASQVFNVPVEEVTSELRSAAKAVNFGIIY 729


>gi|190149819|ref|YP_001968344.1| DNA polymerase I (POL I) [Actinobacillus pleuropneumoniae serovar 7
           str. AP76]
 gi|307263139|ref|ZP_07544760.1| hypothetical protein appser13_5610 [Actinobacillus pleuropneumoniae
           serovar 13 str. N273]
 gi|189914950|gb|ACE61202.1| DNA polymerase I (POL I) [Actinobacillus pleuropneumoniae serovar 7
           str. AP76]
 gi|306871501|gb|EFN03224.1| hypothetical protein appser13_5610 [Actinobacillus pleuropneumoniae
           serovar 13 str. N273]
          Length = 957

 Score = 63.9 bits (154), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 40/118 (33%), Positives = 61/118 (51%), Gaps = 7/118 (5%)

Query: 330 PRPSRSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLVVADLAG 383
           P+  R H    Q +T      +SDP+ LQ I         +R   IA++G K+V AD + 
Sbjct: 680 PKTGRVHTSYHQAVTATGRLSSSDPN-LQNIPIRNEEGRRIRQAFIANKGYKIVAADYSQ 738

Query: 384 IEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGY 441
           IE R++A +A ++  + AF  G+D++  T A  F +A  QVT +QR   K +   L Y
Sbjct: 739 IELRIMAHLANDEGMITAFAEGKDIHRATAAEIFGLALDQVTSEQRRSAKAINFGLIY 796


>gi|303250265|ref|ZP_07336465.1| DNA polymerase I [Actinobacillus pleuropneumoniae serovar 6 str.
           Femo]
 gi|307252030|ref|ZP_07533930.1| hypothetical protein appser6_5490 [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|302650881|gb|EFL81037.1| DNA polymerase I [Actinobacillus pleuropneumoniae serovar 6 str.
           Femo]
 gi|306860499|gb|EFM92512.1| hypothetical protein appser6_5490 [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
          Length = 957

 Score = 63.9 bits (154), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 40/118 (33%), Positives = 61/118 (51%), Gaps = 7/118 (5%)

Query: 330 PRPSRSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLVVADLAG 383
           P+  R H    Q +T      +SDP+ LQ I         +R   IA++G K+V AD + 
Sbjct: 680 PKTGRVHTSYHQAVTATGRLSSSDPN-LQNIPIRNEEGRRIRQAFIANKGYKIVAADYSQ 738

Query: 384 IEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGY 441
           IE R++A +A ++  + AF  G+D++  T A  F +A  QVT +QR   K +   L Y
Sbjct: 739 IELRIMAHLANDEGMITAFAEGKDIHRATAAEIFGLALDQVTSEQRRSAKAINFGLIY 796


>gi|171057747|ref|YP_001790096.1| DNA polymerase I [Leptothrix cholodnii SP-6]
 gi|170775192|gb|ACB33331.1| DNA polymerase I [Leptothrix cholodnii SP-6]
          Length = 934

 Score = 63.9 bits (154), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 35/82 (42%), Positives = 48/82 (58%)

Query: 364 VRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQ 423
           VR   +A+ G KLV AD + IE R++A ++G+   LKAF  G D++  T A  FN+A A 
Sbjct: 695 VREAFVAAPGHKLVSADYSQIELRLMAHISGDANLLKAFADGMDVHRATAAEVFNIAAAD 754

Query: 424 VTKDQRAIGKVMELALGYQGGA 445
           VT +QR   K +   L Y  GA
Sbjct: 755 VTSEQRRYAKTINFGLIYGMGA 776


>gi|303252143|ref|ZP_07338311.1| DNA polymerase I [Actinobacillus pleuropneumoniae serovar 2 str.
           4226]
 gi|307247479|ref|ZP_07529524.1| hypothetical protein appser2_4750 [Actinobacillus pleuropneumoniae
           serovar 2 str. S1536]
 gi|302648926|gb|EFL79114.1| DNA polymerase I [Actinobacillus pleuropneumoniae serovar 2 str.
           4226]
 gi|306855982|gb|EFM88140.1| hypothetical protein appser2_4750 [Actinobacillus pleuropneumoniae
           serovar 2 str. S1536]
          Length = 957

 Score = 63.9 bits (154), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 40/118 (33%), Positives = 61/118 (51%), Gaps = 7/118 (5%)

Query: 330 PRPSRSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLVVADLAG 383
           P+  R H    Q +T      +SDP+ LQ I         +R   IA++G K+V AD + 
Sbjct: 680 PKTGRVHTSYHQAVTATGRLSSSDPN-LQNIPIRNEEGRRIRQAFIANKGYKIVAADYSQ 738

Query: 384 IEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGY 441
           IE R++A +A ++  + AF  G+D++  T A  F +A  QVT +QR   K +   L Y
Sbjct: 739 IELRIMAHLANDEGMITAFAEGKDIHRATAAEIFGLALDQVTSEQRRSAKAINFGLIY 796


>gi|91217029|ref|ZP_01253992.1| DNA polymerase I [Psychroflexus torquis ATCC 700755]
 gi|91184900|gb|EAS71280.1| DNA polymerase I [Psychroflexus torquis ATCC 700755]
          Length = 942

 Score = 63.9 bits (154), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 46/152 (30%), Positives = 76/152 (50%), Gaps = 11/152 (7%)

Query: 324 FPPQNLPRPSRSHEELDQIITHLPTSITSDPDPLQIIS-------DCVRSCVIASEGKKL 376
            P Q  PR  R H E  Q +       +++P+ LQ I        +  ++ V   E   L
Sbjct: 657 LPKQIHPRTKRVHTEFMQTVAATGRLSSNNPN-LQNIPIRTERGREVRKAFVPRDENYVL 715

Query: 377 VVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVME 436
           + AD + IE R++A ++ E+  + AF+ GED++ +T AR F V   +VT+ QR+  K + 
Sbjct: 716 LAADYSQIELRIIAALSQEKTMMNAFKNGEDIHASTAARVFGVDIEEVTRAQRSNAKTVN 775

Query: 437 LALGYQGGAKAFQKMASTTGLNLNTFAHLVKT 468
             + Y  G  AF  +++ T L  N    L++T
Sbjct: 776 FGIIY--GVSAF-GLSNQTDLTRNESKELIET 804


>gi|307260958|ref|ZP_07542640.1| hypothetical protein appser12_5250 [Actinobacillus pleuropneumoniae
           serovar 12 str. 1096]
 gi|306869260|gb|EFN01055.1| hypothetical protein appser12_5250 [Actinobacillus pleuropneumoniae
           serovar 12 str. 1096]
          Length = 957

 Score = 63.9 bits (154), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 40/118 (33%), Positives = 61/118 (51%), Gaps = 7/118 (5%)

Query: 330 PRPSRSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLVVADLAG 383
           P+  R H    Q +T      +SDP+ LQ I         +R   IA++G K+V AD + 
Sbjct: 680 PKTGRVHTSYHQAVTATGRLSSSDPN-LQNIPIRNEEGRRIRQAFIANKGYKIVAADYSQ 738

Query: 384 IEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGY 441
           IE R++A +A ++  + AF  G+D++  T A  F +A  QVT +QR   K +   L Y
Sbjct: 739 IELRIMAHLANDEGMITAFAEGKDIHRATAAEIFGLALDQVTSEQRRSAKAINFGLIY 796


>gi|284031021|ref|YP_003380952.1| DNA polymerase I [Kribbella flavida DSM 17836]
 gi|283810314|gb|ADB32153.1| DNA polymerase I [Kribbella flavida DSM 17836]
          Length = 901

 Score = 63.9 bits (154), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 40/119 (33%), Positives = 63/119 (52%), Gaps = 8/119 (6%)

Query: 330 PRPSRSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEG-KKLVVADLA 382
           PR +R H   +Q I       ++DP+ LQ I         +R   +  EG + L+ AD +
Sbjct: 621 PRDARIHTTFNQTIAATGRLSSTDPN-LQNIPIRTEEGRRIREAFVVGEGYESLMSADYS 679

Query: 383 GIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGY 441
            IE R++A ++ ++  + AF +GED +  T AR F+V P +VT++ RA  K M   L Y
Sbjct: 680 QIEMRIMAHVSEDEGLIDAFNSGEDFHSVTAARVFSVQPGEVTQEMRAKIKAMNYGLAY 738


>gi|283458187|ref|YP_003362804.1| DNA polymerase I [Rothia mucilaginosa DY-18]
 gi|283134219|dbj|BAI64984.1| DNA polymerase I [Rothia mucilaginosa DY-18]
          Length = 1003

 Score = 63.9 bits (154), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 70/276 (25%), Positives = 115/276 (41%), Gaps = 35/276 (12%)

Query: 182 EQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSSS-------- 233
           E  L Y+   +   G  V  AL   L+        +  +   ++  G V++         
Sbjct: 584 ELPLLYVLADMEQAGIAVSDALLTELHDTFSARANQAQESARAIIGGEVATEDGEEPLNL 643

Query: 234 RCLEKLKTWLFLETGL----HLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVL 289
             +++L+T LF   GL     ++    T  + V     K++P++         A+    +
Sbjct: 644 ASVKQLQTVLFETLGLPHTRKIKSGYSTDAESVTELLSKISPESDGAAFLGALAAYRDNI 703

Query: 290 KLNTLVE----AMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITH 345
           KL   VE    A   DGR+  T Q  GA+ TGR S      QN+P   R+ E        
Sbjct: 704 KLAQTVEGLQKAATEDGRVHTTFQ-QGAASTGRLSSTAPNLQNIP--IRTEEG-----RR 755

Query: 346 LPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETG 405
           +  +    P+P+  +           E + L+ AD + IE R++  +A ++  + A+E G
Sbjct: 756 IRGAFIVAPEPIDGV-----------EYEGLLTADYSQIEMRIMVHLAADEKLIAAYEAG 804

Query: 406 EDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGY 441
           EDL+    +  F VAP  VT +QR+  K M   L Y
Sbjct: 805 EDLHRYVGSEVFGVAPEDVTPEQRSKVKAMSYGLAY 840


>gi|145640968|ref|ZP_01796550.1| DNA polymerase I [Haemophilus influenzae R3021]
 gi|145274482|gb|EDK14346.1| DNA polymerase I [Haemophilus influenzae 22.4-21]
          Length = 314

 Score = 63.9 bits (154), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 42/121 (34%), Positives = 62/121 (51%), Gaps = 9/121 (7%)

Query: 334 RSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLVVADLAGIEAR 387
           R H    Q +T      +SDP+ LQ I         +R   IA EG  +V AD + IE R
Sbjct: 41  RVHTSYHQAVTATGRLSSSDPN-LQNIPIRNEEGRRIRQAFIAREGYSIVAADYSQIELR 99

Query: 388 VLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKA 447
           ++A ++G+Q  + AF  G+D++ +T A  F V+  +VT +QR   K +   L Y  G  A
Sbjct: 100 IMAHLSGDQGLINAFSQGKDIHRSTAAEIFGVSLDEVTSEQRRNAKAINFGLIY--GMSA 157

Query: 448 F 448
           F
Sbjct: 158 F 158


>gi|71905805|ref|YP_283392.1| DNA polymerase A [Dechloromonas aromatica RCB]
 gi|71845426|gb|AAZ44922.1| DNA polymerase A [Dechloromonas aromatica RCB]
          Length = 906

 Score = 63.5 bits (153), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 45/134 (33%), Positives = 64/134 (47%), Gaps = 10/134 (7%)

Query: 330 PRPSRSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLVVADLAG 383
           P+  R H    Q         +SDP+ LQ I         +R+  IA  G  +V AD + 
Sbjct: 628 PQTGRVHTHFSQAAVVTGRLASSDPN-LQNIPVRSEEGRKIRTAFIAPAGSSIVSADYSQ 686

Query: 384 IEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQG 443
           IE R++A ++G++  L AF  GED++  T    F V P +V  DQR + K +   L Y  
Sbjct: 687 IELRIMAHLSGDERLLDAFAHGEDVHKATAGEIFGVTPLEVGPDQRRVAKSINFGLIY-- 744

Query: 444 GAKAFQKMASTTGL 457
           G  AF  +A   GL
Sbjct: 745 GMSAF-GLARQLGL 757


>gi|319775212|ref|YP_004137700.1| DNA polymerase I [Haemophilus influenzae F3047]
 gi|317449803|emb|CBY86011.1| DNA polymerase I [Haemophilus influenzae F3047]
          Length = 610

 Score = 63.5 bits (153), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 42/121 (34%), Positives = 62/121 (51%), Gaps = 9/121 (7%)

Query: 334 RSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLVVADLAGIEAR 387
           R H    Q +T      +SDP+ LQ I         +R   IA EG  +V AD + IE R
Sbjct: 337 RVHTSYHQAVTATGRLSSSDPN-LQNIPIRNEEGRRIRQAFIAREGYSIVAADYSQIELR 395

Query: 388 VLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKA 447
           ++A ++G+Q  + AF  G+D++ +T A  F V+  +VT +QR   K +   L Y  G  A
Sbjct: 396 IMAHLSGDQGLINAFSQGKDIHRSTAAEIFGVSLDEVTSEQRRNAKAINFGLIY--GMSA 453

Query: 448 F 448
           F
Sbjct: 454 F 454


>gi|261366357|ref|ZP_05979240.1| DNA polymerase I [Subdoligranulum variabile DSM 15176]
 gi|282571960|gb|EFB77495.1| DNA polymerase I [Subdoligranulum variabile DSM 15176]
          Length = 837

 Score = 63.5 bits (153), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 69/260 (26%), Positives = 112/260 (43%), Gaps = 35/260 (13%)

Query: 196 GYCVDVALAHTLNQIVDVERTKLDQELESL--TYGLVSSSRCLEKLKTWLFLETGLHLED 253
           G+ VD   A  +    D  R +LD  L+S+    G   +    ++L   LF + GL    
Sbjct: 455 GFAVD---ADGIRAFGDSLRGELDGILQSIYEEVGYEFNVNSPKQLGEALFDKLGLPPRK 511

Query: 254 LTE---TTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQF 310
            T    +T    L S +  +P   Q+   R  A   +   +  L+ A  +DGR+  T   
Sbjct: 512 KTSRGYSTDAATLESLRPYSPVIDQILKYRTYAKLLSTY-VEGLLSAQAADGRVHSTF-I 569

Query: 311 LGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITSDPDPLQIISDCVRSCVIA 370
              +RTGR S      QN+P           I T L + +              R   +A
Sbjct: 570 QTEARTGRISSTEPNLQNIP-----------IRTELGSRL--------------RGFFVA 604

Query: 371 SEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRA 430
             GK+LV AD + IE R+LA + G++   +AF  G D++ +T A+ +++  ++VT   R+
Sbjct: 605 GAGKELVDADYSQIELRILAHITGDEAMQQAFLHGADIHRSTAAKIYHIPESEVTPQLRS 664

Query: 431 IGKVMELALGYQGGAKAFQK 450
             K +   + Y  GA +  K
Sbjct: 665 ASKAINFGIMYGKGAFSLSK 684


>gi|319941599|ref|ZP_08015924.1| DNA polymerase I [Sutterella wadsworthensis 3_1_45B]
 gi|319804901|gb|EFW01747.1| DNA polymerase I [Sutterella wadsworthensis 3_1_45B]
          Length = 952

 Score = 63.2 bits (152), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 83/314 (26%), Positives = 133/314 (42%), Gaps = 41/314 (13%)

Query: 196 GYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSSSRCLEKLKTWLFLETGLHL---- 251
           G  VD +L    ++ + VE  +L +E  +   G   +    ++L   LF E GL +    
Sbjct: 569 GITVDASLLAQESKELGVEVEQLVEEAHA-AAGHPFNLSSPKQLAQILFAEQGLPVVKKT 627

Query: 252 EDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFL 311
              T +T + VLS      P    +  +R R ++     L+ L   ++ DGR+  T    
Sbjct: 628 ASGTPSTDEEVLSELALNYPLPKIILEHR-RLTKLKSTYLDKLPTLIDRDGRIHTTFG-Q 685

Query: 312 GASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITSDPDPLQIISDCVRSCVIAS 371
             + TGR S      QN+P                    T  P+  +I     R+   A 
Sbjct: 686 AVAVTGRLSSMDPNLQNIP--------------------TRTPEGRRI-----RTAFTAR 720

Query: 372 EGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAI 431
            G  ++ AD + +E R++A ++ +   L AF  GED++ +T A  F+    QVT DQR +
Sbjct: 721 RGWSVIDADYSQVELRIMAHLSQDAGLLSAFSRGEDIHRSTAAEVFHTPLDQVTPDQRRM 780

Query: 432 GKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPE 491
            KV+   L Y  G  AF  +A   GL+    A  V      E +       R+M++   +
Sbjct: 781 AKVINFGLIY--GMSAF-GLAQQMGLDRQVAAAYVD-----EYFHKFPGVKRYMEKTRAQ 832

Query: 492 HAIEDLFIGTACER 505
            A ED ++ TA  R
Sbjct: 833 -AAEDGYVETAFGR 845


>gi|268592231|ref|ZP_06126452.1| DNA polymerase I [Providencia rettgeri DSM 1131]
 gi|291312280|gb|EFE52733.1| DNA polymerase I [Providencia rettgeri DSM 1131]
          Length = 930

 Score = 63.2 bits (152), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 44/125 (35%), Positives = 61/125 (48%), Gaps = 9/125 (7%)

Query: 330 PRPSRSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLVVADLAG 383
           PR  R H    Q +T      + DP+ LQ I         +R   IA EG K++ AD + 
Sbjct: 652 PRTQRVHTSYHQAVTATGRLSSRDPN-LQNIPVRTEEGRRIRQAFIAREGYKVMAADYSQ 710

Query: 384 IEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQG 443
           IE R++A ++ ++  L AF  G+D++  T A  F V   QVT DQR   K +   L Y  
Sbjct: 711 IELRIMAHLSQDKGLLTAFAEGKDIHKATAAEVFGVPLEQVTSDQRRSAKAINFGLIY-- 768

Query: 444 GAKAF 448
           G  AF
Sbjct: 769 GMSAF 773


>gi|298241730|ref|ZP_06965537.1| DNA-directed DNA polymerase [Ktedonobacter racemifer DSM 44963]
 gi|297554784|gb|EFH88648.1| DNA-directed DNA polymerase [Ktedonobacter racemifer DSM 44963]
          Length = 531

 Score = 63.2 bits (152), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 56/199 (28%), Positives = 88/199 (44%), Gaps = 38/199 (19%)

Query: 294 LVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITSD 353
           L+  +++DGRLR     +GA+ +GR   C  P             L QI          +
Sbjct: 235 LLAMVDTDGRLRTDYAQIGAA-SGRII-CSKP------------NLQQIPAEEEEEGQEE 280

Query: 354 PDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTY 413
           P         VR C +A  G +++ ADL+ IE R+LA ++ +Q  L+ F  G+DL+  T 
Sbjct: 281 P---------VRHCFVAPPGYRILKADLSNIELRILAEVSRDQTMLRLFAEGKDLHAETA 331

Query: 414 ARSFNVAPAQVTKDQ-------RAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLV 466
              F+++P   TK         R I K +   L Y  GA     +A+  G++L T   L+
Sbjct: 332 KLMFHLSPETDTKRHLYKGVPGRKIAKTINFGLAYGMGANG---LANRAGVDLPTAKSLI 388

Query: 467 KTNSAPEEWEDAENFCRWM 485
           +T      +E      RW+
Sbjct: 389 RTY-----FETYRGIARWL 402


>gi|145630606|ref|ZP_01786386.1| DNA polymerase I [Haemophilus influenzae R3021]
 gi|144983996|gb|EDJ91438.1| DNA polymerase I [Haemophilus influenzae R3021]
          Length = 743

 Score = 63.2 bits (152), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 42/121 (34%), Positives = 62/121 (51%), Gaps = 9/121 (7%)

Query: 334 RSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLVVADLAGIEAR 387
           R H    Q +T      +SDP+ LQ I         +R   IA EG  +V AD + IE R
Sbjct: 470 RVHTSYHQAVTATGRLSSSDPN-LQNIPIRNEEGRRIRQAFIAREGYSIVAADYSQIELR 528

Query: 388 VLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKA 447
           ++A ++G+Q  + AF  G+D++ +T A  F V+  +VT +QR   K +   L Y  G  A
Sbjct: 529 IMAHLSGDQGLINAFSQGKDIHRSTAAEIFGVSLDEVTSEQRRNAKAINFGLIY--GMSA 586

Query: 448 F 448
           F
Sbjct: 587 F 587


>gi|16272796|ref|NP_439016.1| DNA polymerase I [Haemophilus influenzae Rd KW20]
 gi|260579947|ref|ZP_05847777.1| DNA-directed DNA polymerase I [Haemophilus influenzae RdAW]
 gi|1169402|sp|P43741|DPO1_HAEIN RecName: Full=DNA polymerase I; Short=POL I
 gi|1573871|gb|AAC22515.1| DNA polymerase I (polA) [Haemophilus influenzae Rd KW20]
 gi|260093231|gb|EEW77164.1| DNA-directed DNA polymerase I [Haemophilus influenzae RdAW]
          Length = 930

 Score = 63.2 bits (152), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 42/121 (34%), Positives = 62/121 (51%), Gaps = 9/121 (7%)

Query: 334 RSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLVVADLAGIEAR 387
           R H    Q +T      +SDP+ LQ I         +R   IA EG  +V AD + IE R
Sbjct: 657 RVHTSYHQAVTATGRLSSSDPN-LQNIPIRNEEGRHIRQAFIAREGYSIVAADYSQIELR 715

Query: 388 VLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKA 447
           ++A ++G+Q  + AF  G+D++ +T A  F V+  +VT +QR   K +   L Y  G  A
Sbjct: 716 IMAHLSGDQGLINAFSQGKDIHRSTAAEIFGVSLDEVTSEQRRNAKAINFGLIY--GMSA 773

Query: 448 F 448
           F
Sbjct: 774 F 774


>gi|118581241|ref|YP_902491.1| DNA polymerase I [Pelobacter propionicus DSM 2379]
 gi|118503951|gb|ABL00434.1| DNA polymerase I [Pelobacter propionicus DSM 2379]
          Length = 893

 Score = 63.2 bits (152), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 44/151 (29%), Positives = 69/151 (45%), Gaps = 5/151 (3%)

Query: 305 RGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITSDPD--PLQIISD 362
           R  L + G S+         P    PR  R H   +Q +T      +SDP+   + I SD
Sbjct: 590 RLILDYRGLSKLKSTYSDALPRLVHPRTGRVHTSYNQTVTSTGRLSSSDPNLQNIPIRSD 649

Query: 363 ---CVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNV 419
               +R   IA  G  ++ AD + IE RVLA ++G+    +AFE  ED++  T +  F +
Sbjct: 650 EGRMIRHAFIAPPGHVIISADYSQIELRVLAHLSGDPVFCQAFEHDEDIHTRTASEVFGL 709

Query: 420 APAQVTKDQRAIGKVMELALGYQGGAKAFQK 450
            P  VT + R   K +   + Y  G+ +  +
Sbjct: 710 FPEMVTAEMRRQAKTINFGIIYGQGSFSLAR 740


>gi|145632225|ref|ZP_01787960.1| DNA polymerase I [Haemophilus influenzae 3655]
 gi|145634721|ref|ZP_01790429.1| DNA polymerase I [Haemophilus influenzae PittAA]
 gi|144987132|gb|EDJ93662.1| DNA polymerase I [Haemophilus influenzae 3655]
 gi|145267887|gb|EDK07883.1| DNA polymerase I [Haemophilus influenzae PittAA]
          Length = 935

 Score = 63.2 bits (152), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 42/121 (34%), Positives = 62/121 (51%), Gaps = 9/121 (7%)

Query: 334 RSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLVVADLAGIEAR 387
           R H    Q +T      +SDP+ LQ I         +R   IA EG  +V AD + IE R
Sbjct: 662 RVHTSYHQAVTATGRLSSSDPN-LQNIPIRNEEGRRIRQAFIAREGYSIVAADYSQIELR 720

Query: 388 VLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKA 447
           ++A ++G+Q  + AF  G+D++ +T A  F V+  +VT +QR   K +   L Y  G  A
Sbjct: 721 IMAHLSGDQGLINAFSQGKDIHRSTAAEIFGVSLDEVTSEQRRNAKAINFGLIY--GMSA 778

Query: 448 F 448
           F
Sbjct: 779 F 779


>gi|301169575|emb|CBW29176.1| fused DNA polymerase I 5'->3' exonuclease/3'->5' polymerase/3'->5'
           exonuclease [Haemophilus influenzae 10810]
          Length = 935

 Score = 63.2 bits (152), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 42/121 (34%), Positives = 62/121 (51%), Gaps = 9/121 (7%)

Query: 334 RSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLVVADLAGIEAR 387
           R H    Q +T      +SDP+ LQ I         +R   IA EG  +V AD + IE R
Sbjct: 662 RVHTSYHQAVTATGRLSSSDPN-LQNIPIRNEEGRRIRQAFIAREGYSIVAADYSQIELR 720

Query: 388 VLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKA 447
           ++A ++G+Q  + AF  G+D++ +T A  F V+  +VT +QR   K +   L Y  G  A
Sbjct: 721 IMAHLSGDQGLINAFSQGKDIHRSTAAEIFGVSLDEVTSEQRRNAKAINFGLIY--GMSA 778

Query: 448 F 448
           F
Sbjct: 779 F 779


>gi|261364888|ref|ZP_05977771.1| DNA polymerase I [Neisseria mucosa ATCC 25996]
 gi|288566937|gb|EFC88497.1| DNA polymerase I [Neisseria mucosa ATCC 25996]
          Length = 933

 Score = 63.2 bits (152), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 51/99 (51%)

Query: 364 VRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQ 423
           VR    A +G  +V AD + IE R++A ++G++  + AF+ GED++  T A  F +AP  
Sbjct: 692 VRRAFTAPQGSVIVSADYSQIELRIMAHLSGDKTLIAAFQNGEDVHCRTAAEVFGIAPEN 751

Query: 424 VTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTF 462
           V+ +QR   K +   L Y  G     K      L+  TF
Sbjct: 752 VSSEQRRYAKTINFGLIYGMGQYGLAKSLGIDNLSAKTF 790


>gi|294634243|ref|ZP_06712786.1| DNA polymerase I [Edwardsiella tarda ATCC 23685]
 gi|291092330|gb|EFE24891.1| DNA polymerase I [Edwardsiella tarda ATCC 23685]
          Length = 930

 Score = 63.2 bits (152), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 64/131 (48%), Gaps = 9/131 (6%)

Query: 324 FPPQNLPRPSRSHEELDQIITHLPTSITSDPDPLQII---SD---CVRSCVIASEGKKLV 377
            P    P   R H    Q +T      +SDP+ LQ I   SD    +R   IA  G K+V
Sbjct: 646 LPQMVSPLTGRVHTSYHQAVTATGRLSSSDPN-LQNIPVRSDEGRRIRQAFIAPAGSKIV 704

Query: 378 VADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMEL 437
            AD + IE R++A ++G++  L+AF  G+D++  T A  F +    VT DQR   K +  
Sbjct: 705 AADYSQIELRIMAHLSGDRGLLEAFAAGKDIHRATAAEVFGLPLEAVTADQRRSAKAINF 764

Query: 438 ALGYQGGAKAF 448
            L Y  G  AF
Sbjct: 765 GLIY--GMSAF 773


>gi|260581683|ref|ZP_05849480.1| DNA polymerase I [Haemophilus influenzae NT127]
 gi|260095276|gb|EEW79167.1| DNA polymerase I [Haemophilus influenzae NT127]
          Length = 930

 Score = 63.2 bits (152), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 42/121 (34%), Positives = 62/121 (51%), Gaps = 9/121 (7%)

Query: 334 RSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLVVADLAGIEAR 387
           R H    Q +T      +SDP+ LQ I         +R   IA EG  +V AD + IE R
Sbjct: 657 RVHTSYHQAVTATGRLSSSDPN-LQNIPIRNEEGRRIRQAFIAREGYSIVAADYSQIELR 715

Query: 388 VLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKA 447
           ++A ++G+Q  + AF  G+D++ +T A  F V+  +VT +QR   K +   L Y  G  A
Sbjct: 716 IMAHLSGDQGLINAFSQGKDIHRSTAAEIFGVSLDEVTSEQRRNAKAINFGLIY--GMSA 773

Query: 448 F 448
           F
Sbjct: 774 F 774


>gi|68249450|ref|YP_248562.1| DNA polymerase I [Haemophilus influenzae 86-028NP]
 gi|68057649|gb|AAX87902.1| DNA polymerase I [Haemophilus influenzae 86-028NP]
          Length = 930

 Score = 63.2 bits (152), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 42/121 (34%), Positives = 62/121 (51%), Gaps = 9/121 (7%)

Query: 334 RSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLVVADLAGIEAR 387
           R H    Q +T      +SDP+ LQ I         +R   IA EG  +V AD + IE R
Sbjct: 657 RVHTSYHQAVTATGRLSSSDPN-LQNIPIRNEEGRRIRQAFIAREGYSIVAADYSQIELR 715

Query: 388 VLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKA 447
           ++A ++G+Q  + AF  G+D++ +T A  F V+  +VT +QR   K +   L Y  G  A
Sbjct: 716 IMAHLSGDQGLINAFSQGKDIHRSTAAEIFGVSLDEVTSEQRRNAKAINFGLIY--GMSA 773

Query: 448 F 448
           F
Sbjct: 774 F 774


>gi|164687872|ref|ZP_02211900.1| hypothetical protein CLOBAR_01516 [Clostridium bartlettii DSM
           16795]
 gi|164603147|gb|EDQ96612.1| hypothetical protein CLOBAR_01516 [Clostridium bartlettii DSM
           16795]
          Length = 882

 Score = 63.2 bits (152), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 37/117 (31%), Positives = 60/117 (51%), Gaps = 5/117 (4%)

Query: 330 PRPSRSHEELDQIITHLPTSITSDPDPLQI-----ISDCVRSCVIASEGKKLVVADLAGI 384
           P+  R H   +Q IT      +++P+   I     +   +R   +A E  KLV AD + +
Sbjct: 604 PKTGRIHSSFNQTITTTGRISSTEPNMQNIPVKTEMGRDIRKVFVADENCKLVDADYSQV 663

Query: 385 EARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGY 441
           E RVLA M+G++  + AF+ GED++  T ++ F+V    VT  QR   K +   + Y
Sbjct: 664 ELRVLAHMSGDENMIDAFKHGEDIHSKTASQIFDVDIKDVTSKQRIEAKAINFGIIY 720


>gi|156086202|ref|XP_001610510.1| DNA polymerase I [Babesia bovis T2Bo]
 gi|154797763|gb|EDO06942.1| DNA polymerase I, putative [Babesia bovis]
          Length = 1613

 Score = 63.2 bits (152), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 54/203 (26%), Positives = 94/203 (46%), Gaps = 35/203 (17%)

Query: 254  LTETTCQRVLSSNK-KLTPQAIQVFNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLG 312
            L + T +R LS N      QA++ +    +A  +   K+   +++  + GR+   +  +G
Sbjct: 1301 LIQDTSERTLSRNTYHPAIQALREYRKTNKAVTAFTEKIPNHIDS--ATGRIYPNINQIG 1358

Query: 313  ASRTGRWSGCVFPP-QNLPRPSRSHEELDQIITHLPTSITSDPDPLQIISDCVRSCVIAS 371
            A  +GR+S C  P  Q +PR SR                              R C IA 
Sbjct: 1359 A-ESGRFS-CDNPNLQQIPRDSR-----------------------------FRECFIAD 1387

Query: 372  EGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAI 431
            +G KLV+AD + IE R+ A +A ++  ++A+ +GEDL+  T +   N   ++VTK++R +
Sbjct: 1388 KGNKLVIADFSQIELRIAADIAEDRRMIEAYNSGEDLHSLTASLVKNKPISEVTKEERQL 1447

Query: 432  GKVMELALGYQGGAKAFQKMAST 454
             K +   L +      F+  A +
Sbjct: 1448 AKAVNFGLIFGMSLAGFRNYAES 1470


>gi|145636579|ref|ZP_01792246.1| DNA polymerase I [Haemophilus influenzae PittHH]
 gi|145270105|gb|EDK10041.1| DNA polymerase I [Haemophilus influenzae PittHH]
          Length = 930

 Score = 63.2 bits (152), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 42/121 (34%), Positives = 62/121 (51%), Gaps = 9/121 (7%)

Query: 334 RSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLVVADLAGIEAR 387
           R H    Q +T      +SDP+ LQ I         +R   IA EG  +V AD + IE R
Sbjct: 657 RVHTSYHQAVTATGRLSSSDPN-LQNIPIRNEEGRRIRQAFIAREGYSIVAADYSQIELR 715

Query: 388 VLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKA 447
           ++A ++G+Q  + AF  G+D++ +T A  F V+  +VT +QR   K +   L Y  G  A
Sbjct: 716 IMAHLSGDQGLINAFSQGKDIHRSTAAEIFGVSLDEVTSEQRRNAKAINFGLIY--GMSA 773

Query: 448 F 448
           F
Sbjct: 774 F 774


>gi|289549017|ref|YP_003474005.1| DNA-directed DNA polymerase [Thermocrinis albus DSM 14484]
 gi|289182634|gb|ADC89878.1| DNA-directed DNA polymerase [Thermocrinis albus DSM 14484]
          Length = 575

 Score = 63.2 bits (152), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 64/129 (49%), Gaps = 1/129 (0%)

Query: 331 RPSRSHEELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLA 390
           R +R + E  QI        +S+P+ +Q I   +R    A EG   V+AD + IE R+ A
Sbjct: 307 RGNRVYPEFKQIGAVTGRMASSNPN-VQNIPKDLRRIFKAEEGNLFVIADFSQIELRIAA 365

Query: 391 WMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQK 450
              GE   ++AF+ G DL+  T +         +TK++R + K +   L Y   AK   +
Sbjct: 366 EYVGEIRMIRAFQEGRDLHRYTASILLGKREEDITKEERQLAKAVNFGLIYGISAKGLSQ 425

Query: 451 MASTTGLNL 459
            A+T G++L
Sbjct: 426 YAATYGIDL 434


>gi|300309795|ref|YP_003773887.1| DNA polymerase I protein [Herbaspirillum seropedicae SmR1]
 gi|300072580|gb|ADJ61979.1| DNA polymerase I protein [Herbaspirillum seropedicae SmR1]
          Length = 920

 Score = 63.2 bits (152), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 53/94 (56%), Gaps = 3/94 (3%)

Query: 364 VRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQ 423
           +R   +A EG  +V AD + IE R++A ++ ++  LKAF   ED++  T A  F +AP Q
Sbjct: 681 IREAFVAPEGSVIVSADYSQIELRIMAHISEDENMLKAFANNEDIHRATAAEIFGIAPEQ 740

Query: 424 VTKDQRAIGKVMELALGYQGGAKAFQKMASTTGL 457
           V  +QR   KV+   L Y  G  AF  +AS  G+
Sbjct: 741 VESEQRRYAKVINFGLIY--GMSAF-GLASNLGI 771


>gi|309810696|ref|ZP_07704504.1| DNA-directed DNA polymerase [Dermacoccus sp. Ellin185]
 gi|308435327|gb|EFP59151.1| DNA-directed DNA polymerase [Dermacoccus sp. Ellin185]
          Length = 905

 Score = 63.2 bits (152), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 70/262 (26%), Positives = 109/262 (41%), Gaps = 32/262 (12%)

Query: 191 TINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSSSRCLEKLKTWLFLETGLH 250
           T+   G  VD+   H L    D +     Q+      G   +    ++L+  LF   GL 
Sbjct: 514 TMEQAGIAVDLDALHELEADYDAQVVAAQQDAWDAIGGEQVNLGSPKQLQVVLFETLGLP 573

Query: 251 LEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLNT---LVEAMNSDGRLRGT 307
               T+T       +   L+ +A   F + +   R A    +T   L++++  DGR+  T
Sbjct: 574 KTKKTKTGYTTDAEAIADLSEKAPHPFLDALLRHRDASKLRSTVQGLIKSIGDDGRIHTT 633

Query: 308 LQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITSDPDPLQIISDCVRSC 367
            Q   A+ TGR S      QN+P  + S                            +R  
Sbjct: 634 YQQTIAA-TGRLSSTDPNLQNIPIRTESGRR-------------------------IRRV 667

Query: 368 VIASEGKK-LVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTK 426
            +  EG   L+ AD + IE RV+A ++G++  ++AF  GEDL+    +R F V P++VT 
Sbjct: 668 FVVGEGYDCLMSADYSQIEMRVMAHLSGDEGLIQAFNDGEDLHRFVGSRVFGVEPSEVTS 727

Query: 427 DQRAIGKVMELALGYQGGAKAF 448
           + RA  K M   L Y  G  AF
Sbjct: 728 EMRAKVKAMSYGLAY--GLSAF 747


>gi|229845908|ref|ZP_04466020.1| DNA polymerase I [Haemophilus influenzae 7P49H1]
 gi|229810912|gb|EEP46629.1| DNA polymerase I [Haemophilus influenzae 7P49H1]
 gi|309973653|gb|ADO96854.1| DNA polymerase I [Haemophilus influenzae R2846]
          Length = 930

 Score = 63.2 bits (152), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 42/121 (34%), Positives = 62/121 (51%), Gaps = 9/121 (7%)

Query: 334 RSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLVVADLAGIEAR 387
           R H    Q +T      +SDP+ LQ I         +R   IA EG  +V AD + IE R
Sbjct: 657 RVHTSYHQAVTATGRLSSSDPN-LQNIPIRNEEGRRIRQAFIAHEGYSIVAADYSQIELR 715

Query: 388 VLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKA 447
           ++A ++G+Q  + AF  G+D++ +T A  F V+  +VT +QR   K +   L Y  G  A
Sbjct: 716 IMAHLSGDQGLINAFSQGKDIHRSTAAEIFGVSLDEVTSEQRRNAKAINFGLIY--GMSA 773

Query: 448 F 448
           F
Sbjct: 774 F 774


>gi|319897650|ref|YP_004135847.1| DNA polymerase i [Haemophilus influenzae F3031]
 gi|317433156|emb|CBY81530.1| DNA polymerase I [Haemophilus influenzae F3031]
          Length = 935

 Score = 63.2 bits (152), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 42/121 (34%), Positives = 62/121 (51%), Gaps = 9/121 (7%)

Query: 334 RSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLVVADLAGIEAR 387
           R H    Q +T      +SDP+ LQ I         +R   IA EG  +V AD + IE R
Sbjct: 662 RVHTSYHQAVTATGRLSSSDPN-LQNIPIRNEEGRRIRQAFIAREGYSIVAADYSQIELR 720

Query: 388 VLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKA 447
           ++A ++G+Q  + AF  G+D++ +T A  F V+  +VT +QR   K +   L Y  G  A
Sbjct: 721 IMAHLSGDQGLINAFSQGKDIHRSTAAEIFGVSLDEVTSEQRRNAKAINFGLIY--GMSA 778

Query: 448 F 448
           F
Sbjct: 779 F 779


>gi|297624586|ref|YP_003706020.1| DNA polymerase I [Truepera radiovictrix DSM 17093]
 gi|297165766|gb|ADI15477.1| DNA polymerase I [Truepera radiovictrix DSM 17093]
          Length = 867

 Score = 63.2 bits (152), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 37/117 (31%), Positives = 59/117 (50%), Gaps = 5/117 (4%)

Query: 330 PRPSRSHEELDQIITHLPTSITSDPDPLQI-----ISDCVRSCVIASEGKKLVVADLAGI 384
           P   R H   +Q  T      +++P+   I     +   +R   +A EG  L+VAD + I
Sbjct: 591 PHTGRLHTTFNQTATATGRLSSANPNLQNIPVRTAVGREIRRAFVADEGATLLVADYSQI 650

Query: 385 EARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGY 441
           E R+LA + GE+  ++ F  GED++  T A+ F V P  VT + R + KV+   + Y
Sbjct: 651 ELRILAHITGEEALVETFRRGEDIHRRTAAQIFGVPPEAVTPEGRRVAKVINFGVLY 707


>gi|148826499|ref|YP_001291252.1| DNA polymerase I [Haemophilus influenzae PittEE]
 gi|148716659|gb|ABQ98869.1| DNA polymerase I [Haemophilus influenzae PittEE]
          Length = 930

 Score = 63.2 bits (152), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 42/121 (34%), Positives = 62/121 (51%), Gaps = 9/121 (7%)

Query: 334 RSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLVVADLAGIEAR 387
           R H    Q +T      +SDP+ LQ I         +R   IA EG  +V AD + IE R
Sbjct: 657 RVHTSYHQAVTATGRLSSSDPN-LQNIPIRNEEGRRIRQAFIAHEGYSIVAADYSQIELR 715

Query: 388 VLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKA 447
           ++A ++G+Q  + AF  G+D++ +T A  F V+  +VT +QR   K +   L Y  G  A
Sbjct: 716 IMAHLSGDQGLINAFSQGKDIHRSTAAEIFGVSLDEVTSEQRRNAKAINFGLIY--GMSA 773

Query: 448 F 448
           F
Sbjct: 774 F 774


>gi|220933279|ref|YP_002512178.1| DNA polymerase I [Thioalkalivibrio sp. HL-EbGR7]
 gi|219994589|gb|ACL71191.1| DNA polymerase I [Thioalkalivibrio sp. HL-EbGR7]
          Length = 903

 Score = 62.8 bits (151), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 42/131 (32%), Positives = 63/131 (48%), Gaps = 9/131 (6%)

Query: 324 FPPQNLPRPSRSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLV 377
            P +  P   R H    Q +       +SDP+ LQ I         +R   +A  G++LV
Sbjct: 619 LPERIDPDTGRVHTSYHQAVASTGRLSSSDPN-LQNIPIRTEEGRRIRQAFVAPSGRRLV 677

Query: 378 VADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMEL 437
            AD + IE R++A ++G+   L+AF  G+D++  T A  F V   QV+ +QR   K +  
Sbjct: 678 AADYSQIELRIMAHLSGDAGLLRAFAEGQDIHRATAAEVFGVGLDQVSGEQRRAAKAINF 737

Query: 438 ALGYQGGAKAF 448
            L Y  G  AF
Sbjct: 738 GLIY--GMSAF 746


>gi|229844734|ref|ZP_04464873.1| DNA polymerase I [Haemophilus influenzae 6P18H1]
 gi|229812448|gb|EEP48138.1| DNA polymerase I [Haemophilus influenzae 6P18H1]
          Length = 930

 Score = 62.8 bits (151), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 42/121 (34%), Positives = 62/121 (51%), Gaps = 9/121 (7%)

Query: 334 RSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLVVADLAGIEAR 387
           R H    Q +T      +SDP+ LQ I         +R   IA EG  +V AD + IE R
Sbjct: 657 RVHTSYHQAVTATGRLSSSDPN-LQNIPIRNEEGRRIRQAFIAREGYSIVAADYSQIELR 715

Query: 388 VLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKA 447
           ++A ++G+Q  + AF  G+D++ +T A  F V+  +VT +QR   K +   L Y  G  A
Sbjct: 716 IMAHLSGDQGLINAFSQGKDIHRSTAAEIFGVSLDEVTSEQRRNAKAINFGLIY--GMSA 773

Query: 448 F 448
           F
Sbjct: 774 F 774


>gi|255067522|ref|ZP_05319377.1| DNA polymerase I [Neisseria sicca ATCC 29256]
 gi|255048317|gb|EET43781.1| DNA polymerase I [Neisseria sicca ATCC 29256]
          Length = 952

 Score = 62.8 bits (151), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 51/99 (51%)

Query: 364 VRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQ 423
           VR    A +G  +V AD + IE R++A ++G++  + AF+ GED++  T A  F +AP  
Sbjct: 711 VRRAFTAPQGSVIVSADYSQIELRIMAHLSGDKTLIAAFQNGEDVHRRTAAEVFGIAPEN 770

Query: 424 VTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTF 462
           V+ +QR   K +   L Y  G     K      L+  TF
Sbjct: 771 VSSEQRRYAKTINFGLIYGMGQYGLAKSLGIDNLSAKTF 809


>gi|329122862|ref|ZP_08251434.1| DNA-directed DNA polymerase I [Haemophilus aegyptius ATCC 11116]
 gi|327472126|gb|EGF17564.1| DNA-directed DNA polymerase I [Haemophilus aegyptius ATCC 11116]
          Length = 930

 Score = 62.8 bits (151), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 42/121 (34%), Positives = 62/121 (51%), Gaps = 9/121 (7%)

Query: 334 RSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLVVADLAGIEAR 387
           R H    Q +T      +SDP+ LQ I         +R   IA EG  +V AD + IE R
Sbjct: 657 RVHTSYHQAVTATGRLSSSDPN-LQNIPIRNEEGRRIRQAFIAREGYSIVAADYSQIELR 715

Query: 388 VLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKA 447
           ++A ++G+Q  + AF  G+D++ +T A  F V+  +VT +QR   K +   L Y  G  A
Sbjct: 716 IMAHLSGDQGLISAFSQGKDIHRSTAAEIFGVSLDEVTSEQRRNAKAINFGLIY--GMSA 773

Query: 448 F 448
           F
Sbjct: 774 F 774


>gi|12001918|gb|AAG43102.1|AF038542_1 DNA polymerase I [Pseudomonas fluorescens]
          Length = 939

 Score = 62.8 bits (151), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 46/151 (30%), Positives = 69/151 (45%), Gaps = 10/151 (6%)

Query: 324 FPPQNLPRPSRSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLV 377
            P Q  PR  R H    Q +       +SDP+ LQ I         +R   +A +G KL+
Sbjct: 655 LPEQINPRTGRIHTSYHQAVASTGRLSSSDPN-LQNIPVRTAEGRRIRQAFVAPKGYKLL 713

Query: 378 VADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMEL 437
            AD + IE R++A ++ ++  + AF    D++  T A  F V   +VT DQR   K +  
Sbjct: 714 AADYSQIELRIMAHLSRDEGLMNAFRNNLDVHTATAAEVFKVELNEVTSDQRRGAKAINF 773

Query: 438 ALGYQGGAKAFQKMASTTGLNLNTFAHLVKT 468
            L Y  GA   QK+    G++  T    + T
Sbjct: 774 GLIYGMGA---QKLGKDIGVDTKTAKAYIDT 801


>gi|312958179|ref|ZP_07772702.1| DNA polymerase A [Pseudomonas fluorescens WH6]
 gi|311287610|gb|EFQ66168.1| DNA polymerase A [Pseudomonas fluorescens WH6]
          Length = 931

 Score = 62.8 bits (151), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 45/144 (31%), Positives = 67/144 (46%), Gaps = 10/144 (6%)

Query: 324 FPPQNLPRPSRSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLV 377
            P Q  PR  R H    Q +       +SDP+ LQ I         +R   +A +G KL+
Sbjct: 647 LPEQINPRTGRIHTSYHQAVAATGRLSSSDPN-LQNIPVRTAEGRRIRQAFVAPKGYKLL 705

Query: 378 VADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMEL 437
            AD + IE R++A ++ ++  + AF    D++  T A  F V   +VT DQR   K +  
Sbjct: 706 AADYSQIELRIMAHLSKDEGLMNAFRHNLDVHTATAAEVFKVELGEVTSDQRRSAKAINF 765

Query: 438 ALGYQGGAKAFQKMASTTGLNLNT 461
            L Y  GA   QK+    G++  T
Sbjct: 766 GLIYGMGA---QKLGKDIGVDTKT 786


>gi|77456284|ref|YP_345789.1| DNA polymerase I [Pseudomonas fluorescens Pf0-1]
 gi|77380287|gb|ABA71800.1| DNA polymerase I [Pseudomonas fluorescens Pf0-1]
          Length = 935

 Score = 62.8 bits (151), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 46/151 (30%), Positives = 69/151 (45%), Gaps = 10/151 (6%)

Query: 324 FPPQNLPRPSRSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLV 377
            P Q  PR  R H    Q +       +SDP+ LQ I         +R   +A +G KL+
Sbjct: 651 LPEQINPRTGRIHTSYHQAVASTGRLSSSDPN-LQNIPVRTAEGRRIRQAFVAPKGYKLL 709

Query: 378 VADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMEL 437
            AD + IE R++A ++ ++  + AF    D++  T A  F V   +VT DQR   K +  
Sbjct: 710 AADYSQIELRIMAHLSRDEGLMNAFRNNLDVHTATAAEVFKVELNEVTSDQRRGAKAINF 769

Query: 438 ALGYQGGAKAFQKMASTTGLNLNTFAHLVKT 468
            L Y  GA   QK+    G++  T    + T
Sbjct: 770 GLIYGMGA---QKLGKDIGVDTKTAKAYIDT 797


>gi|294668660|ref|ZP_06733756.1| DNA polymerase I [Neisseria elongata subsp. glycolytica ATCC 29315]
 gi|291309422|gb|EFE50665.1| DNA polymerase I [Neisseria elongata subsp. glycolytica ATCC 29315]
          Length = 958

 Score = 62.8 bits (151), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 51/99 (51%)

Query: 364 VRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQ 423
           VR    A +G  +V AD + IE R++A ++G++  + AF+ GED++  T A  F +AP  
Sbjct: 717 VRRAFTAPQGSVIVSADYSQIELRIMAHLSGDKTLIAAFQNGEDVHRRTAAEVFGIAPEN 776

Query: 424 VTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTF 462
           V+ +QR   K +   L Y  G     K      L+  TF
Sbjct: 777 VSPEQRRYAKTINFGLIYGMGQYGLAKSLGIDNLSAKTF 815


>gi|329119683|ref|ZP_08248364.1| DNA-directed DNA polymerase I [Neisseria bacilliformis ATCC
           BAA-1200]
 gi|327464280|gb|EGF10584.1| DNA-directed DNA polymerase I [Neisseria bacilliformis ATCC
           BAA-1200]
          Length = 932

 Score = 62.8 bits (151), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 42/139 (30%), Positives = 63/139 (45%), Gaps = 7/139 (5%)

Query: 330 PRPSRSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLVVADLAG 383
           PR  R H    Q +       +S+P+ LQ I         VR    A  G  +V AD + 
Sbjct: 652 PRTGRVHTTYSQAVAITGRLASSNPN-LQNIPIRTAEGRRVRRAFTAPAGSLIVSADYSQ 710

Query: 384 IEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQG 443
           IE R++A ++G++  + AF+ GED++  T A  F +AP  V+ +QR   K +   L Y  
Sbjct: 711 IELRIMAHLSGDKTLMAAFQNGEDVHRRTAAEVFGIAPENVSPEQRRYAKTINFGLIYGM 770

Query: 444 GAKAFQKMASTTGLNLNTF 462
           G     K      L+   F
Sbjct: 771 GQYGLAKSLGIDNLSAKNF 789


>gi|218961649|ref|YP_001741424.1| DNA polymerase I [Candidatus Cloacamonas acidaminovorans]
 gi|167730306|emb|CAO81218.1| DNA polymerase I [Candidatus Cloacamonas acidaminovorans]
          Length = 918

 Score = 62.8 bits (151), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 54/225 (24%), Positives = 103/225 (45%), Gaps = 13/225 (5%)

Query: 282 RASRSAVLKLNTLVEAMNSDGRLRGTL-QFLGASRTGRWSGCVFPPQNLPRPSRSHEELD 340
           R +++     N+++E +  D  + G + Q+   S+         P    P+  R H   +
Sbjct: 587 RKTKTGYSTDNSVLEELAIDYEIAGIIIQYRQLSKLQSTYVSALPKMINPQTGRIHSSFN 646

Query: 341 QIITHLPTSITSDPDPLQI-----ISDCVRSCVIASEGKKLVV-ADLAGIEARVLAWMAG 394
           Q +T      +S+P+   I     I   +R    A + + L++ AD + IE R+LA M+ 
Sbjct: 647 QTVTSTGRLSSSNPNLQNIPVRTEIGREIRKAFCAKDAEHLILDADYSQIELRLLALMSE 706

Query: 395 EQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMAST 454
           ++  ++AF+   D++    A+ FNV   +VT DQR   K +   + Y  G +   K++  
Sbjct: 707 DEVLIEAFKQDLDIHKRMAAKIFNVDIEKVTPDQRRAAKTINFGILYGMGQR---KLSRE 763

Query: 455 TGLNLNTFAHLVKTNSAPEEWEDAENFC-RWMQENHPEHAIEDLF 498
            G++LN    ++    A  ++    NF  + + +   +H  E LF
Sbjct: 764 LGISLNEAKDIIDGYYA--QFPSIRNFINQCVNKARQQHYAETLF 806


>gi|300703485|ref|YP_003745087.1| DNA polymerase i (pol i) [Ralstonia solanacearum CFBP2957]
 gi|299071148|emb|CBJ42461.1| DNA polymerase I (POL I) [Ralstonia solanacearum CFBP2957]
          Length = 960

 Score = 62.8 bits (151), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 34/95 (35%), Positives = 53/95 (55%), Gaps = 3/95 (3%)

Query: 364 VRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQ 423
           +R   +A  G  +V AD + IE R++A ++G+   ++AF  G+D++  T A  F V P +
Sbjct: 713 IREAFVAPAGSVIVSADYSQIELRIMAHLSGDDGLMRAFREGQDVHRATAAEVFGVTPLE 772

Query: 424 VTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLN 458
           VT +QR   KV+   L Y  G  AF  +AS  G+ 
Sbjct: 773 VTAEQRRYAKVINFGLIY--GMSAF-GLASNLGIG 804


>gi|237747176|ref|ZP_04577656.1| DNA polymerase I [Oxalobacter formigenes HOxBLS]
 gi|229378527|gb|EEO28618.1| DNA polymerase I [Oxalobacter formigenes HOxBLS]
          Length = 913

 Score = 62.8 bits (151), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 46/156 (29%), Positives = 72/156 (46%), Gaps = 8/156 (5%)

Query: 308 LQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITSDPDPLQIISDC---- 363
           L F G ++         P    P   R H    Q +       ++DP+   I        
Sbjct: 613 LDFRGMAKLKSTYTDKLPRMINPETGRVHTNYAQAVAVTGRLASNDPNLQNIPVKTEEGR 672

Query: 364 -VRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPA 422
            +R   IA  G  +V AD + IE R++A ++ +   LKAF  G+D++  T +  F++AP 
Sbjct: 673 RIREAFIAPAGCYIVSADYSQIELRIMAHLSDDPGLLKAFREGQDVHKATASEIFDIAPL 732

Query: 423 QVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLN 458
           +VT +QR   KV+   L Y  G  AF  +AS  G++
Sbjct: 733 EVTPEQRRYAKVINFGLIY--GMSAF-GVASNLGIS 765


>gi|284794813|gb|ADB93739.1| gp46 [Mycobacterium phage RedRock]
          Length = 595

 Score = 62.8 bits (151), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 121/489 (24%), Positives = 184/489 (37%), Gaps = 98/489 (20%)

Query: 14  IDLTKCGICKYAEDVCVILFAFGFDDH----PVELWDCVHDPVMPQVLKEALENTDVTIV 69
           +D    G+  Y++     L  FG  D     PVEL D   + V  ++   AL      +V
Sbjct: 40  VDTETTGLDIYSDTFECRLVQFGTQDEAWVVPVELGDVFIEDV--RIAIGALRK----VV 93

Query: 70  AHNSYFERTVLKACFNLDIPI--HRWICTLVLARSNGLPSALKAVGEALKLSSQKMEEGK 127
             N+ ++  VL  CF +++     R + T +LA+    P   +A G    L        +
Sbjct: 94  LQNASYDLQVLDQCFGIEMEDLWPRVLDTQILAKLVD-PRPFEAGGFGHSL--------E 144

Query: 128 ELIARFCKGETHEC-------LYDRNKPNHREAWRL-------FGEYCKGDVTVTREIFK 173
           ELIA F   E  E        L   +K    + W         + +Y   D   T  + K
Sbjct: 145 ELIAEFISKEQAETVKKLMAKLAQEHKTTKAKIWATIDLFHPEYLKYAGMDTIFTARVCK 204

Query: 174 RLEPLS--------SKEQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESL 225
            L PL         + E E+  +   I+ +G+ +DV  A  L                  
Sbjct: 205 ALTPLVPDVSRGLVAYEHEISEICSYIDRQGFLLDVEYAQEL------------------ 246

Query: 226 TYGLVSSSRCLEKLKTW---LFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMR 282
                 S + L   + W    F E G+   + TE   + +     K+T         R  
Sbjct: 247 ------SDKWLADQQVWEAIAFTEYGVEKVNSTEDLAEGLEEMGVKIT--------GRTE 292

Query: 283 ASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPS--RSHEELD 340
             +  V K  TL+E + ++G    T+    A + G+W           R +  R H  ++
Sbjct: 293 TGKRQVDK--TLLEKLVAEGNELATIA-QEAKKLGKWRKTWVQKFLDTRDAEDRCHTFVN 349

Query: 341 QIITHLP-TSITSDPDPLQIISDC-VRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWK 398
            +       SIT  P      SD  VR C +A EG  +   D    E RVLA ++ +Q  
Sbjct: 350 PLQARTSRMSITGIPAQTLPASDSTVRRCFLAEEGDVMASIDYQTQELRVLAALSNDQTM 409

Query: 399 LKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMAS----T 454
           ++AF+TG DL+  T         AQVT   R +GK+      Y GGAK   + A     T
Sbjct: 410 IEAFKTGADLHQMT------ADAAQVT---RKVGKMANFLTVYGGGAKTLAEQAKVDFPT 460

Query: 455 TGLNLNTFA 463
               L+ FA
Sbjct: 461 AKRTLDAFA 469


>gi|222099813|ref|YP_002534381.1| DNA-directed DNA polymerase I [Thermotoga neapolitana DSM 4359]
 gi|221572203|gb|ACM23015.1| DNA-directed DNA polymerase I [Thermotoga neapolitana DSM 4359]
          Length = 893

 Score = 62.8 bits (151), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 45/152 (29%), Positives = 76/152 (50%), Gaps = 26/152 (17%)

Query: 291 LNTLVEAMNSD-GRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTS 349
           ++TL + +N   GR+  +    G + TGR S      QNLP  S   +E+ + I      
Sbjct: 608 IDTLPKLVNPKTGRIHASFHQTGTA-TGRLSSSDPNLQNLPTKSEEGKEIRKAI------ 660

Query: 350 ITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLY 409
           +  DPD                    +V AD + IE R+LA ++G++  +KAFE G D++
Sbjct: 661 VPQDPDWW------------------IVSADYSQIELRILAHLSGDENLVKAFEEGIDVH 702

Query: 410 VTTYARSFNVAPAQVTKDQRAIGKVMELALGY 441
             T +R +NV P +V ++ R +GK++  ++ Y
Sbjct: 703 TLTASRIYNVKPEEVNEEMRRVGKMVNFSIIY 734


>gi|207723739|ref|YP_002254137.1| dna polymeraseIprotein [Ralstonia solanacearum MolK2]
 gi|206588943|emb|CAQ35905.1| dna polymeraseIprotein [Ralstonia solanacearum MolK2]
          Length = 944

 Score = 62.8 bits (151), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 34/95 (35%), Positives = 53/95 (55%), Gaps = 3/95 (3%)

Query: 364 VRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQ 423
           +R   +A  G  +V AD + IE R++A ++G+   ++AF  G+D++  T A  F V P +
Sbjct: 697 IREAFVAPAGSVIVSADYSQIELRIMAHLSGDDGLMRAFREGQDVHRATAAEVFGVTPLE 756

Query: 424 VTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLN 458
           VT +QR   KV+   L Y  G  AF  +AS  G+ 
Sbjct: 757 VTAEQRRYAKVINFGLIY--GMSAF-GLASNLGIG 788


>gi|145628242|ref|ZP_01784043.1| DNA polymerase I [Haemophilus influenzae 22.1-21]
 gi|145638340|ref|ZP_01793950.1| DNA polymerase I [Haemophilus influenzae PittII]
 gi|144980017|gb|EDJ89676.1| DNA polymerase I [Haemophilus influenzae 22.1-21]
 gi|145272669|gb|EDK12576.1| DNA polymerase I [Haemophilus influenzae PittII]
 gi|309751482|gb|ADO81466.1| DNA polymerase I [Haemophilus influenzae R2866]
          Length = 935

 Score = 62.8 bits (151), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 41/121 (33%), Positives = 62/121 (51%), Gaps = 9/121 (7%)

Query: 334 RSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLVVADLAGIEAR 387
           R H    Q +T      +SDP+ LQ I         +R   IA EG  +V AD + IE R
Sbjct: 662 RVHTSYHQAVTATGRLSSSDPN-LQNIPIRNEEGRRIRQAFIAREGYSIVAADYSQIELR 720

Query: 388 VLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKA 447
           ++A ++G+Q  + AF  G+D++ +T A  F V+  ++T +QR   K +   L Y  G  A
Sbjct: 721 IMAHLSGDQGLINAFSQGKDIHRSTAAEIFGVSLDEITSEQRRNAKAINFGLIY--GMSA 778

Query: 448 F 448
           F
Sbjct: 779 F 779


>gi|207743834|ref|YP_002260226.1| dna polymeraseIprotein [Ralstonia solanacearum IPO1609]
 gi|206595234|emb|CAQ62161.1| dna polymeraseIprotein [Ralstonia solanacearum IPO1609]
          Length = 944

 Score = 62.4 bits (150), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 34/95 (35%), Positives = 53/95 (55%), Gaps = 3/95 (3%)

Query: 364 VRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQ 423
           +R   +A  G  +V AD + IE R++A ++G+   ++AF  G+D++  T A  F V P +
Sbjct: 697 IREAFVAPAGSVIVSADYSQIELRIMAHLSGDDGLMRAFREGQDVHRATAAEVFGVTPLE 756

Query: 424 VTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLN 458
           VT +QR   KV+   L Y  G  AF  +AS  G+ 
Sbjct: 757 VTAEQRRYAKVINFGLIY--GMSAF-GLASNLGIG 788


>gi|83746523|ref|ZP_00943574.1| DNA polymerase I [Ralstonia solanacearum UW551]
 gi|83726854|gb|EAP73981.1| DNA polymerase I [Ralstonia solanacearum UW551]
          Length = 946

 Score = 62.4 bits (150), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 34/95 (35%), Positives = 53/95 (55%), Gaps = 3/95 (3%)

Query: 364 VRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQ 423
           +R   +A  G  +V AD + IE R++A ++G+   ++AF  G+D++  T A  F V P +
Sbjct: 699 IREAFVAPAGSVIVSADYSQIELRIMAHLSGDDGLMRAFREGQDVHRATAAEVFGVTPLE 758

Query: 424 VTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLN 458
           VT +QR   KV+   L Y  G  AF  +AS  G+ 
Sbjct: 759 VTAEQRRYAKVINFGLIY--GMSAF-GLASNLGIG 790


>gi|298369714|ref|ZP_06981031.1| DNA polymerase I [Neisseria sp. oral taxon 014 str. F0314]
 gi|298282271|gb|EFI23759.1| DNA polymerase I [Neisseria sp. oral taxon 014 str. F0314]
          Length = 929

 Score = 62.4 bits (150), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 51/99 (51%)

Query: 364 VRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQ 423
           VR    A +G  +V AD + IE R++A ++G++  + AF+ GED++  T A  F +AP  
Sbjct: 688 VRRAFTAPQGSVIVSADYSQIELRIMAHLSGDKTLIAAFQNGEDVHRRTAAEVFGIAPEN 747

Query: 424 VTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTF 462
           V+ +QR   K +   L Y  G     K      L+  TF
Sbjct: 748 VSPEQRRYAKTINFGLIYGMGQYGLAKSLGIDNLSAKTF 786


>gi|257066818|ref|YP_003153074.1| DNA polymerase I [Anaerococcus prevotii DSM 20548]
 gi|256798698|gb|ACV29353.1| DNA polymerase I [Anaerococcus prevotii DSM 20548]
          Length = 879

 Score = 62.4 bits (150), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 45/148 (30%), Positives = 71/148 (47%), Gaps = 26/148 (17%)

Query: 294 LVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITSD 353
           L +A++ DGR+R T +    + TGR S      QNLP                   I +D
Sbjct: 596 LEKAIDEDGRIRSTFR-QNIAATGRLSSQDPNLQNLP-------------------IKTD 635

Query: 354 PDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTY 413
              L      +R    A EGK L+ AD + IE R+LA ++G++  + AF+ G D++  T 
Sbjct: 636 EGRL------IRKAFRAEEGKILIDADYSQIELRILASLSGDRHMIDAFKEGVDIHTKTA 689

Query: 414 ARSFNVAPAQVTKDQRAIGKVMELALGY 441
           ++ F+    +VTK QR+  K +   + Y
Sbjct: 690 SKVFHTDLDKVTKRQRSEAKAVNFGIIY 717


>gi|325577646|ref|ZP_08147921.1| DNA-directed DNA polymerase I [Haemophilus parainfluenzae ATCC
           33392]
 gi|325160391|gb|EGC72517.1| DNA-directed DNA polymerase I [Haemophilus parainfluenzae ATCC
           33392]
          Length = 932

 Score = 62.4 bits (150), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 43/125 (34%), Positives = 63/125 (50%), Gaps = 9/125 (7%)

Query: 330 PRPSRSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLVVADLAG 383
           P+  R H    Q +T      +SDP+ LQ I         +R   IA EG  +V AD + 
Sbjct: 655 PQTGRVHTSYHQAVTATGRLSSSDPN-LQNIPIRNEEGRRIRQAFIAREGFTVVAADYSQ 713

Query: 384 IEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQG 443
           IE R++A ++ +Q  + AF  G+D++ +T A  F VA  +VT +QR   K +   L Y  
Sbjct: 714 IELRIMAHLSQDQGLINAFTQGKDIHRSTAAEIFGVALDEVTSEQRRNAKAINFGLIY-- 771

Query: 444 GAKAF 448
           G  AF
Sbjct: 772 GMSAF 776


>gi|225023896|ref|ZP_03713088.1| hypothetical protein EIKCOROL_00762 [Eikenella corrodens ATCC
           23834]
 gi|224943370|gb|EEG24579.1| hypothetical protein EIKCOROL_00762 [Eikenella corrodens ATCC
           23834]
          Length = 928

 Score = 62.4 bits (150), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 51/99 (51%)

Query: 364 VRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQ 423
           VR    A +G  +V AD + IE R++A ++G++  + AF+ GED++  T A  F +AP  
Sbjct: 687 VRRAFTAPQGSVIVSADYSQIELRIMAHLSGDKTLIAAFQNGEDVHRRTAAEVFGIAPEN 746

Query: 424 VTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTF 462
           V+ +QR   K +   L Y  G     K      L+  TF
Sbjct: 747 VSPEQRRYAKTINFGLIYGMGQYGLAKSLGIDNLSAKTF 785


>gi|300933405|ref|ZP_07148661.1| DNA polymerase I [Corynebacterium resistens DSM 45100]
          Length = 864

 Score = 62.4 bits (150), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 79/307 (25%), Positives = 133/307 (43%), Gaps = 50/307 (16%)

Query: 169 REIFKRL-EPLSSKEQELWYLDQTI---------NDRGYCVDVALAHTLNQIVDVERTKL 218
           R++ K L E L++ +QE  Y D  +            G  VD      L ++ +    K+
Sbjct: 442 RDLVKVLTEKLAAAKQEELYYDLEVPLCLILARMEHEGIAVD---GEHLQELSNDYAAKI 498

Query: 219 DQELESLTYGLVSSSRCL---EKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQ 275
           D+E+ +       S+  L   ++L+  LF +  L     T+T      +  +KLT Q   
Sbjct: 499 DEEIAAARELAGDSTLNLSSPKQLQKVLFDDFDLPKTKRTKTGYSTAAAELEKLTAQTNH 558

Query: 276 VFNNRMRASR---SAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRP 332
            F   + A R        ++ L+EA+  DGR+  T    GA+ TGR S      QN+P  
Sbjct: 559 PFLAHLMAHREYQKMKTTIDGLIEAIGDDGRIHTTFNQKGAA-TGRLSSSDPNLQNIP-- 615

Query: 333 SRSHEELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWM 392
                            + +D          +R+   A  G+ L+ AD + IE RV+A +
Sbjct: 616 -----------------VRTDA------GRRIRAAFHAGWGETLLTADYSQIEMRVMAHL 652

Query: 393 AGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAF---Q 449
           + ++  ++A+++GEDL+    +R F+V   QVT + R   K +   L Y  G  AF   Q
Sbjct: 653 SQDEGLIEAYKSGEDLHNYVGSRVFDVPVDQVTPELRRRVKALSYGLVY--GLSAFGLSQ 710

Query: 450 KMASTTG 456
           ++  + G
Sbjct: 711 QLGISAG 717


>gi|301154826|emb|CBW14289.1| fused DNA polymerase I 5'->3' exonuclease/3'->5' polymerase/3'->5'
           exonuclease [Haemophilus parainfluenzae T3T1]
          Length = 932

 Score = 62.4 bits (150), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 43/125 (34%), Positives = 63/125 (50%), Gaps = 9/125 (7%)

Query: 330 PRPSRSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLVVADLAG 383
           P+  R H    Q +T      +SDP+ LQ I         +R   IA EG  +V AD + 
Sbjct: 655 PQTGRVHTSYHQAVTATGRLSSSDPN-LQNIPIRNEEGRRIRQAFIAREGFTVVAADYSQ 713

Query: 384 IEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQG 443
           IE R++A ++ +Q  + AF  G+D++ +T A  F VA  +VT +QR   K +   L Y  
Sbjct: 714 IELRIMAHLSQDQGLINAFTQGKDIHRSTAAEIFGVALDEVTSEQRRNAKAINFGLIY-- 771

Query: 444 GAKAF 448
           G  AF
Sbjct: 772 GMSAF 776


>gi|253698996|ref|YP_003020185.1| DNA polymerase I [Geobacter sp. M21]
 gi|251773846|gb|ACT16427.1| DNA polymerase I [Geobacter sp. M21]
          Length = 892

 Score = 62.4 bits (150), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 48/164 (29%), Positives = 71/164 (43%), Gaps = 7/164 (4%)

Query: 305 RGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITSDPDPLQII---- 360
           R  LQ+   S+         P    P   R H   +Q +T      +SDP+ LQ I    
Sbjct: 589 RLLLQYRSISKLKSTYTDALPKLVAPATGRVHTSYNQAVTSTGRLSSSDPN-LQNIPIRG 647

Query: 361 --SDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFN 418
                +R   IA  G  ++ AD + IE RVLA ++G++   +AF  GED++  T +  F 
Sbjct: 648 EEGRGIRRAFIAEPGSLMLSADYSQIELRVLAHLSGDRVLCEAFAAGEDIHRRTASEVFG 707

Query: 419 VAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTF 462
           + P  VT + R   KV+   + Y  GA +  K    T      F
Sbjct: 708 MFPELVTSEMRRQAKVINFGVIYGQGAFSLAKELGVTPKQAKAF 751


>gi|157373118|ref|YP_001481107.1| DNA polymerase I [Serratia proteamaculans 568]
 gi|157324882|gb|ABV43979.1| DNA polymerase I [Serratia proteamaculans 568]
          Length = 934

 Score = 62.4 bits (150), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 43/125 (34%), Positives = 62/125 (49%), Gaps = 9/125 (7%)

Query: 330 PRPSRSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLVVADLAG 383
           P   R H    Q +T      +SDP+ LQ I         +R   IA EG ++V AD + 
Sbjct: 655 PVSGRVHTSYHQAVTATGRLSSSDPN-LQNIPVRNDEGRRIRQAFIAPEGYRIVAADYSQ 713

Query: 384 IEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQG 443
           IE R++A ++ ++  LKAF  GED++  T A  F +   +VT +QR   K +   L Y  
Sbjct: 714 IELRIMAHLSQDEGLLKAFAAGEDIHRATAAEVFGLPLDKVTNEQRRSAKAINFGLIY-- 771

Query: 444 GAKAF 448
           G  AF
Sbjct: 772 GMSAF 776


>gi|4731571|gb|AAD28505.1|AF121780_1 DNA polymerase I [Rhodothermus marinus]
          Length = 924

 Score = 62.4 bits (150), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 37/117 (31%), Positives = 59/117 (50%), Gaps = 5/117 (4%)

Query: 330 PRPSRSHEELDQIITHLPTSITSDPDPLQI-----ISDCVRSCVIASEGKKLVVADLAGI 384
           P   R H   +Q +T      +S+P+   I     +   +R   +   G KL+ AD   I
Sbjct: 645 PETGRIHTTFNQTVTATGRLSSSNPNLQNIPVRTEMGREIRRAFVPRPGWKLLSADYVQI 704

Query: 385 EARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGY 441
           E R+LA ++G++   +AF  G+D++  T AR F V P QVT +QR   K++   + Y
Sbjct: 705 ELRILAALSGDEALRRAFLEGQDIHTATAARVFKVPPEQVTPEQRRRAKMVNYGIPY 761


>gi|312795716|ref|YP_004028638.1| DNA polymerase I [Burkholderia rhizoxinica HKI 454]
 gi|312167491|emb|CBW74494.1| DNA polymerase I (EC 2.7.7.7) [Burkholderia rhizoxinica HKI 454]
          Length = 927

 Score = 62.4 bits (150), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 53/94 (56%), Gaps = 3/94 (3%)

Query: 364 VRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQ 423
           +R   IA  G  +V AD + IE R++A ++G+   + AFE GED++  T +  F V   +
Sbjct: 688 IREAFIAPPGSSIVSADYSQIELRIMAHISGDASLMAAFEHGEDVHRATASEIFGVTRQE 747

Query: 424 VTKDQRAIGKVMELALGYQGGAKAFQKMASTTGL 457
           VT +QR I KV+   L Y  G  AF  +AS  G+
Sbjct: 748 VTSEQRRIAKVINFGLIY--GMSAF-GLASNLGI 778


>gi|268316907|ref|YP_003290626.1| DNA polymerase I [Rhodothermus marinus DSM 4252]
 gi|262334441|gb|ACY48238.1| DNA polymerase I [Rhodothermus marinus DSM 4252]
          Length = 924

 Score = 62.4 bits (150), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 37/117 (31%), Positives = 59/117 (50%), Gaps = 5/117 (4%)

Query: 330 PRPSRSHEELDQIITHLPTSITSDPDPLQI-----ISDCVRSCVIASEGKKLVVADLAGI 384
           P   R H   +Q +T      +S+P+   I     +   +R   +   G KL+ AD   I
Sbjct: 645 PETGRIHTTFNQTVTATGRLSSSNPNLQNIPVRTEMGREIRRAFVPRPGWKLLSADYVQI 704

Query: 385 EARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGY 441
           E R+LA ++G++   +AF  G+D++  T AR F V P QVT +QR   K++   + Y
Sbjct: 705 ELRILAALSGDEALRRAFLEGQDIHTATAARVFKVPPEQVTPEQRRRAKMVNYGIPY 761


>gi|295098757|emb|CBK87846.1| DNA polymerase I [Eubacterium cylindroides T2-87]
          Length = 687

 Score = 62.4 bits (150), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 65/121 (53%), Gaps = 7/121 (5%)

Query: 327 QNLPRPSRSHEELDQIITHLPTSITSDPDPLQIIS------DCVRSCVIASEGKKLVVAD 380
           +++ + S+ H   +Q +T      +SDP+ LQ IS        +R   +A +G KL+ AD
Sbjct: 406 KHIQQDSKIHTCFNQAMTQTGRLSSSDPN-LQNISVRDEQGREIRKAFVAQKGYKLLSAD 464

Query: 381 LAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALG 440
            + IE R+LA MA E   ++AF+ G D++  T +  F+V+   VT D R + K +   + 
Sbjct: 465 YSQIELRMLAHMANETHMIEAFKEGADIHNRTASHIFHVSQEDVTPDMRRVAKTVNFGIV 524

Query: 441 Y 441
           Y
Sbjct: 525 Y 525


>gi|4090935|gb|AAC98908.1| DNA polymerase type I [Rhodothermus sp. 'ITI 518']
          Length = 924

 Score = 62.4 bits (150), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 37/117 (31%), Positives = 59/117 (50%), Gaps = 5/117 (4%)

Query: 330 PRPSRSHEELDQIITHLPTSITSDPDPLQI-----ISDCVRSCVIASEGKKLVVADLAGI 384
           P   R H   +Q +T      +S+P+   I     +   +R   +   G KL+ AD   I
Sbjct: 645 PETGRIHTTFNQTVTATGRLSSSNPNLQNIPVRTEMGREIRRAFVPRPGWKLLSADYVQI 704

Query: 385 EARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGY 441
           E R+LA ++G++   +AF  G+D++  T AR F V P QVT +QR   K++   + Y
Sbjct: 705 ELRILAALSGDEALRRAFLEGQDIHTATAARVFKVPPEQVTPEQRRRAKMVNYGIPY 761


>gi|119963436|ref|YP_947809.1| DNA polymerase I [Arthrobacter aurescens TC1]
 gi|119950295|gb|ABM09206.1| DNA polymerase I [Arthrobacter aurescens TC1]
          Length = 880

 Score = 62.4 bits (150), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 66/211 (31%), Positives = 97/211 (45%), Gaps = 34/211 (16%)

Query: 237 EKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLNTLVE 296
           ++L+T LF E GL      ++      +S K L  +    F  ++ A R +  KL  +VE
Sbjct: 535 KQLQTVLFDELGLPKTKKIKSGYTTDAASLKGLLEKTGHEFLVQLMAHRESS-KLAQMVE 593

Query: 297 AMN----SDGRLRGTL-QFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSIT 351
            +      D R+  T  Q + A  TGR S      QN+P   RS E              
Sbjct: 594 TLKKSVADDARIHTTYAQNIAA--TGRISSNNPNLQNIP--VRSEE-------------- 635

Query: 352 SDPDPLQIISDCVRSCVIASEGKK-LVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYV 410
                       VRS  + SEG + L+ AD + IE R++A ++G+Q  ++A++ GEDL+ 
Sbjct: 636 ---------GRRVRSIFMVSEGYECLLSADYSQIEMRIMAHLSGDQALIQAYKDGEDLHR 686

Query: 411 TTYARSFNVAPAQVTKDQRAIGKVMELALGY 441
              AR FNV PA+VT   R+  K M   L Y
Sbjct: 687 FVGARIFNVEPAEVTSAMRSKVKAMSYGLAY 717


>gi|330831571|ref|YP_004394523.1| DNA polymerase I [Aeromonas veronii B565]
 gi|328806707|gb|AEB51906.1| DNA polymerase I [Aeromonas veronii B565]
          Length = 921

 Score = 62.0 bits (149), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 44/125 (35%), Positives = 60/125 (48%), Gaps = 9/125 (7%)

Query: 330 PRPSRSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLVVADLAG 383
           P+  R H    Q +       +SDP+ LQ I         +R   I S G KLV AD + 
Sbjct: 642 PQTGRVHTSYHQAVAATGRLSSSDPN-LQNIPVRNEQGRRIRQAFIPSAGYKLVAADYSQ 700

Query: 384 IEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQG 443
           IE R++A ++G++  L AF  G+D++  T A  F VA   VT D R   K +   L Y  
Sbjct: 701 IELRIMAHLSGDKGLLTAFAEGKDIHKATAAEVFGVAIDAVTTDMRRSAKAINFGLIY-- 758

Query: 444 GAKAF 448
           G  AF
Sbjct: 759 GMSAF 763


>gi|120603488|ref|YP_967888.1| DNA polymerase I [Desulfovibrio vulgaris DP4]
 gi|120563717|gb|ABM29461.1| DNA polymerase I [Desulfovibrio vulgaris DP4]
          Length = 1015

 Score = 62.0 bits (149), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 44/140 (31%), Positives = 65/140 (46%), Gaps = 8/140 (5%)

Query: 333 SRSHEELDQIITHLPTSITSDPDPLQI-----ISDCVRSCVIASEGKKLVVADLAGIEAR 387
            R H   +Q+ T      +S+P+   I     +   +RSC  A+EG  LV AD + IE R
Sbjct: 736 GRIHSTFNQLATATGRLSSSNPNLQNIPARGDLGRRMRSCFTAAEGNLLVSADYSQIELR 795

Query: 388 VLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKA 447
           VLA M+ +   L AF  G D++  T    ++ AP  VT DQR   K +   L Y  G   
Sbjct: 796 VLAHMSQDPTLLAAFREGADIHRRTAGLLYDTAPEDVTPDQRRNAKTINFGLIYGMGP-- 853

Query: 448 FQKMASTTGLNLNTFAHLVK 467
            QK+     + +N     ++
Sbjct: 854 -QKLGQELRITVNEAKQFIE 872


>gi|325954851|ref|YP_004238511.1| DNA polymerase I [Weeksella virosa DSM 16922]
 gi|323437469|gb|ADX67933.1| DNA polymerase I [Weeksella virosa DSM 16922]
          Length = 941

 Score = 62.0 bits (149), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 36/96 (37%), Positives = 58/96 (60%), Gaps = 4/96 (4%)

Query: 364 VRSCVIASEGK-KLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPA 422
           +R   IA   + K++ AD + IE R++A MA +   +KAF+ GED++ +T A+ F VA  
Sbjct: 702 IRKAFIARNPEYKIISADYSQIELRLIAQMAQDPVMVKAFQDGEDIHASTAAKIFGVALD 761

Query: 423 QVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLN 458
           +VT++QR+  K +   + Y  G  AF  +A  TGL+
Sbjct: 762 EVTREQRSQAKTVNFGIIY--GVSAF-GLAQQTGLS 794


>gi|310687606|dbj|BAJ23222.1| DNA dependent DNA polymerase [Thermotoga petrophila]
          Length = 893

 Score = 62.0 bits (149), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 44/140 (31%), Positives = 69/140 (49%), Gaps = 25/140 (17%)

Query: 302 GRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITSDPDPLQIIS 361
           GR+  +    G + TGR S      QNLP  S   +E+ + I      +  DP+      
Sbjct: 620 GRIHASFNQTGTA-TGRLSSSDPNLQNLPTKSEEGKEIRKAI------VPQDPNWW---- 668

Query: 362 DCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAP 421
                         +V AD + IE R+LA ++G++  LKAFE G D++  T +R FNV P
Sbjct: 669 --------------IVSADYSQIELRILAHLSGDENLLKAFEEGIDVHTLTASRIFNVKP 714

Query: 422 AQVTKDQRAIGKVMELALGY 441
            +VT++ R  GK++  ++ Y
Sbjct: 715 EEVTEEMRRAGKMVNFSIIY 734


>gi|229587657|ref|YP_002869776.1| DNA polymerase I [Pseudomonas fluorescens SBW25]
 gi|229359523|emb|CAY46364.1| DNA polymerase I [Pseudomonas fluorescens SBW25]
          Length = 929

 Score = 62.0 bits (149), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 45/144 (31%), Positives = 66/144 (45%), Gaps = 10/144 (6%)

Query: 324 FPPQNLPRPSRSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLV 377
            P Q  PR  R H    Q +       +SDP+ LQ I         +R   IA +G K++
Sbjct: 645 LPEQINPRTGRIHTSYHQAVAATGRLSSSDPN-LQNIPVRTAEGRRIRQAFIAPKGYKML 703

Query: 378 VADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMEL 437
            AD + IE R++A ++ ++  + AF    D++  T A  F V    VT DQR   K +  
Sbjct: 704 AADYSQIELRIMAHLSKDEGLMNAFRHNLDVHTATAAEVFKVELGDVTSDQRRSAKAINF 763

Query: 438 ALGYQGGAKAFQKMASTTGLNLNT 461
            L Y  GA   QK+    G++  T
Sbjct: 764 GLIYGMGA---QKLGKDIGVDTKT 784


>gi|317508193|ref|ZP_07965875.1| DNA polymerase family A [Segniliparus rugosus ATCC BAA-974]
 gi|316253522|gb|EFV12910.1| DNA polymerase family A [Segniliparus rugosus ATCC BAA-974]
          Length = 602

 Score = 62.0 bits (149), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 90/391 (23%), Positives = 156/391 (39%), Gaps = 70/391 (17%)

Query: 169 REIFKRLEPLSSK-----EQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELE 223
           R+    L P+S++     E++L  +   +   G+ +DV     L+      R +LD+ + 
Sbjct: 203 RQKLSPLVPVSARGLVGYERDLAEVCSVMERTGFLLDVDYTRKLST-----RLRLDESVA 257

Query: 224 S---LTYGL--VSSSR----CLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAI 274
           S   L+YG   V+S+      LE++  W+   T    + + +T   ++     +     I
Sbjct: 258 SEIALSYGCENVNSTDQVADVLEQMGAWIPGRTPTGKKQVNDTLLAQLAKDGNEFARSVI 317

Query: 275 QVFNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSR 334
               +  +A +     ++  ++ ++ DGR   ++  L A RT R S    P Q LP    
Sbjct: 318 ----DAKKAGKWRKTWVDRFLQTVDPDGRCHASINPLQA-RTARMSITEIPAQTLPAGDW 372

Query: 335 SHEELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAG 394
                                        +R C +A EG+ +   D    E RVLA ++G
Sbjct: 373 ----------------------------MIRRCFLADEGELIASVDYQAQELRVLAALSG 404

Query: 395 EQWKLKAFETGEDLYVTTYARSFNVAPAQVTKD--QRAIGKVMELALGYQGGAKAFQKMA 452
           +   ++AF  G+DL++ T   +F      +TKD  +R   KV+     Y GGAK    ++
Sbjct: 405 DPTMIRAFAEGQDLHLLTARAAFG---DHITKDDPERKYAKVVNFGRVYGGGAKT---VS 458

Query: 453 STTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQ 512
             TGL       +V      + ++ A    R +     E A++   I T   RV      
Sbjct: 459 EQTGLGFMAAKQVV------DGFDKAYPGVRVLSHKLQEEAVKSGQIVTPTGRVLPV--- 509

Query: 513 KHSRVSELWNELHQAFEQTIENGKAIIARKR 543
              R     N L Q+  + +  GKA+I   R
Sbjct: 510 DQDRAYAALNYLIQSTSRDV-TGKALIRLHR 539


>gi|308390081|gb|ADO32401.1| DNA polymerase I [Neisseria meningitidis alpha710]
 gi|325135575|gb|EGC58193.1| DNA polymerase I [Neisseria meningitidis M0579]
 gi|325201379|gb|ADY96833.1| DNA polymerase I [Neisseria meningitidis M01-240149]
 gi|325207360|gb|ADZ02812.1| DNA polymerase I [Neisseria meningitidis NZ-05/33]
          Length = 929

 Score = 62.0 bits (149), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 51/99 (51%)

Query: 364 VRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQ 423
           VR    A +G  +V AD + IE R++A ++G++  + AF+ GED++  T A  F +AP  
Sbjct: 689 VRRAFTAPQGSVIVSADYSQIELRIMAHLSGDKTLITAFQNGEDVHRRTAAEVFGIAPEN 748

Query: 424 VTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTF 462
           V+ +QR   K +   L Y  G     K      ++  TF
Sbjct: 749 VSSEQRRYAKTINFGLIYGMGQYGLAKSLGIDNISAKTF 787


>gi|145301031|ref|YP_001143872.1| DNA polymerase I [Aeromonas salmonicida subsp. salmonicida A449]
 gi|142853803|gb|ABO92124.1| DNA polymerase I [Aeromonas salmonicida subsp. salmonicida A449]
          Length = 918

 Score = 62.0 bits (149), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 44/125 (35%), Positives = 60/125 (48%), Gaps = 9/125 (7%)

Query: 330 PRPSRSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLVVADLAG 383
           P+  R H    Q +       +SDP+ LQ I         +R   I S G KLV AD + 
Sbjct: 639 PQTGRVHTSYHQAVAATGRLSSSDPN-LQNIPVRNEQGRRIRQAFIPSAGYKLVAADYSQ 697

Query: 384 IEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQG 443
           IE R++A ++G++  L AF  G+D++  T A  F VA   VT D R   K +   L Y  
Sbjct: 698 IELRIMAHLSGDKGLLTAFAEGKDIHKATAAEVFGVALDAVTTDMRRSAKAINFGLIY-- 755

Query: 444 GAKAF 448
           G  AF
Sbjct: 756 GMSAF 760


>gi|288870561|ref|ZP_06409803.1| DNA-directed DNA polymerase [Clostridium hathewayi DSM 13479]
 gi|288866720|gb|EFC99018.1| DNA-directed DNA polymerase [Clostridium hathewayi DSM 13479]
          Length = 653

 Score = 62.0 bits (149), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 42/133 (31%), Positives = 66/133 (49%), Gaps = 1/133 (0%)

Query: 324 FPPQNLPRPSRSHEELDQIITHLPTSITSDPDPLQIISDC-VRSCVIASEGKKLVVADLA 382
            P Q  P   R H +  QI          +P+  QI  +   RSC  A +G+KL++AD +
Sbjct: 378 IPAQIHPVTHRLHPKYMQIGAWSGRMSCYNPNIQQIPREADFRSCFTAPDGRKLILADYS 437

Query: 383 GIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQ 442
            IE RV A ++G+     A + GEDL+  T +   ++  +QVTK QR   K +   L + 
Sbjct: 438 QIELRVAAQISGDSRMKSACQKGEDLHALTASLISSIPVSQVTKAQRQAAKAVNFGLIFG 497

Query: 443 GGAKAFQKMASTT 455
            GA+  ++ A  +
Sbjct: 498 MGAEGLKQYAGQS 510


>gi|224823577|ref|ZP_03696686.1| DNA polymerase I [Lutiella nitroferrum 2002]
 gi|224604032|gb|EEG10206.1| DNA polymerase I [Lutiella nitroferrum 2002]
          Length = 887

 Score = 62.0 bits (149), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 48/147 (32%), Positives = 67/147 (45%), Gaps = 9/147 (6%)

Query: 308 LQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITSDPDPLQII------S 361
           LQ+ G ++         P    P   R H    Q +       +SDP+ LQ I       
Sbjct: 587 LQYRGLAKLKSTYTDKLPSLIRPDTGRVHTNYAQAVAITGRLSSSDPN-LQNIPVRTAEG 645

Query: 362 DCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAP 421
             VR   IA  G ++V AD + IE R++A ++ +   L AF +GED++ TT A  F V  
Sbjct: 646 RRVREAFIAPPGHRIVSADYSQIELRIMAHLSDDANMLAAFASGEDIHKTTAAEVFGVTR 705

Query: 422 AQVTKDQRAIGKVMELALGYQGGAKAF 448
            QVT +QR   K +   L Y  G  AF
Sbjct: 706 EQVTSEQRRAAKAINFGLIY--GMSAF 730


>gi|309791689|ref|ZP_07686181.1| DNA polymerase I [Oscillochloris trichoides DG6]
 gi|308226311|gb|EFO80047.1| DNA polymerase I [Oscillochloris trichoides DG6]
          Length = 951

 Score = 62.0 bits (149), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 41/125 (32%), Positives = 65/125 (52%), Gaps = 9/125 (7%)

Query: 330 PRPSRSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLVVADLAG 383
           PR  R H   +Q+        ++DP+ LQ I         +R   +A+ G + + AD + 
Sbjct: 664 PRTGRVHTTYNQVGAATGRLSSNDPN-LQNIPVRTQEGREIRRGFVAAPGHRFIAADYSQ 722

Query: 384 IEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQG 443
           IE RVLA++  +   ++AF+ G+D++  T A+ F VA  QV K+QR I K +   + Y  
Sbjct: 723 IELRVLAYITKDPNLVRAFQEGQDIHAATAAQLFGVAIDQVDKEQRRIAKTVVFGVIY-- 780

Query: 444 GAKAF 448
           G  AF
Sbjct: 781 GISAF 785


>gi|46578911|ref|YP_009719.1| DNA polymerase I [Desulfovibrio vulgaris str. Hildenborough]
 gi|46448323|gb|AAS94978.1| DNA polymerase I [Desulfovibrio vulgaris str. Hildenborough]
 gi|311232769|gb|ADP85623.1| DNA polymerase I [Desulfovibrio vulgaris RCH1]
          Length = 1015

 Score = 61.6 bits (148), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 44/140 (31%), Positives = 65/140 (46%), Gaps = 8/140 (5%)

Query: 333 SRSHEELDQIITHLPTSITSDPDPLQI-----ISDCVRSCVIASEGKKLVVADLAGIEAR 387
            R H   +Q+ T      +S+P+   I     +   +RSC  A+EG  LV AD + IE R
Sbjct: 736 GRIHSTFNQLATATGRLSSSNPNLQNIPARGDLGRRMRSCFTAAEGNLLVSADYSQIELR 795

Query: 388 VLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKA 447
           VLA M+ +   L AF  G D++  T    ++ AP  VT DQR   K +   L Y  G   
Sbjct: 796 VLAHMSQDPTLLAAFREGADIHRRTAGLLYDTAPEDVTPDQRRNAKTINFGLIYGMGP-- 853

Query: 448 FQKMASTTGLNLNTFAHLVK 467
            QK+     + +N     ++
Sbjct: 854 -QKLGQELRITVNEAKQFIE 872


>gi|34496234|ref|NP_900449.1| DNA-directed DNA polymerase I [Chromobacterium violaceum ATCC
           12472]
 gi|34102088|gb|AAQ58455.1| DNA-directed DNA polymerase I [Chromobacterium violaceum ATCC
           12472]
          Length = 928

 Score = 61.6 bits (148), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 45/131 (34%), Positives = 63/131 (48%), Gaps = 9/131 (6%)

Query: 324 FPPQNLPRPSRSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLV 377
            P    P+  R H    Q +       ++DP+ LQ I         VR   IA  G ++V
Sbjct: 644 LPTLIYPQTGRVHTTYAQAVAITGRLASNDPN-LQNIPVRTAEGRRVREAFIAPAGWQIV 702

Query: 378 VADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMEL 437
            AD + IE R++A ++ ++  LKAF +GED++  T A  F V  A VT DQR   K +  
Sbjct: 703 SADYSQIELRIMAHLSDDEGMLKAFASGEDIHRATAAEVFGVELAAVTSDQRRAAKAINF 762

Query: 438 ALGYQGGAKAF 448
            L Y  G  AF
Sbjct: 763 GLIY--GMSAF 771


>gi|170289072|ref|YP_001739310.1| DNA polymerase I [Thermotoga sp. RQ2]
 gi|170176575|gb|ACB09627.1| DNA polymerase I [Thermotoga sp. RQ2]
          Length = 893

 Score = 61.6 bits (148), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 44/140 (31%), Positives = 69/140 (49%), Gaps = 25/140 (17%)

Query: 302 GRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITSDPDPLQIIS 361
           GR+  +    G + TGR S      QNLP  S   +E+ + I      +  DP+      
Sbjct: 620 GRIHASFNQTGTA-TGRLSSSDPNLQNLPTKSEEGKEIRKAI------VPQDPNWW---- 668

Query: 362 DCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAP 421
                         +V AD + IE R+LA ++G++  LKAFE G D++  T +R FNV P
Sbjct: 669 --------------IVSADYSQIELRILAHLSGDENLLKAFEEGIDVHTLTASRIFNVKP 714

Query: 422 AQVTKDQRAIGKVMELALGY 441
            +VT++ R  GK++  ++ Y
Sbjct: 715 EEVTEEMRRAGKMVNFSIIY 734


>gi|78358489|ref|YP_389938.1| DNA polymerase I [Desulfovibrio desulfuricans subsp. desulfuricans
           str. G20]
 gi|78220894|gb|ABB40243.1| DNA polymerase I [Desulfovibrio desulfuricans subsp. desulfuricans
           str. G20]
          Length = 931

 Score = 61.6 bits (148), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 55/209 (26%), Positives = 92/209 (44%), Gaps = 15/209 (7%)

Query: 334 RSHEELDQIITHLPTSITSDPDPLQI-----ISDCVRSCVIASEGKKLVVADLAGIEARV 388
           R H   +Q+ T      +S P+   I     +   +R C  A+ G KLV AD + IE RV
Sbjct: 653 RIHTTFNQLATATGRLSSSQPNLQNIPVRGPMGQRMRRCFTAAPGNKLVAADYSQIELRV 712

Query: 389 LAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAF 448
           LA ++ +   +++F   ED++  T    ++V  A VT DQR   K +   L Y  G    
Sbjct: 713 LAHVSADPTLIESFTRNEDIHSRTAGLLYDVTAADVTPDQRRNAKTINFGLIYGMGP--- 769

Query: 449 QKMASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKK 508
           QK+A    + LN     +      E +    +  +   +N  + A E  F+ T   R ++
Sbjct: 770 QKLAQELKVTLNEAKEFI------ERYFSKLSHLKEFYDNVEQSAREHGFVTTLAGR-RR 822

Query: 509 AWRQKHSRVSELWNELHQAFEQTIENGKA 537
              + HS  ++L ++  +    T+  G A
Sbjct: 823 LLPEIHSDNNQLRSQARRQAINTVVQGSA 851


>gi|317494612|ref|ZP_07953025.1| DNA polymerase I [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316917542|gb|EFV38888.1| DNA polymerase I [Enterobacteriaceae bacterium 9_2_54FAA]
          Length = 933

 Score = 61.6 bits (148), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 44/130 (33%), Positives = 64/130 (49%), Gaps = 10/130 (7%)

Query: 326 PQNL-PRPSRSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLVV 378
           PQ + P   R H    Q +T      +SDP+ LQ I         +R   IA +G K+V 
Sbjct: 649 PQMINPATGRVHTSYHQAVTATGRLSSSDPN-LQNIPVRNDEGRRIRQAFIAPQGYKIVA 707

Query: 379 ADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELA 438
           AD + IE R++A ++G++  L AF  G+D++  T A  F +    VT +QR   K +   
Sbjct: 708 ADYSQIELRIMAHLSGDKGLLTAFAAGKDIHRATAAEVFGLKLEDVTSEQRRSAKAINFG 767

Query: 439 LGYQGGAKAF 448
           L Y  G  AF
Sbjct: 768 LIY--GMSAF 775


>gi|303327432|ref|ZP_07357873.1| DNA polymerase I [Desulfovibrio sp. 3_1_syn3]
 gi|302862372|gb|EFL85305.1| DNA polymerase I [Desulfovibrio sp. 3_1_syn3]
          Length = 922

 Score = 61.6 bits (148), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 39/119 (32%), Positives = 60/119 (50%), Gaps = 5/119 (4%)

Query: 333 SRSHEELDQIITHLPTSITSDPDPLQI-----ISDCVRSCVIASEGKKLVVADLAGIEAR 387
            R H   +Q  T      +S+P+   I     +   +R+C IA  G+ LV AD + +E R
Sbjct: 643 GRIHTTFNQKATATGRLSSSNPNLQNIPVRGPLGKRMRACFIAGPGRTLVSADYSQVELR 702

Query: 388 VLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAK 446
           VLA M+ +   L AF  GED++  T A  +++   +V+ DQR   K +   L Y  GA+
Sbjct: 703 VLAHMSQDAALLDAFRQGEDIHARTAALIYDLQAGEVSPDQRRNAKTINFGLIYGMGAQ 761


>gi|291545365|emb|CBL18473.1| hypothetical protein CK1_00910 [Ruminococcus sp. SR1/5]
          Length = 124

 Score = 61.6 bits (148), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 39/118 (33%), Positives = 61/118 (51%), Gaps = 6/118 (5%)

Query: 1   MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
           M TL ID ET S + L K G+ +Y E  D  ++LFA+  D+ PV++ D      +P+ + 
Sbjct: 1   MKTLSIDIETYSDVPLQKTGVYRYVESPDFEILLFAYSVDNQPVQVIDLACGEQIPKEIL 60

Query: 59  EALENTDVTIVAHNSYFERTVLKACFNLD----IPIHRWICTLVLARSNGLPSALKAV 112
            ALE+  V   A N+ FER  L           +    W C+++ + + GLP +L+ V
Sbjct: 61  LALEDECVIKWAFNATFERICLSRFLGYPTGEYLKPESWRCSMIWSATMGLPLSLEGV 118


>gi|89889486|ref|ZP_01200997.1| DNA polymerase I [Flavobacteria bacterium BBFL7]
 gi|89517759|gb|EAS20415.1| DNA  polymerase I [Flavobacteria bacterium BBFL7]
          Length = 946

 Score = 61.6 bits (148), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 50/175 (28%), Positives = 83/175 (47%), Gaps = 11/175 (6%)

Query: 304 LRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITSDPDPLQII--- 360
           ++  L + G S+         P Q   +  R H    Q +       ++DP+ LQ I   
Sbjct: 641 IQNVLDYRGLSKLKSTYVDALPNQVDAKTQRIHTNYMQTVAATGRLSSTDPN-LQNIPIR 699

Query: 361 ---SDCVRSCVIA-SEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARS 416
                 VR   I   E   L+ AD + IE R++A ++ E+  + AF++GED++ +T A+ 
Sbjct: 700 TERGRQVRKAFIPRDENYTLIAADYSQIELRIIAALSEEENMIAAFQSGEDIHASTAAKV 759

Query: 417 FNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVKTNSA 471
           FNVA   VT++QR+  K +   + Y  G  AF  +++ T L+      L+ T  A
Sbjct: 760 FNVALEDVTREQRSNAKTVNFGIIY--GVSAF-GLSNQTDLSRGEAKELIDTYYA 811


>gi|332304401|ref|YP_004432252.1| DNA polymerase I [Glaciecola agarilytica 4H-3-7+YE-5]
 gi|332171730|gb|AEE20984.1| DNA polymerase I [Glaciecola agarilytica 4H-3-7+YE-5]
          Length = 928

 Score = 61.6 bits (148), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 43/124 (34%), Positives = 62/124 (50%), Gaps = 9/124 (7%)

Query: 331 RPSRSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLVVADLAGI 384
           R  R H    Q IT      +++P+ LQ I         VR   I   G K+V AD + I
Sbjct: 650 RSGRVHTSYHQAITATGRLSSTEPN-LQNIPIRTEQGRRVRQAFIPRPGYKIVAADYSQI 708

Query: 385 EARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGG 444
           E R++A ++ ++  LKAF  G+D++  T A  FNV+  +VT +QR   K +   L Y  G
Sbjct: 709 ELRIMAHLSQDKGLLKAFSQGKDIHTATAAEVFNVSLEEVTTEQRRNAKAINFGLIY--G 766

Query: 445 AKAF 448
             AF
Sbjct: 767 MSAF 770


>gi|261866908|ref|YP_003254830.1| DNA polymerase I [Aggregatibacter actinomycetemcomitans D11S-1]
 gi|261412240|gb|ACX81611.1| DNA polymerase I (POL I) [Aggregatibacter actinomycetemcomitans
           D11S-1]
          Length = 933

 Score = 61.6 bits (148), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 63/125 (50%), Gaps = 9/125 (7%)

Query: 330 PRPSRSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLVVADLAG 383
           P+  R H    Q +T      +SDP+ LQ I         +R   IA +G K++ AD + 
Sbjct: 656 PQTGRVHTSYHQAVTATGRLSSSDPN-LQNIPIRNEAGRRIRQAFIARDGYKIIAADYSQ 714

Query: 384 IEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQG 443
           IE R++A ++ +Q  + AF  G+D++ +T A  F +   QVT +QR   K +   L Y  
Sbjct: 715 IELRIMAHLSNDQGLINAFAQGKDIHRSTAAEIFGLPLEQVTSEQRRNAKAINFGLIY-- 772

Query: 444 GAKAF 448
           G  +F
Sbjct: 773 GMSSF 777


>gi|153005315|ref|YP_001379640.1| DNA polymerase I [Anaeromyxobacter sp. Fw109-5]
 gi|152028888|gb|ABS26656.1| DNA polymerase I [Anaeromyxobacter sp. Fw109-5]
          Length = 899

 Score = 61.6 bits (148), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 42/124 (33%), Positives = 63/124 (50%), Gaps = 7/124 (5%)

Query: 330 PRPSRSHEELDQIITHLPTSITSDPD----PLQI-ISDCVRSCVIASEGKKLVVADLAGI 384
           PR  R H    Q         +SDP+    P++  +S  +R+  +A  G +L+ AD + I
Sbjct: 621 PRDGRIHTTFHQAGAATGRLSSSDPNLQNIPVRTELSRRIRAAFVAPPGWRLLSADYSQI 680

Query: 385 EARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGG 444
           E R+LA  + +   L+AF   ED++  T A +F VA  +VT D R I KV+   + Y  G
Sbjct: 681 ELRILAHYSDDPALLEAFRLREDVHTRTAAETFGVATGEVTSDMRRIAKVLNFGIAY--G 738

Query: 445 AKAF 448
             AF
Sbjct: 739 LSAF 742


>gi|197116765|ref|YP_002137192.1| DNA polymerase I [Geobacter bemidjiensis Bem]
 gi|197086125|gb|ACH37396.1| DNA polymerase I [Geobacter bemidjiensis Bem]
          Length = 892

 Score = 61.6 bits (148), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 48/164 (29%), Positives = 71/164 (43%), Gaps = 7/164 (4%)

Query: 305 RGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITSDPDPLQII---- 360
           R  LQ+   S+         P    P   R H   +Q +T      +SDP+ LQ I    
Sbjct: 589 RLLLQYRSISKLKSTYTDALPKLVDPATGRVHTSYNQAVTSTGRLSSSDPN-LQNIPIRG 647

Query: 361 --SDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFN 418
                +R   IA  G  ++ AD + IE RVLA ++G++   +AF  GED++  T +  F 
Sbjct: 648 EEGRGIRRAFIAEPGSLMLSADYSQIELRVLAHLSGDRVLCEAFAAGEDIHRRTASEVFG 707

Query: 419 VAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTF 462
           + P  VT + R   KV+   + Y  GA +  K    T      F
Sbjct: 708 MFPELVTSEMRRQAKVINFGVIYGQGAFSLAKELGVTPKQAKAF 751


>gi|289207231|ref|YP_003459297.1| DNA polymerase I [Thioalkalivibrio sp. K90mix]
 gi|288942862|gb|ADC70561.1| DNA polymerase I [Thioalkalivibrio sp. K90mix]
          Length = 911

 Score = 61.6 bits (148), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 45/78 (57%)

Query: 364 VRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQ 423
           +R   IA EG +L+ AD + IE R++A ++ +   LKAF  G+D++  T A  F + P Q
Sbjct: 672 IRRAFIAEEGHQLLAADYSQIELRIMAHLSQDAGLLKAFAEGQDIHRATAAEVFGLDPEQ 731

Query: 424 VTKDQRAIGKVMELALGY 441
           V+ DQR   K +   L Y
Sbjct: 732 VSGDQRRAAKAINFGLIY 749


>gi|218282129|ref|ZP_03488428.1| hypothetical protein EUBIFOR_01003 [Eubacterium biforme DSM 3989]
 gi|218216922|gb|EEC90460.1| hypothetical protein EUBIFOR_01003 [Eubacterium biforme DSM 3989]
          Length = 858

 Score = 61.6 bits (148), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 38/114 (33%), Positives = 58/114 (50%), Gaps = 7/114 (6%)

Query: 334 RSHEELDQIITHLPTSITSDPDPLQIIS------DCVRSCVIASEGKKLVVADLAGIEAR 387
           + H   +Q +T      +S+P+ LQ IS        +R   +A EG  L+ AD + IE R
Sbjct: 584 KIHTSFNQTMTQTGRLSSSEPN-LQNISIRDELGKEIRKAFVAQEGYHLLSADYSQIELR 642

Query: 388 VLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGY 441
           +LA MA E   +KAF  G D++  T    FN +P +V + +R I K +   + Y
Sbjct: 643 MLAHMANEDHMIKAFNEGLDIHTKTATLIFNCSPEEVDEHKRRIAKTVNFGIVY 696


>gi|310658711|ref|YP_003936432.1| DNA polymerase I [Clostridium sticklandii DSM 519]
 gi|308825489|emb|CBH21527.1| DNA polymerase I [Clostridium sticklandii]
          Length = 888

 Score = 61.6 bits (148), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 36/117 (30%), Positives = 62/117 (52%), Gaps = 5/117 (4%)

Query: 330 PRPSRSHEELDQIITHLPTSITSDPD----PLQI-ISDCVRSCVIASEGKKLVVADLAGI 384
           P+  R H   +Q IT      +++P+    P+++ I   +R   +A E   LV AD + I
Sbjct: 610 PKTGRIHSSFNQTITTTGRISSTEPNMQNIPVRLEIGRELRKVFVAPEDMYLVDADYSQI 669

Query: 385 EARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGY 441
           E R+LA +A ++  + AF  G+D++  T +  FNV   +VTK+ R+  K +   + Y
Sbjct: 670 ELRILAHIANDEGLIDAFSKGDDIHTITASEVFNVPLDEVTKELRSAAKAVNFGIVY 726


>gi|170077895|ref|YP_001734533.1| DNA polymerase I [Synechococcus sp. PCC 7002]
 gi|169885564|gb|ACA99277.1| DNA-directed DNA polymerase I [Synechococcus sp. PCC 7002]
          Length = 973

 Score = 61.2 bits (147), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 40/132 (30%), Positives = 66/132 (50%), Gaps = 6/132 (4%)

Query: 330 PRPSRSHEELDQIITHLPTSITSDPDPLQI-----ISDCVRSCVIASEGKKLVVADLAGI 384
           P+  R H + +Q +T      +S+P+   I      S  +R   I  E   LV AD + I
Sbjct: 678 PKTDRIHTDFNQTLTSTGRLSSSNPNLQNIPVRTEFSQRIRRAFIPKENWVLVAADYSQI 737

Query: 385 EARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNV-APAQVTKDQRAIGKVMELALGYQG 443
           E R+L  ++ E   L+A++ GED++  T    F+  +P  VT  +R IGK++   + Y  
Sbjct: 738 ELRILTHLSQEPILLQAYQAGEDVHRVTAQMIFDRDSPQAVTAAERRIGKIINFGVIYGM 797

Query: 444 GAKAFQKMASTT 455
           GA+ F + A  +
Sbjct: 798 GAQRFAREAGVS 809


>gi|327478747|gb|AEA82057.1| DNA polymerase I [Pseudomonas stutzeri DSM 4166]
          Length = 914

 Score = 61.2 bits (147), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 45/131 (34%), Positives = 62/131 (47%), Gaps = 9/131 (6%)

Query: 324 FPPQNLPRPSRSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLV 377
            P Q  PR  R H    Q +T      +SDP+ LQ I         +R   +A+ G KL+
Sbjct: 630 LPQQINPRTGRIHTSYHQAVTATGRLSSSDPN-LQNIPIRTAEGRRIRQAFVAAPGYKLL 688

Query: 378 VADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMEL 437
            AD + IE R++A +A +   L AF+   D++  T A  F V   QV+ DQR   K +  
Sbjct: 689 AADYSQIELRIMAHLAQDAGLLHAFQNDLDVHRATAAEVFGVPLEQVSNDQRRSAKAINF 748

Query: 438 ALGYQGGAKAF 448
            L Y  G  AF
Sbjct: 749 GLIY--GMSAF 757


>gi|311113501|ref|YP_003984723.1| DNA-directed DNA polymerase I [Rothia dentocariosa ATCC 17931]
 gi|310944995|gb|ADP41289.1| DNA-directed DNA polymerase I [Rothia dentocariosa ATCC 17931]
          Length = 955

 Score = 61.2 bits (147), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 69/276 (25%), Positives = 116/276 (42%), Gaps = 39/276 (14%)

Query: 182 EQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSSS----RCLE 237
           E  L Y+   +   G  V  AL + LN       +  +++ + L  G V+        ++
Sbjct: 540 ELPLLYVLADMEQAGIAVSDALLNELNDTFSSRASMAEEQAKVLIGGDVNGEPLNLASVK 599

Query: 238 KLKTWLFLETGL----HLEDLTETTCQRVLSSNKKLTPQ--------AIQVFNNRMRASR 285
           +L+T LF   GL     ++    T  + V     K++P+        A+Q + + ++  +
Sbjct: 600 QLQTVLFERLGLPKTRKIKSGYSTDSESVADLLTKVSPESDGAQFLIALQAYRDNIKLKQ 659

Query: 286 SAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITH 345
           +    +  L +A  +DGR+  T Q   AS TGR S      QN+P  +     +      
Sbjct: 660 T----VEGLQKAAVADGRVHTTFQQNAAS-TGRLSSTAPNLQNIPIRTDEGRRIRGAFIV 714

Query: 346 LPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETG 405
            P            I D V       E + L+ AD + IE R++  +A ++  ++A+  G
Sbjct: 715 APK-----------ILDGV-------EYEGLLTADYSQIEMRIMVHLAADEKLIQAYADG 756

Query: 406 EDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGY 441
           EDL+    +  F VAP +VT   RA  K M   L Y
Sbjct: 757 EDLHRYVGSEVFGVAPEEVTPQMRAKVKAMSYGLAY 792


>gi|293391271|ref|ZP_06635605.1| DNA polymerase I [Aggregatibacter actinomycetemcomitans D7S-1]
 gi|290951805|gb|EFE01924.1| DNA polymerase I [Aggregatibacter actinomycetemcomitans D7S-1]
          Length = 933

 Score = 61.2 bits (147), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 63/125 (50%), Gaps = 9/125 (7%)

Query: 330 PRPSRSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLVVADLAG 383
           P+  R H    Q +T      +SDP+ LQ I         +R   IA +G K++ AD + 
Sbjct: 656 PQTGRVHTSYHQAVTATGRLSSSDPN-LQNIPIRNEAGRRIRQAFIARDGYKIIAADYSQ 714

Query: 384 IEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQG 443
           IE R++A ++ +Q  + AF  G+D++ +T A  F +   QVT +QR   K +   L Y  
Sbjct: 715 IELRIMAHLSNDQGLINAFAQGKDIHRSTAAEIFGLPLEQVTSEQRRNAKAINFGLIY-- 772

Query: 444 GAKAF 448
           G  +F
Sbjct: 773 GMSSF 777


>gi|257092739|ref|YP_003166380.1| DNA polymerase I [Candidatus Accumulibacter phosphatis clade IIA
           str. UW-1]
 gi|257045263|gb|ACV34451.1| DNA polymerase I [Candidatus Accumulibacter phosphatis clade IIA
           str. UW-1]
          Length = 922

 Score = 61.2 bits (147), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 59/122 (48%), Gaps = 9/122 (7%)

Query: 333 SRSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLVVADLAGIEA 386
            R H    Q +       +SDP+ LQ I         +R+  IA  G  LV AD + IE 
Sbjct: 647 GRVHTSYAQAVAVTGRLASSDPN-LQNIPVRTAEGRRIRAAFIAPPGSSLVSADYSQIEL 705

Query: 387 RVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAK 446
           R++A ++ +   L+AF  GED++  T A  F V P  V  DQR + KV+   L Y  G  
Sbjct: 706 RIMAHLSEDARLLEAFAQGEDVHRATAAEIFGVRPVDVGPDQRRVAKVINFGLIY--GMS 763

Query: 447 AF 448
           AF
Sbjct: 764 AF 765


>gi|70733594|ref|YP_257234.1| DNA polymerase I [Pseudomonas fluorescens Pf-5]
 gi|68347893|gb|AAY95499.1| DNA polymerase I [Pseudomonas fluorescens Pf-5]
          Length = 929

 Score = 61.2 bits (147), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 46/141 (32%), Positives = 64/141 (45%), Gaps = 10/141 (7%)

Query: 324 FPPQNLPRPSRSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLV 377
            P Q  PR  R H    Q +       +SDP+ LQ I         +R   IA  G KL+
Sbjct: 645 LPEQINPRTGRIHTSYHQAVASTGRLSSSDPN-LQNIPVRTAEGRRIRQAFIAPPGYKLL 703

Query: 378 VADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMEL 437
            AD + IE R++A ++ ++  L AF    D++  T A  F V    VT DQR   K +  
Sbjct: 704 AADYSQIELRIMAHLSRDEGLLNAFRNNLDVHTATAAEVFKVELKDVTSDQRRSAKAINF 763

Query: 438 ALGYQGGAKAFQKMASTTGLN 458
            L Y  GA   QK+    G++
Sbjct: 764 GLIYGMGA---QKLGKDIGVD 781


>gi|313631120|gb|EFR98660.1| DNA polymerase [Listeria seeligeri FSL N1-067]
          Length = 80

 Score = 61.2 bits (147), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 27/76 (35%), Positives = 46/76 (60%), Gaps = 3/76 (3%)

Query: 354 PDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTY 413
           PD   ++S  +R+  IA +G    + D + IEARV+AW+AGEQW+L  F +   +Y  + 
Sbjct: 7   PD---VLSQLIRTAFIAEDGYTFDITDFSAIEARVIAWLAGEQWRLDVFNSHGKIYEASA 63

Query: 414 ARSFNVAPAQVTKDQR 429
           ++ F++   +V K+ R
Sbjct: 64  SQMFHIPIEEVDKNLR 79


>gi|119899889|ref|YP_935102.1| DNA polymerase I [Azoarcus sp. BH72]
 gi|119672302|emb|CAL96216.1| DNA polymerase I [Azoarcus sp. BH72]
          Length = 918

 Score = 61.2 bits (147), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 32/87 (36%), Positives = 49/87 (56%)

Query: 364 VRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQ 423
           +R+  IA     +V AD + IE R++A ++G+   L+AF  GED++  T A  F VAP++
Sbjct: 679 IRAAFIAPRDHVIVSADYSQIELRIMAHLSGDARLLEAFAEGEDVHRATAAEVFGVAPSE 738

Query: 424 VTKDQRAIGKVMELALGYQGGAKAFQK 450
           V+ +QR   KV+   L Y   A    K
Sbjct: 739 VSSEQRRYAKVINFGLIYGMSAHGLAK 765


>gi|271964468|ref|YP_003338664.1| DNA-directed DNA polymerase [Streptosporangium roseum DSM 43021]
 gi|270507643|gb|ACZ85921.1| DNA-directed DNA polymerase [Streptosporangium roseum DSM 43021]
          Length = 901

 Score = 61.2 bits (147), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 60/115 (52%), Gaps = 6/115 (5%)

Query: 333 SRSHEELDQIITHLPTSITSDPD----PLQIISDC-VRSCVIASEG-KKLVVADLAGIEA 386
            R H   +QI+       +  P+    P++ +    +R   +   G + L+ AD + IE 
Sbjct: 624 GRIHTTFNQIVAATGRLSSEKPNLQNIPIRTVEGRRIRQGFVVGPGYETLLTADYSQIEL 683

Query: 387 RVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGY 441
           R++A ++G++  + AFE+G D + TT AR F++ P QVT + RA  K M   L Y
Sbjct: 684 RIMAHLSGDESLIAAFESGHDFHKTTAARVFDIEPEQVTGEMRAKIKAMNYGLAY 738


>gi|108759777|ref|YP_631312.1| DNA polymerase I [Myxococcus xanthus DK 1622]
 gi|108463657|gb|ABF88842.1| DNA polymerase I [Myxococcus xanthus DK 1622]
          Length = 908

 Score = 61.2 bits (147), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 44/151 (29%), Positives = 72/151 (47%), Gaps = 26/151 (17%)

Query: 291 LNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSI 350
           L+TL   + +DGR+  T     A+ TGR S      QN+P                   +
Sbjct: 622 LDTLPTLVAADGRIHTTYH-QAATATGRLSSTDPNLQNIP-------------------V 661

Query: 351 TSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYV 410
            +D      +   +R   +A+EG +LV AD + +E R+LA +A +   ++AF   ED++ 
Sbjct: 662 RTD------LGREIRRAFVAAEGHQLVSADYSQVELRLLAHIANDPVLIEAFLHDEDIHT 715

Query: 411 TTYARSFNVAPAQVTKDQRAIGKVMELALGY 441
            T A  F VA  QV ++QR + K++   + Y
Sbjct: 716 RTAAEVFGVAKEQVDREQRRVAKMVNFGIAY 746


>gi|332991521|gb|AEF01576.1| DNA polymerase I [Alteromonas sp. SN2]
          Length = 935

 Score = 61.2 bits (147), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 43/124 (34%), Positives = 60/124 (48%), Gaps = 9/124 (7%)

Query: 331 RPSRSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLVVADLAGI 384
           R  R H    Q IT      ++DP+ LQ I         VR   +  EG K+V AD + I
Sbjct: 657 RTGRVHTSYHQAITATGRLSSTDPN-LQNIPIRNEEGRKVRQAFVPREGYKIVAADYSQI 715

Query: 385 EARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGG 444
           E R++A ++G++  L AF  G D++  T A  F V   +VT +QR   K +   L Y  G
Sbjct: 716 ELRIMAHLSGDEGLLDAFAHGRDIHKATAAEVFGVTLDEVTTEQRRSAKAINFGLIY--G 773

Query: 445 AKAF 448
             AF
Sbjct: 774 MSAF 777


>gi|254804208|ref|YP_003082429.1| DNA polymerase I [Neisseria meningitidis alpha14]
 gi|254667750|emb|CBA03667.1| DNA polymerase I [Neisseria meningitidis alpha14]
          Length = 937

 Score = 61.2 bits (147), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 42/145 (28%), Positives = 65/145 (44%), Gaps = 7/145 (4%)

Query: 324 FPPQNLPRPSRSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLV 377
            P    PR +R H    Q +       +++P+ LQ I         VR    A +G  +V
Sbjct: 645 LPEMISPRDNRVHTTYAQAVAITGRLASNNPN-LQNIPIRTAEGRRVRRAFTAPQGSVIV 703

Query: 378 VADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMEL 437
            AD + IE R++A ++G++  + AF+ GED++  T A  F  AP  V+ +QR   K +  
Sbjct: 704 SADYSQIELRIMAHLSGDKTLIAAFQNGEDVHRRTAAEVFGTAPENVSPEQRRYAKTINF 763

Query: 438 ALGYQGGAKAFQKMASTTGLNLNTF 462
            L Y  G     K      L+   F
Sbjct: 764 GLIYGMGQYGLAKSLGIDNLSAKNF 788


>gi|288941214|ref|YP_003443454.1| DNA polymerase I [Allochromatium vinosum DSM 180]
 gi|288896586|gb|ADC62422.1| DNA polymerase I [Allochromatium vinosum DSM 180]
          Length = 911

 Score = 61.2 bits (147), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 41/122 (33%), Positives = 61/122 (50%), Gaps = 9/122 (7%)

Query: 333 SRSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLVVADLAGIEA 386
            R H    Q +T      +SDP+ LQ I         +R   IA+ G +L+ AD + IE 
Sbjct: 636 GRVHTSYHQAVTATGRLSSSDPN-LQNIPIRTEEGRRIRRAFIAASGHRLLAADYSQIEL 694

Query: 387 RVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAK 446
           R++A ++G++  L AF  G+D++  T A    +AP  VT +QR   K +   L Y  G  
Sbjct: 695 RIMAHLSGDERLLAAFAGGQDIHRATAAEILGLAPEDVTGEQRRSAKAINFGLIY--GMS 752

Query: 447 AF 448
           AF
Sbjct: 753 AF 754


>gi|146329645|ref|YP_001209132.1| DNA polymerase I [Dichelobacter nodosus VCS1703A]
 gi|146233115|gb|ABQ14093.1| DNA polymerase I [Dichelobacter nodosus VCS1703A]
          Length = 901

 Score = 61.2 bits (147), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 63/124 (50%), Gaps = 7/124 (5%)

Query: 330 PRPSRSHEELDQIITHLPTSITSDPD--PLQIISD---CVRSCVIASEGKKLVVADLAGI 384
           P   R H    Q +T      +SDP+   + I SD    +R   IA EG  ++ AD + I
Sbjct: 623 PDSKRVHTSYHQAVTSTGRLSSSDPNLQNIPIRSDEGRRIRQAFIAEEGYSILAADYSQI 682

Query: 385 EARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGG 444
           E R++A ++ ++   +AF+  +D++  T A  F+VAP  V ++QR   K +   L Y  G
Sbjct: 683 ELRIMAHLSQDERLQRAFQLQQDIHTATAAELFSVAPEAVDRNQRRDAKAINFGLIY--G 740

Query: 445 AKAF 448
             AF
Sbjct: 741 MSAF 744


>gi|291615288|ref|YP_003525445.1| DNA polymerase I [Sideroxydans lithotrophicus ES-1]
 gi|291585400|gb|ADE13058.1| DNA polymerase I [Sideroxydans lithotrophicus ES-1]
          Length = 929

 Score = 61.2 bits (147), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 46/139 (33%), Positives = 68/139 (48%), Gaps = 12/139 (8%)

Query: 331 RPSRSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLVVADLAGI 384
           +  R H    Q +       +SDP+ LQ I         +R   I   G ++V AD + I
Sbjct: 652 KTGRVHTSYAQAVAVTGRLASSDPN-LQNIPIRTPEGRRIREAFITPAGSRIVSADYSQI 710

Query: 385 EARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGG 444
           E R++A ++G++  LKAF  GED++  T A  F+VA   V+ +QR   KV+   L Y  G
Sbjct: 711 ELRIMAHLSGDEGLLKAFAAGEDIHRATAAEVFSVALDAVSSEQRRYAKVINFGLIY--G 768

Query: 445 AKAFQKMASTTGLNLNTFA 463
             A+   A    LN+ T A
Sbjct: 769 MSAYGLAAQ---LNIETSA 784


>gi|89092190|ref|ZP_01165144.1| DNA polymerase I [Oceanospirillum sp. MED92]
 gi|89083278|gb|EAR62496.1| DNA polymerase I [Oceanospirillum sp. MED92]
          Length = 922

 Score = 61.2 bits (147), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 44/125 (35%), Positives = 60/125 (48%), Gaps = 9/125 (7%)

Query: 330 PRPSRSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLVVADLAG 383
           P   R H    Q +T      ++DP+ LQ I         +R   IA EG K+V AD + 
Sbjct: 644 PGTGRIHTSYHQAVTATGRLSSTDPN-LQNIPVRTQEGRRIRHAFIAPEGYKVVAADYSQ 702

Query: 384 IEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQG 443
           IE R++A ++ +Q  L AF  G D++  T A  F V   QV+ DQR   K +   L Y  
Sbjct: 703 IELRIMAHLSQDQGLLDAFSKGADIHRATAAEVFKVELDQVSDDQRRSAKAINFGLIY-- 760

Query: 444 GAKAF 448
           G  AF
Sbjct: 761 GMSAF 765


>gi|148828039|ref|YP_001292792.1| DNA polymerase I [Haemophilus influenzae PittGG]
 gi|148719281|gb|ABR00409.1| DNA polymerase I [Haemophilus influenzae PittGG]
          Length = 930

 Score = 61.2 bits (147), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 41/121 (33%), Positives = 62/121 (51%), Gaps = 9/121 (7%)

Query: 334 RSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLVVADLAGIEAR 387
           R H    Q +T      +SDP+ LQ I         +R   IA +G  +V AD + IE R
Sbjct: 657 RVHTSYHQAVTATGRLSSSDPN-LQNIPIRNEEGRRIRQAFIARKGYSIVAADYSQIELR 715

Query: 388 VLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKA 447
           ++A ++G+Q  + AF  G+D++ +T A  F V+  +VT +QR   K +   L Y  G  A
Sbjct: 716 IMAHLSGDQGLINAFSQGKDIHRSTAAEIFGVSLDEVTSEQRRNAKAINFGLIY--GMSA 773

Query: 448 F 448
           F
Sbjct: 774 F 774


>gi|146280510|ref|YP_001170663.1| DNA polymerase I [Pseudomonas stutzeri A1501]
 gi|145568715|gb|ABP77821.1| DNA polymerase I [Pseudomonas stutzeri A1501]
          Length = 931

 Score = 61.2 bits (147), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 45/131 (34%), Positives = 62/131 (47%), Gaps = 9/131 (6%)

Query: 324 FPPQNLPRPSRSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLV 377
            P Q  PR  R H    Q +T      +SDP+ LQ I         +R   +A+ G KL+
Sbjct: 647 LPQQINPRTGRIHTSYHQAVTATGRLSSSDPN-LQNIPIRTAEGRRIRQAFVAAPGYKLL 705

Query: 378 VADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMEL 437
            AD + IE R++A +A +   L AF+   D++  T A  F V   QV+ DQR   K +  
Sbjct: 706 AADYSQIELRIMAHLAQDAGLLHAFQNDLDVHRATAAEVFGVPLEQVSNDQRRSAKAINF 765

Query: 438 ALGYQGGAKAF 448
            L Y  G  AF
Sbjct: 766 GLIY--GMSAF 774


>gi|237807112|ref|YP_002891552.1| DNA polymerase I [Tolumonas auensis DSM 9187]
 gi|237499373|gb|ACQ91966.1| DNA polymerase I [Tolumonas auensis DSM 9187]
          Length = 910

 Score = 61.2 bits (147), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 41/125 (32%), Positives = 60/125 (48%), Gaps = 9/125 (7%)

Query: 330 PRPSRSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLVVADLAG 383
           P   R H    Q +T      +SDP+ LQ I         +R   +A  G K+V AD + 
Sbjct: 631 PSTGRVHTSYHQAVTATGRLSSSDPN-LQNIPVRTEEGRRIRQAFVADHGYKIVAADYSQ 689

Query: 384 IEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQG 443
           IE R++A ++ +   L+AF  G+D++  T A   N+ P  VT +QR   K +   L Y  
Sbjct: 690 IELRIMAHLSEDDGLLQAFAHGQDIHRATAAEIMNITPEAVTSEQRRNAKAINFGLIY-- 747

Query: 444 GAKAF 448
           G  AF
Sbjct: 748 GMSAF 752


>gi|332701547|ref|ZP_08421635.1| DNA polymerase I [Desulfovibrio africanus str. Walvis Bay]
 gi|332551696|gb|EGJ48740.1| DNA polymerase I [Desulfovibrio africanus str. Walvis Bay]
          Length = 882

 Score = 61.2 bits (147), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 97/417 (23%), Positives = 152/417 (36%), Gaps = 118/417 (28%)

Query: 234 RCLEKLKTWLFLETGLHLEDLT----ETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVL 289
           R  ++L   LF   GL  +  T    ++T   VL   +   P    +   RM     +  
Sbjct: 536 RSNQQLAQLLFDRLGLKAKGKTPGGAQSTANPVLEKLRNEHPVVADILEFRMLEKLRSTY 595

Query: 290 KLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTS 349
            L  L +  +  GR+  T   L A+ TGR S      QN+P                   
Sbjct: 596 -LEPLPKLADEQGRIHTTFNQL-ATATGRLSSSAPNLQNIP------------------- 634

Query: 350 ITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLY 409
               P   ++     R+C  A  G  L  AD + IE RVLA M+ +   L+AF  G+D++
Sbjct: 635 -IRGPQGTRM-----RACFTAGPGCLLAAADYSQIELRVLAHMSQDPTLLEAFRHGQDIH 688

Query: 410 VTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVKTN 469
             T    F+    QV  D+R   K +   L Y  G    QK+A+  G+ L          
Sbjct: 689 ARTAGLIFDKDAGQVAPDERRSAKTINFGLLYGMGP---QKLAAELGIAL---------- 735

Query: 470 SAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELHQAFE 529
                   A+ F            IE  F+G              S++ E ++ + +  E
Sbjct: 736 ------AQAKEF------------IERYFVGL-------------SKLKEFYDSIVKEAE 764

Query: 530 QTIENGKAI-IARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNNRSYLNTTTRQLT 588
           Q   NG  + +  +RR +P ++ + D  NL       ++   R   N R           
Sbjct: 765 Q---NGSVVTMLGRRRLLPDIHSRND--NL-------KAQAVRQAINTR----------- 801

Query: 589 REYTYGGKLTENIVQAVSRDILAEGMMNA------TKAGYDIVLTVHDEIVCETPDT 639
                        +Q  + DI+   M+ A         G  ++L VHDE++ ETP+ 
Sbjct: 802 -------------IQGSAADIIKLAMIRAHADEKIRALGGRLILQVHDELLLETPEA 845


>gi|291301241|ref|YP_003512519.1| DNA polymerase I [Stackebrandtia nassauensis DSM 44728]
 gi|290570461|gb|ADD43426.1| DNA polymerase I [Stackebrandtia nassauensis DSM 44728]
          Length = 908

 Score = 61.2 bits (147), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 48/79 (60%), Gaps = 1/79 (1%)

Query: 364 VRSCVIASEG-KKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPA 422
           +R   I +EG + L+  D + IE R++A ++G++  ++AF++GEDL+ T  AR FNV P 
Sbjct: 667 IRQGFIVTEGFETLMTCDYSQIEMRIMAHLSGDEGLIEAFKSGEDLHTTVAARVFNVEPG 726

Query: 423 QVTKDQRAIGKVMELALGY 441
            V  +QR   K M   L Y
Sbjct: 727 SVDAEQRRRIKAMSYGLAY 745


>gi|296314737|ref|ZP_06864678.1| DNA polymerase I [Neisseria polysaccharea ATCC 43768]
 gi|296838474|gb|EFH22412.1| DNA polymerase I [Neisseria polysaccharea ATCC 43768]
          Length = 930

 Score = 60.8 bits (146), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 50/99 (50%)

Query: 364 VRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQ 423
           VR    A +G  +V AD + IE R++A ++G++  + AF+ GED++  T A  F +AP  
Sbjct: 689 VRRAFTAPQGSVIVSADYSQIELRIMAHLSGDKTLIAAFQNGEDVHRRTAAEVFGIAPEN 748

Query: 424 VTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTF 462
           V+ +QR   K +   L Y  G     K      L+   F
Sbjct: 749 VSPEQRRYAKTINFGLIYGMGQYGLAKSLGIDNLSAKNF 787


>gi|148270302|ref|YP_001244762.1| DNA polymerase I [Thermotoga petrophila RKU-1]
 gi|147735846|gb|ABQ47186.1| DNA polymerase I [Thermotoga petrophila RKU-1]
          Length = 893

 Score = 60.8 bits (146), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 43/140 (30%), Positives = 69/140 (49%), Gaps = 25/140 (17%)

Query: 302 GRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITSDPDPLQIIS 361
           GR+  +    G + TGR S      QNLP  S   +E+ + I      +  DP+      
Sbjct: 620 GRIHASFNQTGTA-TGRLSSSDPNLQNLPTKSEEGKEIRKAI------VPQDPNWW---- 668

Query: 362 DCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAP 421
                         +V AD + IE R+LA ++G++  L+AFE G D++  T +R FNV P
Sbjct: 669 --------------IVSADYSQIELRILAHLSGDENLLRAFEEGIDVHTLTASRIFNVKP 714

Query: 422 AQVTKDQRAIGKVMELALGY 441
            +VT++ R  GK++  ++ Y
Sbjct: 715 EEVTEEMRRAGKMVNFSIIY 734


>gi|172040823|ref|YP_001800537.1| DNA polymerase I [Corynebacterium urealyticum DSM 7109]
 gi|171852127|emb|CAQ05103.1| DNA polymerase I [Corynebacterium urealyticum DSM 7109]
          Length = 879

 Score = 60.8 bits (146), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 72/288 (25%), Positives = 126/288 (43%), Gaps = 55/288 (19%)

Query: 188 LDQTINDRG-----YCVDVALAHTLNQI----VDVERTKLDQ---ELESLTYGLVSSSRC 235
           ++Q + D G     + ++V L H L ++    + V++  L++   + E+     V+++R 
Sbjct: 462 MNQELTDAGQAELYFSMEVPLTHILAEMEARGIAVDKAALEELAADYEAQIADEVTAARE 521

Query: 236 L-----------EKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRAS 284
           L           ++L+  LF + GL     T+T      +  +KL  Q    F N + A 
Sbjct: 522 LAEDDQLNLSSPKQLQKVLFEDFGLPKTKKTKTGYSTAAAELEKLQQQTEHPFLNHLMAH 581

Query: 285 R---SAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQ 341
           R        ++ L+ A++ DGR+R T    GA+ TGR S      QN+P  + +  +   
Sbjct: 582 REYQKMKSTIDGLINAIDGDGRIRTTFNQKGAA-TGRLSSSEPNLQNIPVRTEAGRK--- 637

Query: 342 IITHLPTSITSDPDPLQIISDCVRSCVIASEG-KKLVVADLAGIEARVLAWMAGEQWKLK 400
                                 +RS     EG + L+ AD + IE RV+A ++ +   ++
Sbjct: 638 ----------------------IRSAFRVGEGYETLLTADYSQIEMRVMAHLSEDAGLIE 675

Query: 401 AFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAF 448
           A+  GEDL+    +R F+V   +VT + R   K +   L Y  G  AF
Sbjct: 676 AYRAGEDLHNYVGSRVFDVPVDEVTPELRRRVKALSYGLVY--GLSAF 721


>gi|257056582|ref|YP_003134414.1| DNA polymerase I [Saccharomonospora viridis DSM 43017]
 gi|256586454|gb|ACU97587.1| DNA polymerase I [Saccharomonospora viridis DSM 43017]
          Length = 901

 Score = 60.8 bits (146), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 47/150 (31%), Positives = 72/150 (48%), Gaps = 29/150 (19%)

Query: 294 LVEAMNSDGRLRGTL-QFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITS 352
           L++A+  DGR+  TL Q + A  TGR S      QN+P   R+ E               
Sbjct: 616 LIKAVADDGRIHTTLHQTITA--TGRLSSVDPNLQNIP--VRTDE--------------- 656

Query: 353 DPDPLQIISDCVRSCVIASEG-KKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVT 411
                      +R   +  EG  +L+ AD + IE R++A ++ ++  ++AF +G D +  
Sbjct: 657 --------GRRIREAFVVGEGYAELMTADYSQIEMRIMAHLSNDEALIEAFHSGFDFHAA 708

Query: 412 TYARSFNVAPAQVTKDQRAIGKVMELALGY 441
           T AR F+V P +VT +QRA  K M   L Y
Sbjct: 709 TAARVFDVDPTEVTGEQRAKIKAMNYGLAY 738


>gi|258543756|ref|ZP_05703990.1| DNA polymerase I [Cardiobacterium hominis ATCC 15826]
 gi|258520992|gb|EEV89851.1| DNA polymerase I [Cardiobacterium hominis ATCC 15826]
          Length = 881

 Score = 60.8 bits (146), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 42/125 (33%), Positives = 64/125 (51%), Gaps = 9/125 (7%)

Query: 330 PRPSRSHEELDQIITHLPTSITSDPDPLQII---SDC---VRSCVIASEGKKLVVADLAG 383
           P   R H    Q +T      +SDP+ LQ I   S+    +R   IA +G +++ AD + 
Sbjct: 580 PHTGRIHTSYHQAVTSTGRLSSSDPN-LQNIPVRSEAGRRIRRAFIAEDGWQILAADYSQ 638

Query: 384 IEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQG 443
           IE R++A ++ +   L AF  G+D++  T A  F VAP  V+++QR   K +   L Y  
Sbjct: 639 IELRIMAHLSADPGLLAAFARGDDIHRATAAEIFGVAPEAVSREQRRDAKAINFGLIY-- 696

Query: 444 GAKAF 448
           G  AF
Sbjct: 697 GMSAF 701


>gi|239993904|ref|ZP_04714428.1| DNA polymerase I [Alteromonas macleodii ATCC 27126]
          Length = 930

 Score = 60.8 bits (146), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 42/124 (33%), Positives = 60/124 (48%), Gaps = 9/124 (7%)

Query: 331 RPSRSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLVVADLAGI 384
           R  R H    Q +T      ++DP+ LQ I         VR   +  EG K V AD + I
Sbjct: 652 RTGRVHTSYHQAVTATGRLSSTDPN-LQNIPIRNEEGRRVRQAFVPREGNKFVAADYSQI 710

Query: 385 EARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGG 444
           E R++A ++G++  L AF  G+D++  T A  F V   +VT +QR   K +   L Y  G
Sbjct: 711 ELRIMAHLSGDKGLLDAFAHGKDIHKATAAEVFGVPLDEVTTEQRRSAKAINFGLIY--G 768

Query: 445 AKAF 448
             AF
Sbjct: 769 MSAF 772


>gi|33152330|ref|NP_873683.1| DNA polymerase I [Haemophilus ducreyi 35000HP]
 gi|33148553|gb|AAP96072.1| DNA polymerase I [Haemophilus ducreyi 35000HP]
          Length = 962

 Score = 60.8 bits (146), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 38/114 (33%), Positives = 59/114 (51%), Gaps = 7/114 (6%)

Query: 334 RSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLVVADLAGIEAR 387
           R H    Q +T      +SDP+ LQ I         +R   IA +G K+V AD + IE R
Sbjct: 689 RVHTSYHQAVTTTGRLSSSDPN-LQNIPIRTEAGRRIRQAFIARDGYKIVAADYSQIELR 747

Query: 388 VLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGY 441
           ++A +A ++  + AF  G+D++  T A  F ++ A+VT +QR   K +   L Y
Sbjct: 748 IMAHLANDEGMITAFANGQDIHQATAAEIFGLSLAEVTSEQRRSAKAINFGLIY 801


>gi|53728836|ref|ZP_00134878.2| COG0749: DNA polymerase I - 3'-5' exonuclease and polymerase
           domains [Actinobacillus pleuropneumoniae serovar 1 str.
           4074]
 gi|126207957|ref|YP_001053182.1| DNA polymerase I [Actinobacillus pleuropneumoniae L20]
 gi|126096749|gb|ABN73577.1| DNA polymerase I (POL I) [Actinobacillus pleuropneumoniae serovar
           5b str. L20]
          Length = 957

 Score = 60.8 bits (146), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 39/117 (33%), Positives = 59/117 (50%), Gaps = 7/117 (5%)

Query: 331 RPSRSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLVVADLAGI 384
           +  R H    Q +T      +SDP+ LQ I         +R   IA +G K+V AD + I
Sbjct: 681 KTGRVHTSYHQAVTATGRLSSSDPN-LQNIPIRNEEGRRIRQAFIARDGYKIVAADYSQI 739

Query: 385 EARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGY 441
           E R++A +A ++  + AF  G+D++  T A  F +A  QVT +QR   K +   L Y
Sbjct: 740 ELRIMAHLANDEGMITAFAEGKDIHCATAAEIFGLALDQVTSEQRRSAKAINFGLIY 796


>gi|270308554|ref|YP_003330612.1| DNA-directed DNA polymerase I [Dehalococcoides sp. VS]
 gi|270154446|gb|ACZ62284.1| DNA-directed DNA polymerase I [Dehalococcoides sp. VS]
          Length = 903

 Score = 60.8 bits (146), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 46/170 (27%), Positives = 78/170 (45%), Gaps = 24/170 (14%)

Query: 330 PRPSRSHEELDQIITHLPTSITSDPDPLQI-----ISDCVRSCVIASEGKKLVVADLAGI 384
           P   R H   +Q  T      +S+P+   I     +   +R   IA  G  L+  D + I
Sbjct: 625 PHTRRLHTSFNQTRTATGRLSSSEPNLQNIPVRGEMGREIRRAFIAPPGTVLLAGDYSQI 684

Query: 385 EARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGG 444
           + RVLA ++ +   ++AF++ +D++  T AR  NV+P++VTK+QR + K +   + Y   
Sbjct: 685 DLRVLAHLSQDPALIEAFQSDQDIHTATAARLLNVSPSKVTKEQRRLAKTVNFGVIYG-- 742

Query: 445 AKAFQKMASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAI 494
                   S+ GL   T   L          E+A+ F +   E +P  A+
Sbjct: 743 -------MSSYGLEQATELSL----------EEADKFIKAYFEKYPRVAV 775


>gi|300741418|ref|ZP_07071439.1| DNA polymerase I [Rothia dentocariosa M567]
 gi|300380603|gb|EFJ77165.1| DNA polymerase I [Rothia dentocariosa M567]
          Length = 955

 Score = 60.8 bits (146), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 68/276 (24%), Positives = 116/276 (42%), Gaps = 39/276 (14%)

Query: 182 EQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSSS----RCLE 237
           E  L Y+   +   G  V  AL + LN       +  +++ + L  G V+        ++
Sbjct: 540 ELPLLYVLADMEQAGIAVSDALLNELNDTFSSRASMAEEQAKVLIGGDVNGEPLNLASVK 599

Query: 238 KLKTWLFLETGL----HLEDLTETTCQRVLSSNKKLTPQ--------AIQVFNNRMRASR 285
           +L+T LF   GL     ++    T  + V     K++P+        A+Q + + ++  +
Sbjct: 600 QLQTVLFERLGLPKTRKIKSGYSTDSESVADLLTKVSPESDGAQFLIALQAYRDNIKLKQ 659

Query: 286 SAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITH 345
           +    +  L +A  +DGR+  T Q   AS TGR S      QN+P  +     +      
Sbjct: 660 T----VEGLQKAAVTDGRVHTTFQQNAAS-TGRLSSTAPNLQNIPIRTDEGRRIRGAFIV 714

Query: 346 LPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETG 405
            P            + D V       E + L+ AD + IE R++  +A ++  ++A+  G
Sbjct: 715 APK-----------VLDGV-------EYEGLLTADYSQIEMRIMVHLAADEKLIQAYADG 756

Query: 406 EDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGY 441
           EDL+    +  F VAP +VT   RA  K M   L Y
Sbjct: 757 EDLHRYVGSEVFGVAPEEVTPQMRAKVKAMSYGLAY 792


>gi|281412608|ref|YP_003346687.1| DNA polymerase I [Thermotoga naphthophila RKU-10]
 gi|281373711|gb|ADA67273.1| DNA polymerase I [Thermotoga naphthophila RKU-10]
          Length = 893

 Score = 60.8 bits (146), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 43/140 (30%), Positives = 69/140 (49%), Gaps = 25/140 (17%)

Query: 302 GRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITSDPDPLQIIS 361
           GR+  +    G + TGR S      QNLP  S   +E+ + I      +  DP+      
Sbjct: 620 GRIHASFNQTGTA-TGRLSSSDPNLQNLPTKSEEGKEIRKAI------VPQDPNWW---- 668

Query: 362 DCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAP 421
                         +V AD + IE R+LA ++G++  L+AFE G D++  T +R FNV P
Sbjct: 669 --------------IVSADYSQIELRILAHLSGDENLLRAFEEGIDVHTLTASRIFNVKP 714

Query: 422 AQVTKDQRAIGKVMELALGY 441
            +VT++ R  GK++  ++ Y
Sbjct: 715 EEVTEEMRRAGKMVNFSIIY 734


>gi|118595288|ref|ZP_01552635.1| DNA polymerase I [Methylophilales bacterium HTCC2181]
 gi|118441066|gb|EAV47693.1| DNA polymerase I [Methylophilales bacterium HTCC2181]
          Length = 904

 Score = 60.8 bits (146), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 36/122 (29%), Positives = 61/122 (50%), Gaps = 5/122 (4%)

Query: 334 RSHEELDQIITHLPTSITSDPD----PLQIISD-CVRSCVIASEGKKLVVADLAGIEARV 388
           R H   +Q I       +SDP+    P++ +    VR   IA +G K++ AD + IE R+
Sbjct: 629 RVHTSYNQAIAITGRLASSDPNLQNIPIRTVEGRKVREAFIAPDGSKILSADYSQIELRI 688

Query: 389 LAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAF 448
           +A ++ ++  + AF+  ED++  T    FN+  + V+ +QR   KV+   L Y  G    
Sbjct: 689 MAHLSKDKRLVAAFKNNEDIHTITAGEIFNIDNSAVSSEQRRYAKVINFGLIYGMGVYGL 748

Query: 449 QK 450
            K
Sbjct: 749 AK 750


>gi|163845937|ref|YP_001633981.1| DNA polymerase I [Chloroflexus aurantiacus J-10-fl]
 gi|222523662|ref|YP_002568132.1| DNA polymerase I [Chloroflexus sp. Y-400-fl]
 gi|6015002|sp|O08307|DPO1_CHLAA RecName: Full=DNA polymerase I; Short=POL I
 gi|1913934|emb|CAA72997.1| DNA-directed DNA polymerase I [Chloroflexus aurantiacus J-10-fl]
 gi|163667226|gb|ABY33592.1| DNA polymerase I [Chloroflexus aurantiacus J-10-fl]
 gi|222447541|gb|ACM51807.1| DNA polymerase I [Chloroflexus sp. Y-400-fl]
          Length = 942

 Score = 60.8 bits (146), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 60/222 (27%), Positives = 96/222 (43%), Gaps = 42/222 (18%)

Query: 228 GLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSA 287
           G+   +  L KLK+  +  T   LE+L++            L P A  +   R + ++  
Sbjct: 600 GIDPRAHGLSKLKSGGYSITAEVLEELSQ------------LYPIAADILTYR-QLTKLK 646

Query: 288 VLKLNTLVEAMNS-DGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHL 346
              ++ L + +N   GR+  +   LGA+ TGR S      QN+P  +    E        
Sbjct: 647 STYIDALPDLVNPRTGRIHTSYNQLGAA-TGRLSSNNPNLQNIPVRTEEGRE-------- 697

Query: 347 PTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGE 406
                            +R   +A  G + V AD + IE RVLA M+G++  + AF+ G 
Sbjct: 698 -----------------IRRAFVAEPGWRFVAADYSQIELRVLAHMSGDENLIAAFQQGL 740

Query: 407 DLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAF 448
           D++  T +R F V P  V K+QR + K +   + Y  G  AF
Sbjct: 741 DIHAATASRLFGVEPTAVDKNQRRVAKTVVFGVIY--GISAF 780


>gi|237654465|ref|YP_002890779.1| DNA polymerase I [Thauera sp. MZ1T]
 gi|237625712|gb|ACR02402.1| DNA polymerase I [Thauera sp. MZ1T]
          Length = 939

 Score = 60.8 bits (146), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 60/127 (47%), Gaps = 7/127 (5%)

Query: 330 PRPSRSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLVVADLAG 383
           PR  R H    Q         +S+P+ LQ I         +R+  IA     +V AD + 
Sbjct: 661 PRTGRVHTSFSQATAVTGRLSSSEPN-LQNIPIRTPEGRRIRAAFIAPRDHLIVSADYSQ 719

Query: 384 IEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQG 443
           IE R++A ++ +   L+AF  GED++  T    F VAPA+VT +QR   KV+   L Y  
Sbjct: 720 IELRIMAHLSDDARLLEAFARGEDVHRATAGEVFGVAPAEVTSEQRRYAKVINFGLIYGM 779

Query: 444 GAKAFQK 450
            A    K
Sbjct: 780 SAHGLAK 786


>gi|15644367|ref|NP_229419.1| DNA-directed DNA polymerase I [Thermotoga maritima MSB8]
 gi|4982191|gb|AAD36686.1|AE001805_11 DNA-directed DNA polymerase I [Thermotoga maritima MSB8]
          Length = 893

 Score = 60.8 bits (146), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 43/140 (30%), Positives = 69/140 (49%), Gaps = 25/140 (17%)

Query: 302 GRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITSDPDPLQIIS 361
           GR+  +    G + TGR S      QNLP  S   +E+ + I      +  DP+      
Sbjct: 620 GRIHASFNQTGTA-TGRLSSSDPNLQNLPTKSEEGKEIRKAI------VPQDPNWW---- 668

Query: 362 DCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAP 421
                         +V AD + IE R+LA ++G++  L+AFE G D++  T +R FNV P
Sbjct: 669 --------------IVSADYSQIELRILAHLSGDENLLRAFEEGIDVHTLTASRIFNVKP 714

Query: 422 AQVTKDQRAIGKVMELALGY 441
            +VT++ R  GK++  ++ Y
Sbjct: 715 EEVTEEMRRAGKMVNFSIIY 734


>gi|9625474|ref|NP_039708.1| predicted 66.2Kd protein [Mycobacterium phage L5]
 gi|461959|sp|Q05254|DPOL_BPML5 RecName: Full=DNA polymerase
 gi|579133|emb|CAA79420.1| gene 44 [Mycobacterium phage L5]
          Length = 595

 Score = 60.8 bits (146), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 123/487 (25%), Positives = 187/487 (38%), Gaps = 109/487 (22%)

Query: 14  IDLTKCGICKYAEDVCVILFAFGFDDH----PVELWDCVHDPVMPQVLKEALENTDVTIV 69
           +D    G+  Y++     L  FG  D     PVEL D   + V  ++   AL+     +V
Sbjct: 40  VDTETTGLDIYSDTFECRLVQFGTQDEAWVVPVELGDVFIEDV--RIAIGALKR----MV 93

Query: 70  AHNSYFERTVLKACFNLDIP--IHRWICTLVLARSNGLPSALKAVGEALKLSSQKMEEGK 127
             N+ F+  VL  CF +++     R + T +LA+    P   +A G    L        +
Sbjct: 94  LQNASFDLQVLDQCFGIEMEGLWPRVLDTQILAKLVD-PRPFEAGGFGHSL--------E 144

Query: 128 ELIARFCKGETHEC-------LYDRNKPNHREAWR---LFGE----YCKGDVTVTREIFK 173
           ELIA+F   +  E        L   +K    + W    LF      Y   D   T  + K
Sbjct: 145 ELIAKFISEDQAENVKKLMAKLAAEHKTTKAKIWSTIDLFHPEYLLYAGMDTIFTARVCK 204

Query: 174 RLEPLSSK--------EQELWYLDQTINDRGYCVDVALAHTLNQIVDVERTKLDQEL-ES 224
            L PL           E ++  +   I+ +G+ +DV  + +L      E+   DQE+ E+
Sbjct: 205 SLTPLVPDVSRSLVPYEHKISEICSYIDRQGFLLDVEYSRSL-----AEKWLADQEVWEA 259

Query: 225 LT---YGLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRM 281
           +    YG V      E L   L  E G+ +   TET  ++V   N  L  + ++   N +
Sbjct: 260 IAFTEYG-VEKVNSTEDLAEGL-EEMGVKITGRTETGKRQV---NAALLDKLVED-GNEL 313

Query: 282 RASRSAVLKLNT--------LVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPS 333
            A      KL           ++  +S+ R    +  L A RT R S    P Q LP   
Sbjct: 314 AAIAQEAKKLGKWRKTWVQKFIDTRDSEDRCHTFINPLQA-RTSRMSITGIPAQTLPS-- 370

Query: 334 RSHEELDQIITHLPTSITSDPDPLQIISD-CVRSCVIASEGKKLVVADLAGIEARVLAWM 392
                                      SD  VR C IA  G  +   D    E RVLA +
Sbjct: 371 ---------------------------SDWIVRRCFIAEPGDVMASVDYQAQELRVLAAL 403

Query: 393 AGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMA 452
           +G++  ++AFE G DL+  T         A   +  R +GK       Y GGAKA   +A
Sbjct: 404 SGDRNMIEAFENGADLHQMT---------ADAAQVPRKVGKTANFQKVYGGGAKA---LA 451

Query: 453 STTGLNL 459
              G+++
Sbjct: 452 EAVGISI 458


>gi|261379438|ref|ZP_05984011.1| DNA polymerase I [Neisseria subflava NJ9703]
 gi|284797890|gb|EFC53237.1| DNA polymerase I [Neisseria subflava NJ9703]
          Length = 938

 Score = 60.8 bits (146), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 50/99 (50%)

Query: 364 VRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQ 423
           VR    A +G  +V AD + IE R++A ++G++  + AF+ GED++  T A  F  AP  
Sbjct: 690 VRRAFTAPQGSVIVSADYSQIELRIMAHLSGDKTLIAAFQNGEDVHRRTAAEVFGTAPEN 749

Query: 424 VTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTF 462
           V+ +QR   K +   L Y  G     K  S   ++   F
Sbjct: 750 VSSEQRRYAKTINFGLIYGMGQYGLAKSLSIDNISAKNF 788


>gi|332653862|ref|ZP_08419606.1| DNA-directed DNA polymerase I [Ruminococcaceae bacterium D16]
 gi|332516948|gb|EGJ46553.1| DNA-directed DNA polymerase I [Ruminococcaceae bacterium D16]
          Length = 900

 Score = 60.8 bits (146), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 45/78 (57%)

Query: 364 VRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQ 423
           +R   +A+ GK LV AD + IE R+LA MAG+Q  ++ F +G D++  T ++ F V P Q
Sbjct: 661 LREMFVAAPGKVLVDADYSQIELRLLAHMAGDQAMIEGFHSGADIHTITASQVFGVTPDQ 720

Query: 424 VTKDQRAIGKVMELALGY 441
           VT   R   K +   + Y
Sbjct: 721 VTPQMRRSAKAVNFGIVY 738


>gi|270265261|ref|ZP_06193523.1| DNA polymerase I [Serratia odorifera 4Rx13]
 gi|270040895|gb|EFA13997.1| DNA polymerase I [Serratia odorifera 4Rx13]
          Length = 933

 Score = 60.8 bits (146), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 43/125 (34%), Positives = 62/125 (49%), Gaps = 9/125 (7%)

Query: 330 PRPSRSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLVVADLAG 383
           P   R H    Q +T      +SDP+ LQ I         +R   IA EG ++V AD + 
Sbjct: 654 PFSGRVHTSYHQAVTATGRLSSSDPN-LQNIPVRNDEGRRIRQAFIAPEGYRIVAADYSQ 712

Query: 384 IEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQG 443
           IE R++A ++ ++  LKAF  G+D++  T A  F V   +VT +QR   K +   L Y  
Sbjct: 713 IELRIMAHLSQDEGLLKAFAEGKDIHRATAAEVFGVQLDKVTGEQRRSAKAINFGLIY-- 770

Query: 444 GAKAF 448
           G  AF
Sbjct: 771 GMSAF 775


>gi|89897107|ref|YP_520594.1| hypothetical protein DSY4361 [Desulfitobacterium hafniense Y51]
 gi|89336555|dbj|BAE86150.1| hypothetical protein [Desulfitobacterium hafniense Y51]
          Length = 578

 Score = 60.8 bits (146), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 40/130 (30%), Positives = 63/130 (48%), Gaps = 1/130 (0%)

Query: 324 FPPQNLPRPSRSHEELDQIITHLPTSITSDPDPLQIISDC-VRSCVIASEGKKLVVADLA 382
           F P   P   R H    QI          +P+  QI  D   R+C  A  G+KL++AD +
Sbjct: 303 FTPLIHPVTGRLHPRYGQISAWSGRMSCWNPNIQQIPRDSEFRACFAAPPGRKLILADYS 362

Query: 383 GIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQ 442
            IE RV A ++G+   + A++ GEDL++ T +   +   A++T  +R   K +   L + 
Sbjct: 363 QIELRVAAQISGDTRMISAYQQGEDLHLLTASLVAHKPIAEITPQERQAAKAVNFGLIFG 422

Query: 443 GGAKAFQKMA 452
            GA   Q+ A
Sbjct: 423 MGAPGLQQYA 432


>gi|194290334|ref|YP_002006241.1| DNA polymerase I [Cupriavidus taiwanensis LMG 19424]
 gi|193224169|emb|CAQ70178.1| DNA polymerase A; 5'->3' exonuclease ; 3'->5' polymerase ; 3'->5'
           exonuclease [Cupriavidus taiwanensis LMG 19424]
          Length = 939

 Score = 60.8 bits (146), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 45/143 (31%), Positives = 68/143 (47%), Gaps = 10/143 (6%)

Query: 330 PRPSRSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLVVADLAG 383
           PR  R H    Q         +++P+ LQ I         +R   IA  G  +V AD + 
Sbjct: 661 PRTGRVHTSYGQATAVTGRLASTEPN-LQNIPVRTDEGRRIREAFIAEPGSVIVSADYSQ 719

Query: 384 IEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQG 443
           IE R++A ++G++  L+AF  GED++  T A  F V    V+ +QR   KV+   L Y  
Sbjct: 720 IELRIMAHISGDENLLRAFANGEDIHRATAAEIFGVERDAVSSEQRRYAKVINFGLIY-- 777

Query: 444 GAKAFQKMASTTGLNLNTFAHLV 466
           G  AF  +AS  G+  +   H +
Sbjct: 778 GMSAF-GLASNLGIERDAARHYI 799


>gi|325479001|gb|EGC82102.1| DNA-directed DNA polymerase [Anaerococcus prevotii ACS-065-V-Col13]
          Length = 878

 Score = 60.8 bits (146), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 65/255 (25%), Positives = 114/255 (44%), Gaps = 43/255 (16%)

Query: 196 GYCVDVALAHTLNQIVDVERTKLDQELESLT---YGLVSSSRCLEKLKTWLFL------E 246
           G+  D  +   L + +D +  +L QE+  L+   + + S+ +  E L   L L      +
Sbjct: 496 GFVTDRKVLEELKEGIDADIDELTQEIYELSGSEFNINSTKQLGEVLFKDLELPVIKKTK 555

Query: 247 TGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLNTLVEAMNSDGRLRG 306
           TG      T+ +    L    ++ P+ I+ +    +  RS  ++   L +A++ DGR+R 
Sbjct: 556 TGFS----TDASVLEKLRDKHQIIPK-IERYRELFKL-RSTYIE--GLEKAIDYDGRIRS 607

Query: 307 TLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITSDPDPLQIISDCVRS 366
           T +    + TGR S      QNLP                   I +D   L      +R 
Sbjct: 608 TFR-QNIAATGRLSSQDPNLQNLP-------------------IKTDEGRL------IRK 641

Query: 367 CVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTK 426
              A EGK L+ AD + IE R+LA ++G++  + AF   +D++  T ++ F+    +VTK
Sbjct: 642 AFKAEEGKILIDADYSQIELRILASLSGDEHMIDAFINVDDIHRKTASKVFHTPLEEVTK 701

Query: 427 DQRAIGKVMELALGY 441
            QR+  K +   + Y
Sbjct: 702 RQRSEAKAVNFGIIY 716


>gi|238921711|ref|YP_002935226.1| DNA polymerase I [Edwardsiella ictaluri 93-146]
 gi|238871280|gb|ACR70991.1| DNA polymerase I [Edwardsiella ictaluri 93-146]
          Length = 930

 Score = 60.5 bits (145), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 43/125 (34%), Positives = 63/125 (50%), Gaps = 9/125 (7%)

Query: 330 PRPSRSHEELDQIITHLPTSITSDPDPLQII---SD---CVRSCVIASEGKKLVVADLAG 383
           P   R H    Q +T      +SDP+ LQ I   SD    +R   IA  G ++V AD + 
Sbjct: 652 PLTGRVHTSYHQAVTATGRLSSSDPN-LQNIPVRSDEGRRIRQAFIAPVGSRIVAADYSQ 710

Query: 384 IEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQG 443
           IE R++A ++G++  L+AF  G+D++  T A  F +    V+ DQR   K +   L Y  
Sbjct: 711 IELRIMAHLSGDKGLLQAFAAGKDIHRATAAEVFGLPLEAVSADQRRSAKAINFGLIY-- 768

Query: 444 GAKAF 448
           G  AF
Sbjct: 769 GMSAF 773


>gi|139437104|ref|ZP_01771264.1| Hypothetical protein COLAER_00242 [Collinsella aerofaciens ATCC
           25986]
 gi|133776751|gb|EBA40571.1| Hypothetical protein COLAER_00242 [Collinsella aerofaciens ATCC
           25986]
          Length = 916

 Score = 60.5 bits (145), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 61/121 (50%), Gaps = 7/121 (5%)

Query: 333 SRSHEELDQIITHLPTSITSDPDPLQI-----ISDCVRSCVIASEGKKLVVADLAGIEAR 387
            R H   +Q IT      +SDP+   I     +   V++   A EG   +  D + IE R
Sbjct: 641 GRVHTTYNQTITATGRLSSSDPNLQNIPTRSELGRTVKTAFSAGEGSVFLAVDYSQIELR 700

Query: 388 VLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKA 447
           +LA ++G++  ++AF  GED +  T AR F V  ++VT D R+  K +   + Y  G +A
Sbjct: 701 LLAHLSGDEHLVRAFNEGEDFHAETAARVFGVPVSEVTPDLRSRAKAVNFGIVY--GQQA 758

Query: 448 F 448
           +
Sbjct: 759 Y 759


>gi|307256528|ref|ZP_07538309.1| hypothetical protein appser10_5330 [Actinobacillus pleuropneumoniae
           serovar 10 str. D13039]
 gi|306864938|gb|EFM96840.1| hypothetical protein appser10_5330 [Actinobacillus pleuropneumoniae
           serovar 10 str. D13039]
          Length = 957

 Score = 60.5 bits (145), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 39/117 (33%), Positives = 59/117 (50%), Gaps = 7/117 (5%)

Query: 331 RPSRSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLVVADLAGI 384
           +  R H    Q +T      +SDP+ LQ I         +R   IA +G K+V AD + I
Sbjct: 681 KTGRVHTSYHQAVTATGRLSSSDPN-LQNIPIRNEEGRRIRQAFIARDGYKIVAADYSQI 739

Query: 385 EARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGY 441
           E R++A +A ++  + AF  G+D++  T A  F +A  QVT +QR   K +   L Y
Sbjct: 740 ELRIMAHLANDEGMITAFAEGKDIHRATAAEIFGLALDQVTSEQRRSAKAINFGLIY 796


>gi|59802404|ref|YP_209116.1| hypothetical protein NGO2103 [Neisseria gonorrhoeae FA 1090]
 gi|254492832|ref|ZP_05106003.1| DNA polymerase I [Neisseria gonorrhoeae 1291]
 gi|260441414|ref|ZP_05795230.1| hypothetical protein NgonDG_10092 [Neisseria gonorrhoeae DGI2]
 gi|268593903|ref|ZP_06128070.1| DNA polymerase I [Neisseria gonorrhoeae 35/02]
 gi|268595960|ref|ZP_06130127.1| DNA polymerase I [Neisseria gonorrhoeae FA19]
 gi|268598080|ref|ZP_06132247.1| DNA polymerase I [Neisseria gonorrhoeae MS11]
 gi|268600421|ref|ZP_06134588.1| DNA polymerase I [Neisseria gonorrhoeae PID18]
 gi|268602653|ref|ZP_06136820.1| DNA polymerase I [Neisseria gonorrhoeae PID1]
 gi|268681202|ref|ZP_06148064.1| DNA polymerase I [Neisseria gonorrhoeae PID332]
 gi|268683373|ref|ZP_06150235.1| DNA polymerase I [Neisseria gonorrhoeae SK-92-679]
 gi|268685682|ref|ZP_06152544.1| DNA polymerase I [Neisseria gonorrhoeae SK-93-1035]
 gi|291044776|ref|ZP_06570485.1| DNA polymerase I [Neisseria gonorrhoeae DGI2]
 gi|59719299|gb|AAW90704.1| putative DNA polymerase I [Neisseria gonorrhoeae FA 1090]
 gi|226511872|gb|EEH61217.1| DNA polymerase I [Neisseria gonorrhoeae 1291]
 gi|268547292|gb|EEZ42710.1| DNA polymerase I [Neisseria gonorrhoeae 35/02]
 gi|268549748|gb|EEZ44767.1| DNA polymerase I [Neisseria gonorrhoeae FA19]
 gi|268582211|gb|EEZ46887.1| DNA polymerase I [Neisseria gonorrhoeae MS11]
 gi|268584552|gb|EEZ49228.1| DNA polymerase I [Neisseria gonorrhoeae PID18]
 gi|268586784|gb|EEZ51460.1| DNA polymerase I [Neisseria gonorrhoeae PID1]
 gi|268621486|gb|EEZ53886.1| DNA polymerase I [Neisseria gonorrhoeae PID332]
 gi|268623657|gb|EEZ56057.1| DNA polymerase I [Neisseria gonorrhoeae SK-92-679]
 gi|268625966|gb|EEZ58366.1| DNA polymerase I [Neisseria gonorrhoeae SK-93-1035]
 gi|291011670|gb|EFE03666.1| DNA polymerase I [Neisseria gonorrhoeae DGI2]
          Length = 930

 Score = 60.5 bits (145), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 42/145 (28%), Positives = 65/145 (44%), Gaps = 7/145 (4%)

Query: 324 FPPQNLPRPSRSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLV 377
            P    PR +R H    Q +       +++P+ LQ I         VR    A  G  +V
Sbjct: 645 LPEMISPRDNRVHTTYAQAVAITGRLASNNPN-LQNIPIRTAEGRRVRRAFTAPPGSVIV 703

Query: 378 VADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMEL 437
            AD + IE R++A ++G++  + AF++GED++  T A  F  AP  V+ +QR   K +  
Sbjct: 704 SADYSQIELRIMAHLSGDKTLIAAFQSGEDVHRRTAAEVFGTAPENVSPEQRRYAKTINF 763

Query: 438 ALGYQGGAKAFQKMASTTGLNLNTF 462
            L Y  G     K      L+   F
Sbjct: 764 GLIYGMGQYGLAKSLGIDNLSAKNF 788


>gi|293397866|ref|ZP_06642072.1| DNA polymerase I [Neisseria gonorrhoeae F62]
 gi|291611812|gb|EFF40881.1| DNA polymerase I [Neisseria gonorrhoeae F62]
          Length = 930

 Score = 60.5 bits (145), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 42/145 (28%), Positives = 65/145 (44%), Gaps = 7/145 (4%)

Query: 324 FPPQNLPRPSRSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLV 377
            P    PR +R H    Q +       +++P+ LQ I         VR    A  G  +V
Sbjct: 645 LPEMISPRDNRVHTTYAQAVAITGRLASNNPN-LQNIPIRTAEGRRVRRAFTAPPGSVIV 703

Query: 378 VADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMEL 437
            AD + IE R++A ++G++  + AF++GED++  T A  F  AP  V+ +QR   K +  
Sbjct: 704 SADYSQIELRIMAHLSGDKTLIAAFQSGEDVHRRTAAEVFGTAPENVSPEQRRYAKTINF 763

Query: 438 ALGYQGGAKAFQKMASTTGLNLNTF 462
            L Y  G     K      L+   F
Sbjct: 764 GLIYGMGQYGLAKSLGIDNLSAKNF 788


>gi|160900757|ref|YP_001566339.1| DNA polymerase I [Delftia acidovorans SPH-1]
 gi|160366341|gb|ABX37954.1| DNA polymerase I [Delftia acidovorans SPH-1]
          Length = 947

 Score = 60.5 bits (145), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 45/144 (31%), Positives = 69/144 (47%), Gaps = 10/144 (6%)

Query: 329 LPRPSRSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLVVADLA 382
           LPR  R H    Q +       ++DP+ LQ I         VR   IA+ G  +  AD +
Sbjct: 668 LPRTGRVHTHYAQAVAVTGRLSSNDPN-LQNIPIRTPEGRRVREAFIAAPGHVIASADYS 726

Query: 383 GIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQ 442
            IE R++A ++G++  L+AF  G D++  T +  FNV   QV+ +QR   KV+   L Y 
Sbjct: 727 QIELRIMAHLSGDESLLRAFHEGRDVHRATASEVFNVELEQVSSEQRRYAKVINFGLIY- 785

Query: 443 GGAKAFQKMASTTGLNLNTFAHLV 466
            G  +F  +A   G+     A  +
Sbjct: 786 -GMSSF-GLAKNLGIETKAAAAYI 807


>gi|269140843|ref|YP_003297544.1| DNA polymerase I [Edwardsiella tarda EIB202]
 gi|267986504|gb|ACY86333.1| DNA polymerase I [Edwardsiella tarda EIB202]
 gi|304560602|gb|ADM43266.1| DNA polymerase I [Edwardsiella tarda FL6-60]
          Length = 930

 Score = 60.5 bits (145), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 45/130 (34%), Positives = 65/130 (50%), Gaps = 10/130 (7%)

Query: 326 PQNL-PRPSRSHEELDQIITHLPTSITSDPDPLQII---SD---CVRSCVIASEGKKLVV 378
           PQ + P   R H    Q +T      +SDP+ LQ I   SD    +R   IA  G ++V 
Sbjct: 647 PQMVNPLTGRVHTSYHQAVTATGRLSSSDPN-LQNIPVRSDEGRRIRQAFIAPAGSRIVA 705

Query: 379 ADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELA 438
           AD + IE R++A ++G++  L AF  G+D++  T A  F +    V+ DQR   K +   
Sbjct: 706 ADYSQIELRIMAHLSGDKGLLAAFAAGKDIHRATAAEVFGLPLEAVSADQRRSAKAINFG 765

Query: 439 LGYQGGAKAF 448
           L Y  G  AF
Sbjct: 766 LIY--GMSAF 773


>gi|17546949|ref|NP_520351.1| DNA polymerase I [Ralstonia solanacearum GMI1000]
 gi|17429250|emb|CAD15937.1| probable dna polymeraseIprotein [Ralstonia solanacearum GMI1000]
          Length = 946

 Score = 60.5 bits (145), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 47/157 (29%), Positives = 72/157 (45%), Gaps = 10/157 (6%)

Query: 308 LQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITSDPDPLQII------S 361
           L F G ++         P    P+  R H    Q         ++DP+ LQ I       
Sbjct: 638 LDFRGLAKLKSTYTDKLPKMVNPQTGRVHTTYGQATAVTGRLASTDPN-LQNIPVRTEEG 696

Query: 362 DCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAP 421
             +R   +A  G  +V AD + IE R++A ++ ++  L+AF  G+D++  T A  F V P
Sbjct: 697 RRIREAFVAPAGSVIVSADYSQIELRIMAHLSEDEGLLRAFREGQDVHRATAAEVFGVTP 756

Query: 422 AQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLN 458
            +VT +QR   KV+   L Y  G  AF  +AS  G+ 
Sbjct: 757 LEVTAEQRRYAKVINFGLIY--GMSAF-GLASNLGIG 790


>gi|320162435|ref|YP_004175660.1| DNA polymerase I [Anaerolinea thermophila UNI-1]
 gi|319996289|dbj|BAJ65060.1| DNA polymerase I [Anaerolinea thermophila UNI-1]
          Length = 938

 Score = 60.5 bits (145), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 85/356 (23%), Positives = 136/356 (38%), Gaps = 92/356 (25%)

Query: 324 FPPQNLPRPSRSHEELDQIITHLPTSITSDPDPLQI-----ISDCVRSCVIASEGKKLVV 378
            P Q  PR  R H   +Q  +      +SDP+   I     +   VR+  IA EG  L+ 
Sbjct: 650 LPQQVNPRTGRVHTRFNQTGSVTGRLASSDPNLQNIPTRTDLGRQVRNAFIADEGWVLLS 709

Query: 379 ADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELA 438
            D + IE R++A +A ++  L AF  G+D++  T A  + V    VT++ R   K +   
Sbjct: 710 VDYSQIELRIVAHVANDEAMLAAFRAGQDIHAATAAAIYGVPLEAVTREMRRHAKAINFG 769

Query: 439 LGYQGGAKAFQKMASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLF 498
           L Y  G  AF       GL          + SA     +AENF +   E  P        
Sbjct: 770 LIY--GMSAF-------GL----------SRSADLTLAEAENFVKAYFEQFP-------- 802

Query: 499 IGTACERVKKAWRQKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNL 558
                +R     R++ +R            E  +E    ++ R+R      Y    KN  
Sbjct: 803 ---GVKRFLDDLRRRAAR------------EGYVET---LLGRRR------YFPNLKN-- 836

Query: 559 ILMLPSGRSLVYRDVGNNRSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGM---- 614
               P+  +L  R+    R  +N                    +Q  + DI+   M    
Sbjct: 837 ----PANPALKARE---EREAINAP------------------IQGTAADIIKLAMIRLP 871

Query: 615 --MNATKAGYDIVLTVHDEIVCETPDTD-EFNASMLYHLMTSNPSWAKGLPLKAEG 667
             + A  +   ++L VHDE+V E P  +    A ++ H+M +  ++   +PL  E 
Sbjct: 872 EALRAAGSRARLLLQVHDELVLEVPREEMPGTAKLVQHVMET--AYPLQIPLTTEA 925


>gi|255327557|ref|ZP_05368624.1| DNA polymerase I [Rothia mucilaginosa ATCC 25296]
 gi|255295451|gb|EET74801.1| DNA polymerase I [Rothia mucilaginosa ATCC 25296]
          Length = 1003

 Score = 60.5 bits (145), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 70/276 (25%), Positives = 113/276 (40%), Gaps = 35/276 (12%)

Query: 182 EQELWYLDQTINDRGYCVDVALAHTL--------NQIVDVERTKLDQELESLTYGLVSSS 233
           E  L Y+   +   G  V  AL   L        NQ  D  RT +   +++       + 
Sbjct: 584 ELPLLYVLADMEQAGIAVSDALLTELHDTFSARANQAQDAARTIIGDTVQTDDGEEPLNL 643

Query: 234 RCLEKLKTWLFLETGL----HLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVL 289
             +++L+T LF +  L     ++    T  + V     K++P++         A+    +
Sbjct: 644 ASVKQLQTVLFDKLALPHTRKIKSGYSTDAESVTELLAKISPESDGAAFLGALAAYRDNI 703

Query: 290 KLNTLVEAMN----SDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITH 345
           KL   VE +      DGR+  T Q  GA+ TGR S      QN+P  +     +      
Sbjct: 704 KLVQTVEGLQKAAADDGRVHTTFQ-QGAASTGRLSSTAPNLQNIPIRTEEGRRIRGAFIV 762

Query: 346 LPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETG 405
            P  +           D V       E + L+ AD + IE R++  +A ++  + A+E G
Sbjct: 763 APAPV-----------DGV-------EYEGLLTADYSQIEMRIMVHLAADEKLIAAYEAG 804

Query: 406 EDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGY 441
           EDL+    +  F VAP +VT +QR+  K M   L Y
Sbjct: 805 EDLHRYVGSEVFGVAPEEVTPEQRSKVKAMSYGLAY 840


>gi|165975932|ref|YP_001651525.1| DNA polymerase I [Actinobacillus pleuropneumoniae serovar 3 str.
           JL03]
 gi|165876033|gb|ABY69081.1| DNA polymerase I [Actinobacillus pleuropneumoniae serovar 3 str.
           JL03]
          Length = 919

 Score = 60.5 bits (145), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 39/117 (33%), Positives = 59/117 (50%), Gaps = 7/117 (5%)

Query: 331 RPSRSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLVVADLAGI 384
           +  R H    Q +T      +SDP+ LQ I         +R   IA +G K+V AD + I
Sbjct: 643 KTGRVHTSYHQAVTATGRLSSSDPN-LQNIPIRNEEGRRIRQAFIARDGYKIVAADYSQI 701

Query: 385 EARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGY 441
           E R++A +A ++  + AF  G+D++  T A  F +A  QVT +QR   K +   L Y
Sbjct: 702 ELRIMAHLANDEGMITAFAEGKDIHRATAAEIFGLALDQVTSEQRRSAKAINFGLIY 758


>gi|307254261|ref|ZP_07536102.1| hypothetical protein appser9_5120 [Actinobacillus pleuropneumoniae
           serovar 9 str. CVJ13261]
 gi|307258723|ref|ZP_07540455.1| hypothetical protein appser11_5210 [Actinobacillus pleuropneumoniae
           serovar 11 str. 56153]
 gi|306862808|gb|EFM94761.1| hypothetical protein appser9_5120 [Actinobacillus pleuropneumoniae
           serovar 9 str. CVJ13261]
 gi|306867074|gb|EFM98930.1| hypothetical protein appser11_5210 [Actinobacillus pleuropneumoniae
           serovar 11 str. 56153]
          Length = 957

 Score = 60.5 bits (145), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 39/117 (33%), Positives = 59/117 (50%), Gaps = 7/117 (5%)

Query: 331 RPSRSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLVVADLAGI 384
           +  R H    Q +T      +SDP+ LQ I         +R   IA +G K+V AD + I
Sbjct: 681 KTGRVHTSYHQAVTATGRLSSSDPN-LQNIPIRNEEGRRIRQAFIARDGYKIVAADYSQI 739

Query: 385 EARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGY 441
           E R++A +A ++  + AF  G+D++  T A  F +A  QVT +QR   K +   L Y
Sbjct: 740 ELRIMAHLANDEGMITAFAEGKDIHRATAAEIFGLALDQVTSEQRRSAKAINFGLIY 796


>gi|194100055|ref|YP_002003195.1| PolA [Neisseria gonorrhoeae NCCP11945]
 gi|239998054|ref|ZP_04717978.1| hypothetical protein Ngon3_01018 [Neisseria gonorrhoeae 35/02]
 gi|240013236|ref|ZP_04720149.1| hypothetical protein NgonD_01055 [Neisseria gonorrhoeae DGI18]
 gi|240015682|ref|ZP_04722222.1| hypothetical protein NgonFA_00693 [Neisseria gonorrhoeae FA6140]
 gi|240079818|ref|ZP_04724361.1| hypothetical protein NgonF_00666 [Neisseria gonorrhoeae FA19]
 gi|240112026|ref|ZP_04726516.1| hypothetical protein NgonM_00295 [Neisseria gonorrhoeae MS11]
 gi|240114773|ref|ZP_04728835.1| hypothetical protein NgonPID1_00698 [Neisseria gonorrhoeae PID18]
 gi|240116973|ref|ZP_04731035.1| hypothetical protein NgonPID_00683 [Neisseria gonorrhoeae PID1]
 gi|240120307|ref|ZP_04733269.1| hypothetical protein NgonPI_00730 [Neisseria gonorrhoeae PID24-1]
 gi|240122611|ref|ZP_04735567.1| hypothetical protein NgonP_01466 [Neisseria gonorrhoeae PID332]
 gi|240124799|ref|ZP_04737685.1| hypothetical protein NgonSK_00995 [Neisseria gonorrhoeae SK-92-679]
 gi|240127317|ref|ZP_04739978.1| hypothetical protein NgonS_01450 [Neisseria gonorrhoeae SK-93-1035]
 gi|193935345|gb|ACF31169.1| PolA [Neisseria gonorrhoeae NCCP11945]
 gi|317165496|gb|ADV09037.1| hypothetical protein NGTW08_2086 [Neisseria gonorrhoeae
           TCDC-NG08107]
          Length = 908

 Score = 60.5 bits (145), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 42/145 (28%), Positives = 65/145 (44%), Gaps = 7/145 (4%)

Query: 324 FPPQNLPRPSRSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLV 377
            P    PR +R H    Q +       +++P+ LQ I         VR    A  G  +V
Sbjct: 623 LPEMISPRDNRVHTTYAQAVAITGRLASNNPN-LQNIPIRTAEGRRVRRAFTAPPGSVIV 681

Query: 378 VADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMEL 437
            AD + IE R++A ++G++  + AF++GED++  T A  F  AP  V+ +QR   K +  
Sbjct: 682 SADYSQIELRIMAHLSGDKTLIAAFQSGEDVHRRTAAEVFGTAPENVSPEQRRYAKTINF 741

Query: 438 ALGYQGGAKAFQKMASTTGLNLNTF 462
            L Y  G     K      L+   F
Sbjct: 742 GLIYGMGQYGLAKSLGIDNLSAKNF 766


>gi|88811281|ref|ZP_01126537.1| DNA polymerase I [Nitrococcus mobilis Nb-231]
 gi|88791820|gb|EAR22931.1| DNA polymerase I [Nitrococcus mobilis Nb-231]
          Length = 898

 Score = 60.5 bits (145), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 44/144 (30%), Positives = 68/144 (47%), Gaps = 10/144 (6%)

Query: 330 PRPSRSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLVVADLAG 383
           PR  R H    Q +       +SDP+ LQ I         +R   IA +G +L+  D + 
Sbjct: 620 PRTGRVHTSYRQAVAATGRLSSSDPN-LQNIPVRSPEGRRIRRGFIARQGYRLLAVDYSQ 678

Query: 384 IEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQG 443
           +E R++A  +G++   +AF  GED++  T A  F  A  QVT +QR   K +   L Y  
Sbjct: 679 VELRIMAHFSGDERLHRAFAAGEDIHRATAAEVFATALEQVTAEQRRAAKAINFGLIY-- 736

Query: 444 GAKAFQKMASTTGLNLNTFAHLVK 467
           G  A+  +A   G+  +   H V+
Sbjct: 737 GMSAY-GLARQLGIERDAAQHYVE 759


>gi|167626125|ref|YP_001676419.1| DNA polymerase I [Shewanella halifaxensis HAW-EB4]
 gi|167356147|gb|ABZ78760.1| DNA polymerase I [Shewanella halifaxensis HAW-EB4]
          Length = 918

 Score = 60.5 bits (145), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 33/85 (38%), Positives = 50/85 (58%), Gaps = 2/85 (2%)

Query: 364 VRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQ 423
           +R   IA EGKK++ AD + IE R++A ++ ++  L AF  G+D++  T A  F+V  ++
Sbjct: 678 IRHAFIAPEGKKILAADYSQIELRIMAHLSQDKGLLTAFAEGKDIHKATAAEVFDVDFSE 737

Query: 424 VTKDQRAIGKVMELALGYQGGAKAF 448
           VT DQR   K +   L Y  G  AF
Sbjct: 738 VTTDQRRRAKAVNFGLIY--GMSAF 760


>gi|307245312|ref|ZP_07527400.1| hypothetical protein appser1_5170 [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|306853653|gb|EFM85870.1| hypothetical protein appser1_5170 [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
          Length = 957

 Score = 60.5 bits (145), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 39/117 (33%), Positives = 59/117 (50%), Gaps = 7/117 (5%)

Query: 331 RPSRSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLVVADLAGI 384
           +  R H    Q +T      +SDP+ LQ I         +R   IA +G K+V AD + I
Sbjct: 681 KTGRVHTSYHQAVTATGRLSSSDPN-LQNIPIRNEEGRRIRQAFIARDGYKIVAADYSQI 739

Query: 385 EARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGY 441
           E R++A +A ++  + AF  G+D++  T A  F +A  QVT +QR   K +   L Y
Sbjct: 740 ELRIMAHLANDEGMITAFAEGKDIHRATAAEIFGLALDQVTSEQRRSAKAINFGLIY 796


>gi|239905004|ref|YP_002951743.1| DNA polymerase I [Desulfovibrio magneticus RS-1]
 gi|239794868|dbj|BAH73857.1| DNA polymerase I [Desulfovibrio magneticus RS-1]
          Length = 888

 Score = 60.5 bits (145), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 61/218 (27%), Positives = 94/218 (43%), Gaps = 18/218 (8%)

Query: 331 RPSRSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLVVADLAGI 384
           R SR H  L+ + T      +S+P+ LQ I         +R+C  A  G +LV AD + I
Sbjct: 611 RDSRIHTTLNNMATATGRLSSSNPN-LQNIPIRGEFGRRMRACFTAGPGNRLVAADYSQI 669

Query: 385 EARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGG 444
           E RVLA ++GE   L AF  G D++  T A  F+     +  D+R   K +   L Y  G
Sbjct: 670 ELRVLAHLSGESALLDAFAHGADIHARTAAILFDKPEEAIAPDERRQAKTINFGLLYGMG 729

Query: 445 AKAFQKMASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACE 504
               QK++   G+ L+     +        +E       +  E   E A  D F+ T   
Sbjct: 730 P---QKLSRDLGIKLDAAKAFIA-----RYFERLPGLSAFY-EGIVEAAKRDGFVTTLAG 780

Query: 505 RVKKAWRQKHSRVSELWNEL-HQAFEQTIENGKAIIAR 541
           R ++      S  S+L ++   QA    ++ G A I +
Sbjct: 781 R-RRLLPDIGSANSQLSSQARRQAINTVVQGGAADIIK 817


>gi|73540576|ref|YP_295096.1| DNA polymerase I [Ralstonia eutropha JMP134]
 gi|72117989|gb|AAZ60252.1| DNA polymerase I [Ralstonia eutropha JMP134]
          Length = 941

 Score = 60.5 bits (145), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 36/103 (34%), Positives = 55/103 (53%), Gaps = 3/103 (2%)

Query: 364 VRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQ 423
           +R   IAS G  +V AD + IE R++A ++G++  L+AF  GED++  T +  F V    
Sbjct: 702 IREAFIASPGSVIVSADYSQIELRIMAHISGDENLLRAFANGEDIHRATASEIFGVDREA 761

Query: 424 VTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLV 466
           V+ +QR   KV+   L Y  G  AF  +AS  G+      H +
Sbjct: 762 VSSEQRRYAKVINFGLIY--GMSAF-GLASNLGIEREAAKHYI 801


>gi|297569901|ref|YP_003691245.1| DNA polymerase I [Desulfurivibrio alkaliphilus AHT2]
 gi|296925816|gb|ADH86626.1| DNA polymerase I [Desulfurivibrio alkaliphilus AHT2]
          Length = 914

 Score = 60.5 bits (145), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 51/178 (28%), Positives = 77/178 (43%), Gaps = 30/178 (16%)

Query: 271 PQAIQVFNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLP 330
           P AI    N  +   + V KL+TL+    +DGR+  +      + TGR S      QN+P
Sbjct: 610 PAAIIAQRNLSKLKSTYVDKLSTLINP--ADGRIHTSFN-QTVTATGRLSSSNPNLQNIP 666

Query: 331 RPSRSHEELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLA 390
              R+ E                          +R   IA+ G + + AD + I+ RVLA
Sbjct: 667 --VRTQE-----------------------GRRIRGAFIAAPGHRFLAADYSQIDLRVLA 701

Query: 391 WMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAF 448
             + +   L+AF+  +D++  T A  F V PA VT D R + K +   + Y  G  AF
Sbjct: 702 HYSADPMLLEAFQQDQDIHRRTAAEIFRVNPAMVTADMRRVAKTINFGIIY--GMSAF 757


>gi|61676024|gb|AAX51677.1| DNA polymerase I [Thermocrinis ruber DSM 12173]
          Length = 169

 Score = 60.5 bits (145), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 37/107 (34%), Positives = 55/107 (51%), Gaps = 1/107 (0%)

Query: 353 DPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTT 412
           DP+ LQ I   +R    A EG   V+AD + IE R+ A   GE   +KAF+ G DL+  T
Sbjct: 1   DPN-LQNIPKDLRRIFKAEEGNLFVIADFSQIELRIAAEYVGEIRMIKAFQEGRDLHRYT 59

Query: 413 YARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNL 459
            +         +TK++R + K +   L Y   AK   + A+T G++L
Sbjct: 60  ASILLGKREEDITKEERQLAKAVNFGLIYGISAKGLSQYAATYGIDL 106


>gi|299066168|emb|CBJ37351.1| DNA polymerase I (POL I) [Ralstonia solanacearum CMR15]
          Length = 959

 Score = 60.5 bits (145), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 43/135 (31%), Positives = 66/135 (48%), Gaps = 10/135 (7%)

Query: 330 PRPSRSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLVVADLAG 383
           P+  R H    Q         ++DP+ LQ I         +R   +A  G  +V AD + 
Sbjct: 673 PQTGRVHTTYGQATAVTGRLASTDPN-LQNIPVRTEEGRRIREAFVAPAGSVIVSADYSQ 731

Query: 384 IEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQG 443
           IE R++A ++ ++  L+AF  G+D++  T A  F V P +VT +QR   KV+   L Y  
Sbjct: 732 IELRIMAHLSEDEGLLRAFREGQDVHRATAAEVFGVTPLEVTAEQRRYAKVINFGLIY-- 789

Query: 444 GAKAFQKMASTTGLN 458
           G  AF  +AS  G+ 
Sbjct: 790 GMSAF-GLASNLGIG 803


>gi|292493377|ref|YP_003528816.1| DNA polymerase I [Nitrosococcus halophilus Nc4]
 gi|291581972|gb|ADE16429.1| DNA polymerase I [Nitrosococcus halophilus Nc4]
          Length = 901

 Score = 60.5 bits (145), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 46/150 (30%), Positives = 68/150 (45%), Gaps = 10/150 (6%)

Query: 324 FPPQNLPRPSRSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLV 377
            P Q  PR  R H    Q +T      +SDP+ LQ I         +R   IA  G  L+
Sbjct: 617 LPLQVNPRTGRVHTSYHQAVTATGRLSSSDPN-LQNIPIRSAEGRRIRQAFIAPPGYCLL 675

Query: 378 VADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMEL 437
            AD + IE R++A ++ ++  L AFE GED++  T A  F      VT +QR   K +  
Sbjct: 676 AADYSQIELRIMAHLSDDEGLLAAFEAGEDIHQRTAAEIFRTPLEGVTPEQRRSAKAINF 735

Query: 438 ALGYQGGAKAFQKMASTTGLNLNTFAHLVK 467
            L Y   A     +A   G++ +   H ++
Sbjct: 736 GLIYGMSAHG---LAQQLGISRSAAQHYIE 762


>gi|218767443|ref|YP_002341955.1| DNA polymerase I [Neisseria meningitidis Z2491]
 gi|121051451|emb|CAM07744.1| DNA polymerase I [Neisseria meningitidis Z2491]
          Length = 938

 Score = 60.5 bits (145), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 50/99 (50%)

Query: 364 VRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQ 423
           VR    A +G  +V AD + IE R++A ++G++  + AF+ GED++  T A  F +AP  
Sbjct: 690 VRRAFTAPQGSVIVSADYSQIELRIMAHLSGDKTLIAAFQNGEDVHRRTAAEVFGIAPEN 749

Query: 424 VTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTF 462
           V+ +QR   K +   L Y  G     K      ++   F
Sbjct: 750 VSSEQRRYAKTINFGLIYGMGQYGLAKSLGIDNISAKNF 788


>gi|313669194|ref|YP_004049478.1| DNA polymerase I [Neisseria lactamica ST-640]
 gi|313006656|emb|CBN88122.1| DNA polymerase I [Neisseria lactamica 020-06]
          Length = 932

 Score = 60.1 bits (144), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 42/145 (28%), Positives = 63/145 (43%), Gaps = 7/145 (4%)

Query: 324 FPPQNLPRPSRSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLV 377
            P    PR  R H    Q +        ++P+ LQ I         VR    A  G  +V
Sbjct: 646 LPEMISPRDKRVHTTYAQAVAITGRLAGNNPN-LQNIPIRTEEGRKVRRAFTAPPGSVIV 704

Query: 378 VADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMEL 437
            AD + IE R++A ++G++  + AF+ GED++  T A  F +AP  V+ +QR   K +  
Sbjct: 705 SADYSQIELRIMAHLSGDKTLIAAFQNGEDVHRRTAAEVFGIAPENVSSEQRRYAKTINF 764

Query: 438 ALGYQGGAKAFQKMASTTGLNLNTF 462
            L Y  G     K      L+   F
Sbjct: 765 GLIYGMGQYGLAKSLGIDNLSAKNF 789


>gi|300690852|ref|YP_003751847.1| DNA polymerase I (POL I) [Ralstonia solanacearum PSI07]
 gi|299077912|emb|CBJ50551.1| DNA polymerase I (POL I) [Ralstonia solanacearum PSI07]
          Length = 944

 Score = 60.1 bits (144), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 46/157 (29%), Positives = 72/157 (45%), Gaps = 10/157 (6%)

Query: 308 LQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITSDPDPLQII------S 361
           L F G ++         P    P+  R H    Q         ++DP+ LQ I       
Sbjct: 636 LDFRGLAKLKSTYTDKLPKMVNPQTGRVHTTYGQATAVTGRLASTDPN-LQNIPVRTEEG 694

Query: 362 DCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAP 421
             +R   +A  G  +V AD + IE R++A ++ ++  ++AF  G+D++  T A  F V P
Sbjct: 695 RRIREAFVAPAGSVIVSADYSQIELRIMAHLSEDEGLMRAFREGQDVHRATAAEVFGVTP 754

Query: 422 AQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLN 458
            +VT +QR   KV+   L Y  G  AF  +AS  G+ 
Sbjct: 755 LEVTAEQRRYAKVINFGLIY--GMSAF-GLASNLGIG 788


>gi|113460863|ref|YP_718930.1| DNA polymerase I [Haemophilus somnus 129PT]
 gi|112822906|gb|ABI24995.1| DNA polymerase I [Haemophilus somnus 129PT]
          Length = 951

 Score = 60.1 bits (144), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 38/124 (30%), Positives = 62/124 (50%), Gaps = 9/124 (7%)

Query: 331 RPSRSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLVVADLAGI 384
           +  R H    Q +T      +SDP+ LQ I        C+R   IA +G K++ AD + I
Sbjct: 676 KTGRVHTSYHQAVTATGRLSSSDPN-LQNIPIKNEEGHCIRQAFIARKGYKIIAADYSQI 734

Query: 385 EARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGG 444
           E R++A ++ +   + AF  G+D++ +T A  F +   +VT +QR   K +   L Y  G
Sbjct: 735 ELRIMAHLSQDNGLIMAFNEGKDIHRSTAAEIFGIPLNEVTSEQRRSAKAINFGLIY--G 792

Query: 445 AKAF 448
             +F
Sbjct: 793 MSSF 796


>gi|161869227|ref|YP_001598393.1| DNA polymerase I [Neisseria meningitidis 053442]
 gi|161594780|gb|ABX72440.1| DNA polymerase I [Neisseria meningitidis 053442]
          Length = 930

 Score = 60.1 bits (144), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 50/99 (50%)

Query: 364 VRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQ 423
           VR    A +G  +V AD + IE R++A ++G++  + AF+ GED++  T A  F +AP  
Sbjct: 690 VRRAFTAPQGSVIVSADYSQIELRIMAHLSGDKTLIAAFQNGEDVHRRTAAEVFGIAPEN 749

Query: 424 VTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTF 462
           V+ +QR   K +   L Y  G     K      ++   F
Sbjct: 750 VSSEQRRYAKTINFGLIYGMGQYGLAKSLGIDNISAKNF 788


>gi|319638957|ref|ZP_07993715.1| DNA polymerase I [Neisseria mucosa C102]
 gi|317399861|gb|EFV80524.1| DNA polymerase I [Neisseria mucosa C102]
          Length = 930

 Score = 60.1 bits (144), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 50/99 (50%)

Query: 364 VRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQ 423
           VR    A +G  +V AD + IE R++A ++G++  + AF+ GED++  T A  F +AP  
Sbjct: 690 VRRAFTAPQGSIIVSADYSQIELRIMAHLSGDKTLIAAFQNGEDVHRRTAAEVFGIAPEN 749

Query: 424 VTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTF 462
           V+ +QR   K +   L Y  G     K      ++   F
Sbjct: 750 VSSEQRRYAKTINFGLIYGMGQYGLAKSLGIDNISAKNF 788


>gi|319409706|emb|CBY90010.1| DNA polymerase I (POL I) [Neisseria meningitidis WUE 2594]
          Length = 938

 Score = 60.1 bits (144), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 50/99 (50%)

Query: 364 VRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQ 423
           VR    A +G  +V AD + IE R++A ++G++  + AF+ GED++  T A  F +AP  
Sbjct: 690 VRRAFTAPQGSVIVSADYSQIELRIMAHLSGDKTLIAAFQNGEDVHRRTAAEVFGIAPEN 749

Query: 424 VTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTF 462
           V+ +QR   K +   L Y  G     K      ++   F
Sbjct: 750 VSSEQRRYAKTINFGLIYGMGQYGLAKSLGIDNISAKNF 788


>gi|256823707|ref|YP_003147670.1| DNA polymerase I [Kangiella koreensis DSM 16069]
 gi|256797246|gb|ACV27902.1| DNA polymerase I [Kangiella koreensis DSM 16069]
          Length = 915

 Score = 60.1 bits (144), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 36/106 (33%), Positives = 57/106 (53%), Gaps = 3/106 (2%)

Query: 363 CVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPA 422
            +R+  IA +G K++ AD + IE R++A ++ ++  LKAFE G D++  T A  F+V   
Sbjct: 676 SIRTAFIAPKGSKILAADYSQIELRIMAHLSQDEGLLKAFEEGLDVHSATAAEVFDVPLD 735

Query: 423 QVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVKT 468
           +VT +QR   K +   L Y  G  AF  +A     + NT    + T
Sbjct: 736 EVTSNQRRNAKAINFGLIY--GMSAF-GLAKQIDTDRNTAQDYINT 778


>gi|261492276|ref|ZP_05988839.1| DNA-directed DNA polymerase I [Mannheimia haemolytica serotype A2
           str. BOVINE]
 gi|261312055|gb|EEY13195.1| DNA-directed DNA polymerase I [Mannheimia haemolytica serotype A2
           str. BOVINE]
          Length = 952

 Score = 60.1 bits (144), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 39/124 (31%), Positives = 62/124 (50%), Gaps = 9/124 (7%)

Query: 331 RPSRSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLVVADLAGI 384
           +  R H   +Q +T      +SDP+ LQ I         +R   +A EG K+V AD + I
Sbjct: 676 KTGRVHTSYNQAVTATGRLSSSDPN-LQNIPIRNEEGRRIRQAFVAREGYKIVAADYSQI 734

Query: 385 EARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGG 444
           E R++A ++ ++  + AF  G+D++  T A  F V   +VT +QR   K +   L Y  G
Sbjct: 735 ELRIMAHLSNDEGMINAFAEGKDIHRATAAEIFGVELGEVTSEQRRSAKAINFGLIY--G 792

Query: 445 AKAF 448
             +F
Sbjct: 793 MSSF 796


>gi|261494497|ref|ZP_05990983.1| DNA-directed DNA polymerase I [Mannheimia haemolytica serotype A2
           str. OVINE]
 gi|261309881|gb|EEY11098.1| DNA-directed DNA polymerase I [Mannheimia haemolytica serotype A2
           str. OVINE]
          Length = 952

 Score = 60.1 bits (144), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 39/124 (31%), Positives = 62/124 (50%), Gaps = 9/124 (7%)

Query: 331 RPSRSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLVVADLAGI 384
           +  R H   +Q +T      +SDP+ LQ I         +R   +A EG K+V AD + I
Sbjct: 676 KTGRVHTSYNQAVTATGRLSSSDPN-LQNIPIRNEEGRRIRQAFVAREGYKIVAADYSQI 734

Query: 385 EARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGG 444
           E R++A ++ ++  + AF  G+D++  T A  F V   +VT +QR   K +   L Y  G
Sbjct: 735 ELRIMAHLSNDEGMINAFAEGKDIHRATAAEIFGVELGEVTSEQRRSAKAINFGLIY--G 792

Query: 445 AKAF 448
             +F
Sbjct: 793 MSSF 796


>gi|210077499|gb|ACJ07014.1| PolI [Thermus sp. ATCC 27737]
          Length = 830

 Score = 60.1 bits (144), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 81/322 (25%), Positives = 129/322 (40%), Gaps = 51/322 (15%)

Query: 142 LYDRNKPNHREAWRLFGEYCKGDVT----VTREIFKRLEPLSSKEQELWYLDQTIND--- 194
           L D    N     R +G   K D      ++  +++ L P  ++E+ L +L + +     
Sbjct: 377 LLDPGNTNPEGVARRYGGEWKEDAAARALLSERLWQALYPRVAEEERLLWLYREVERPLA 436

Query: 195 --------RGYCVDVALAHTLNQIVDVERTKLDQELESLTYGLVSSSRCLEKLKTWLFLE 246
                    G  +DV     L+Q V  E  +L+ E+  L  G   +    ++L+  LF E
Sbjct: 437 QVLAHMEATGVRLDVPYLEALSQEVAFELERLEAEVHRLA-GHPFNLNSRDQLERVLFDE 495

Query: 247 TGLHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLNTLVEAMNSDGRLRG 306
            GL     TE T +R                     ++ +AVL+L  L EA    GR+  
Sbjct: 496 LGLPPIGKTEKTGKR---------------------STSAAVLEL--LREAHPIVGRILE 532

Query: 307 TLQFLGASRTGRWSGCVFPPQNL--PRPSRSHEELDQIITHLPTSITSDPDPLQI----- 359
             + +    T      + P   L  P+  R H   +Q  T      +SDP+   I     
Sbjct: 533 YRELMKLKST-----YIDPLPRLVHPKTGRLHTRFNQTATATGRLSSSDPNLQNIPVRTP 587

Query: 360 ISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNV 419
           +   +R   IA EG  LV  D + IE RVLA ++G++  ++ F  G+D++  T A  F V
Sbjct: 588 LGQRIRKAFIAEEGHLLVALDYSQIELRVLAHLSGDENLIRVFREGKDIHTETAAWMFGV 647

Query: 420 APAQVTKDQRAIGKVMELALGY 441
            P  V    R   K +   + Y
Sbjct: 648 PPEGVDGAMRRAAKTVNFGVLY 669


>gi|261401773|ref|ZP_05987898.1| DNA polymerase I [Neisseria lactamica ATCC 23970]
 gi|269208086|gb|EEZ74541.1| DNA polymerase I [Neisseria lactamica ATCC 23970]
          Length = 939

 Score = 60.1 bits (144), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 42/145 (28%), Positives = 63/145 (43%), Gaps = 7/145 (4%)

Query: 324 FPPQNLPRPSRSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLV 377
            P    PR  R H    Q +        ++P+ LQ I         VR    A  G  +V
Sbjct: 646 LPEMISPRDKRVHTTYAQAVAITGRLAGNNPN-LQNIPIRTEEGRKVRRAFTAPPGSVIV 704

Query: 378 VADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMEL 437
            AD + IE R++A ++G++  + AF+ GED++  T A  F +AP  V+ +QR   K +  
Sbjct: 705 SADYSQIELRIMAHLSGDKTLIAAFQNGEDVHRRTAAEVFGIAPENVSSEQRRYAKTINF 764

Query: 438 ALGYQGGAKAFQKMASTTGLNLNTF 462
            L Y  G     K      L+   F
Sbjct: 765 GLIYGMGQYGLAKSLGIDNLSAKNF 789


>gi|254360483|ref|ZP_04976632.1| DNA-directed DNA polymerase I [Mannheimia haemolytica PHL213]
 gi|153091023|gb|EDN73028.1| DNA-directed DNA polymerase I [Mannheimia haemolytica PHL213]
          Length = 952

 Score = 60.1 bits (144), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 39/124 (31%), Positives = 62/124 (50%), Gaps = 9/124 (7%)

Query: 331 RPSRSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLVVADLAGI 384
           +  R H   +Q +T      +SDP+ LQ I         +R   +A EG K+V AD + I
Sbjct: 676 KTGRVHTSYNQAVTATGRLSSSDPN-LQNIPIRNEEGRRIRQAFVAREGYKIVAADYSQI 734

Query: 385 EARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGG 444
           E R++A ++ ++  + AF  G+D++  T A  F V   +VT +QR   K +   L Y  G
Sbjct: 735 ELRIMAHLSNDEGMINAFAEGKDIHRATAAEIFGVELGEVTSEQRRSAKAINFGLIY--G 792

Query: 445 AKAF 448
             +F
Sbjct: 793 MSSF 796


>gi|115378925|ref|ZP_01466060.1| DNA polymerase I [Stigmatella aurantiaca DW4/3-1]
 gi|115364075|gb|EAU63175.1| DNA polymerase I [Stigmatella aurantiaca DW4/3-1]
          Length = 852

 Score = 60.1 bits (144), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 70/253 (27%), Positives = 105/253 (41%), Gaps = 31/253 (12%)

Query: 192 INDRGYCVDVALAHTLNQIVDVE-RTKLDQ--ELESLTYGLVSSSRCLEKLKTWLFLETG 248
           +  +G  +D A+  TL+  VD E  TKL     L    + + S+ +  + L   L L   
Sbjct: 466 MEQQGVKLDTAVFKTLSTQVDAECETKLKHIHTLAGQEFNVGSNPQLAQVLYEKLQLPI- 524

Query: 249 LHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLNTLVEAMNSDGRLRGTL 308
           L       +T Q VL    +  P    +   R   S+     L+TL   +  DGR+  T 
Sbjct: 525 LKKGKTGPSTDQEVLEKLAEQHPLPGAILEYR-SLSKLKSTYLDTLPGLVAKDGRIHTTY 583

Query: 309 QFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITSDPDPLQIISDCVRSCV 368
               A+ TGR S      QN+P           + T L   I              R   
Sbjct: 584 H-QAATATGRLSSSDPNLQNIP-----------VRTELGREI--------------RRAF 617

Query: 369 IASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQ 428
           +A  G +LV AD + +E R+LA +A +   L AF+  ED++  T A  F V P +V +DQ
Sbjct: 618 VAEAGYQLVSADYSQVELRLLAHIAEDPVLLDAFQHDEDIHSRTAAEIFGVTPDKVDRDQ 677

Query: 429 RAIGKVMELALGY 441
           R + K +   + Y
Sbjct: 678 RRVAKTVNFGIAY 690


>gi|325129412|gb|EGC52244.1| DNA polymerase I [Neisseria meningitidis OX99.30304]
          Length = 937

 Score = 60.1 bits (144), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 50/99 (50%)

Query: 364 VRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQ 423
           VR    A +G  +V AD + IE R++A ++G++  + AF+ GED++  T A  F +AP  
Sbjct: 689 VRRAFTAPQGSVIVSADYSQIELRIMAHLSGDKTLIAAFQNGEDVHRRTAAEVFGIAPEN 748

Query: 424 VTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTF 462
           V+ +QR   K +   L Y  G     K      ++   F
Sbjct: 749 VSSEQRRYAKTINFGLIYGMGQYGLAKSLGIDNISAKNF 787


>gi|309378893|emb|CBX22480.1| unnamed protein product [Neisseria lactamica Y92-1009]
          Length = 939

 Score = 60.1 bits (144), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 49/99 (49%)

Query: 364 VRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQ 423
           VR    A  G  +V AD + IE R++A ++G++  + AF+ GED++  T A  F +AP  
Sbjct: 691 VRRAFTAPPGSVIVSADYSQIELRIMAHLSGDKTLIAAFQNGEDVHRRTAAEVFGIAPEN 750

Query: 424 VTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTF 462
           V+ +QR   K +   L Y  G     K      L+   F
Sbjct: 751 VSPEQRRYAKTINFGLIYGMGQYGLAKSLGIDNLSAKNF 789


>gi|258592992|emb|CBE69303.1| DNA polymerase I (POL I) [NC10 bacterium 'Dutch sediment']
          Length = 873

 Score = 60.1 bits (144), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 36/114 (31%), Positives = 58/114 (50%), Gaps = 5/114 (4%)

Query: 333 SRSHEELDQIITHLPTSITSDPDPLQI-----ISDCVRSCVIASEGKKLVVADLAGIEAR 387
            R H   +Q +T      +S+P+   I     +   +R   +ASEG +L+ AD + IE R
Sbjct: 597 GRIHTSFNQTVTATGRLSSSEPNLQNIPVRTEVGRRIRQAFVASEGHRLLSADYSQIELR 656

Query: 388 VLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGY 441
           +LA ++ +Q  + AF  G D++ +T A  F V P  VT + R   KV+   + Y
Sbjct: 657 ILAHLSQDQALIAAFIAGGDVHRSTAAEVFGVQPEAVTVEMRRRAKVINFGIVY 710


>gi|261344431|ref|ZP_05972075.1| DNA polymerase I [Providencia rustigianii DSM 4541]
 gi|282567335|gb|EFB72870.1| DNA polymerase I [Providencia rustigianii DSM 4541]
          Length = 934

 Score = 60.1 bits (144), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 42/125 (33%), Positives = 61/125 (48%), Gaps = 9/125 (7%)

Query: 330 PRPSRSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLVVADLAG 383
           P+  R H    Q +T      + DP+ LQ I         +R   IA +G K++ AD + 
Sbjct: 656 PKTGRVHTSYHQAVTATGRLSSRDPN-LQNIPVRTEEGRRIRQAFIARKGYKVMAADYSQ 714

Query: 384 IEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQG 443
           IE R++A ++ ++  L AF  G+D++  T A  F V   QVT DQR   K +   L Y  
Sbjct: 715 IELRIMAHLSQDKGLLTAFAEGKDIHKATAAEVFGVPLDQVTSDQRRSAKAINFGLIY-- 772

Query: 444 GAKAF 448
           G  AF
Sbjct: 773 GMSAF 777


>gi|37678370|ref|NP_932979.1| DNA polymerase I [Vibrio vulnificus YJ016]
 gi|37197109|dbj|BAC92950.1| DNA polymerase I [Vibrio vulnificus YJ016]
          Length = 957

 Score = 60.1 bits (144), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 61/125 (48%), Gaps = 9/125 (7%)

Query: 330 PRPSRSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLVVADLAG 383
           P   R H    Q +T      ++DP+ LQ I         +R   +A  G K++  D + 
Sbjct: 678 PHTGRVHTSYHQAVTATGRLSSTDPN-LQNIPIRNEEGRRIRQAFVAPHGYKILAVDYSQ 736

Query: 384 IEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQG 443
           IE R++A ++G+Q  L AF+ G+D++  T A    V+  QV+ +QR   K +   L Y  
Sbjct: 737 IELRIMAHLSGDQALLDAFQQGKDIHAATAAEIMGVSIEQVSSEQRRRAKAVNFGLIY-- 794

Query: 444 GAKAF 448
           G  AF
Sbjct: 795 GMSAF 799


>gi|325206887|gb|ADZ02340.1| DNA polymerase I [Neisseria meningitidis M04-240196]
          Length = 938

 Score = 60.1 bits (144), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 41/145 (28%), Positives = 64/145 (44%), Gaps = 7/145 (4%)

Query: 324 FPPQNLPRPSRSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLV 377
            P    P+  R H    Q +       +++P+ LQ I         VR    A +G  +V
Sbjct: 645 LPEMISPKDGRVHTTYAQAVAITGRLASNNPN-LQNIPIRTEEGRKVRRAFTAPQGSVIV 703

Query: 378 VADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMEL 437
            AD + IE R++A ++G++  + AF+ GED++  T A  F  AP  V+ +QR   K +  
Sbjct: 704 SADYSQIELRIMAHLSGDKTLIAAFQNGEDVHRRTAAEVFGTAPENVSSEQRRYAKTINF 763

Query: 438 ALGYQGGAKAFQKMASTTGLNLNTF 462
            L Y  G     K      L+   F
Sbjct: 764 GLIYGMGQYGLAKSLGIDNLSAKNF 788


>gi|307546592|ref|YP_003899071.1| DNA polymerase I [Halomonas elongata DSM 2581]
 gi|307218616|emb|CBV43886.1| DNA polymerase I [Halomonas elongata DSM 2581]
          Length = 922

 Score = 60.1 bits (144), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 39/118 (33%), Positives = 58/118 (49%), Gaps = 7/118 (5%)

Query: 330 PRPSRSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLVVADLAG 383
           P   R H    Q +T      +SDP+ LQ I         +R   +A  G +LV AD + 
Sbjct: 644 PTTGRLHTSYHQAVTATGRLSSSDPN-LQNIPIRTEQGRRIRQAFVARPGYRLVAADYSQ 702

Query: 384 IEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGY 441
           IE R++A ++G++  L AF  G D++  T A  F VA  +V+ +QR   K +   L Y
Sbjct: 703 IELRIMAHLSGDKGLLDAFAQGRDIHAATAAEVFGVALDKVSGEQRRSAKAINFGLIY 760


>gi|241758960|ref|ZP_04757072.1| DNA polymerase I [Neisseria flavescens SK114]
 gi|241320781|gb|EER57014.1| DNA polymerase I [Neisseria flavescens SK114]
          Length = 935

 Score = 60.1 bits (144), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 50/99 (50%)

Query: 364 VRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQ 423
           VR    A +G  +V AD + IE R++A ++G++  + AF+ GED++  T A  F +AP  
Sbjct: 694 VRRAFTAPQGSVIVSADYSQIELRIMAHLSGDKTLIAAFQNGEDVHRRTAAEVFGIAPEN 753

Query: 424 VTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTF 462
           V+ +QR   K +   L Y  G     K      ++   F
Sbjct: 754 VSSEQRRYAKTINFGLIYGMGQYGLAKSLGIDNISAKNF 792


>gi|225075916|ref|ZP_03719115.1| hypothetical protein NEIFLAOT_00940 [Neisseria flavescens
           NRL30031/H210]
 gi|224952772|gb|EEG33981.1| hypothetical protein NEIFLAOT_00940 [Neisseria flavescens
           NRL30031/H210]
          Length = 937

 Score = 60.1 bits (144), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 42/145 (28%), Positives = 64/145 (44%), Gaps = 7/145 (4%)

Query: 324 FPPQNLPRPSRSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLV 377
            P    PR +R H    Q +       +++P+ LQ I         VR    A  G  +V
Sbjct: 645 LPEMISPRDNRVHTTYAQAVAITGRLASNNPN-LQNIPIRTAEGRRVRRAFTAPPGSVIV 703

Query: 378 VADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMEL 437
            AD + IE R++A ++G++  + AF+ GED++  T A  F  AP  V+ +QR   K +  
Sbjct: 704 SADYSQIELRIMAHLSGDKTLIAAFQNGEDVHRRTAAEVFGTAPENVSPEQRRYAKTINF 763

Query: 438 ALGYQGGAKAFQKMASTTGLNLNTF 462
            L Y  G     K      L+   F
Sbjct: 764 GLIYGMGQYGLAKSLGIDNLSAKNF 788


>gi|261393312|emb|CAX50944.1| DNA polymerase I (POL I) [Neisseria meningitidis 8013]
          Length = 930

 Score = 60.1 bits (144), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 41/145 (28%), Positives = 64/145 (44%), Gaps = 7/145 (4%)

Query: 324 FPPQNLPRPSRSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLV 377
            P    P+  R H    Q +       +++P+ LQ I         VR    A +G  +V
Sbjct: 645 LPEMISPKDGRVHTTYAQAVAITGRLASNNPN-LQNIPIRTAEGRRVRRAFTAPQGSVIV 703

Query: 378 VADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMEL 437
            AD + IE R++A ++G++  + AF+ GED++  T A  F  AP  V+ +QR   K +  
Sbjct: 704 SADYSQIELRIMAHLSGDKTLIAAFQNGEDVHRRTAAEVFGTAPENVSSEQRRYAKTINF 763

Query: 438 ALGYQGGAKAFQKMASTTGLNLNTF 462
            L Y  G     K      L+   F
Sbjct: 764 GLIYGMGQYGLAKSLGIDNLSAKNF 788


>gi|284009008|emb|CBA75937.1| DNA polymerase I [Arsenophonus nasoniae]
          Length = 936

 Score = 60.1 bits (144), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 42/125 (33%), Positives = 60/125 (48%), Gaps = 9/125 (7%)

Query: 330 PRPSRSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLVVADLAG 383
           P+  R H    Q +T      + DP+ LQ I         +R   IA EG K+V AD + 
Sbjct: 658 PKTKRVHTSYHQAVTATGRLSSRDPN-LQNIPVRTEEGRRIRQAFIAREGYKIVAADYSQ 716

Query: 384 IEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQG 443
           IE R++A ++ ++  L AF  G+D++  T A  F V    VT +QR   K +   L Y  
Sbjct: 717 IELRIMAHLSQDKGLLDAFAEGQDIHRATAAEVFGVLLTDVTNEQRRSAKAINFGLIY-- 774

Query: 444 GAKAF 448
           G  AF
Sbjct: 775 GMSAF 779


>gi|325143690|gb|EGC66009.1| DNA polymerase I [Neisseria meningitidis M01-240013]
          Length = 983

 Score = 60.1 bits (144), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 41/145 (28%), Positives = 64/145 (44%), Gaps = 7/145 (4%)

Query: 324 FPPQNLPRPSRSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLV 377
            P    P+  R H    Q +       +++P+ LQ I         VR    A +G  +V
Sbjct: 690 LPEMISPKDGRVHTTYAQAVAITGRLASNNPN-LQNIPIRTEEGRKVRRAFTAPQGSVIV 748

Query: 378 VADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMEL 437
            AD + IE R++A ++G++  + AF+ GED++  T A  F  AP  V+ +QR   K +  
Sbjct: 749 SADYSQIELRIMAHLSGDKTLIAAFQNGEDVHRRTAAEVFGTAPENVSSEQRRYAKTINF 808

Query: 438 ALGYQGGAKAFQKMASTTGLNLNTF 462
            L Y  G     K      L+   F
Sbjct: 809 GLIYGMGQYGLAKSLGIDNLSAKNF 833


>gi|269956308|ref|YP_003326097.1| DNA polymerase I [Xylanimonas cellulosilytica DSM 15894]
 gi|269304989|gb|ACZ30539.1| DNA polymerase I [Xylanimonas cellulosilytica DSM 15894]
          Length = 905

 Score = 60.1 bits (144), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 54/187 (28%), Positives = 86/187 (45%), Gaps = 35/187 (18%)

Query: 277 FNNRMRASRSAV---LKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPS 333
           F   + A R A    + +  L+++++ DGR+  T Q   A+ TGR S      QN+P  +
Sbjct: 600 FLEHLLAHRDAAKLRVTVEGLLKSVHPDGRIHTTFQQTIAA-TGRLSSTEPNLQNIPIRT 658

Query: 334 RSHEELDQIITHLPTSITSDPDPLQIISDCVRSCVIASEG-KKLVVADLAGIEARVLAWM 392
            +  +                         +R      EG + L+ AD + IE R++A +
Sbjct: 659 EAGRQ-------------------------IRRAFRVGEGFESLLTADYSQIEMRIMAHL 693

Query: 393 AGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAF---Q 449
           +G++  ++AF TGEDL+    +R F V PA VT + R+  K M   L Y  G  AF   Q
Sbjct: 694 SGDEGLIEAFRTGEDLHRYVGSRVFGVEPAGVTAEMRSKVKAMSYGLAY--GLSAFGLSQ 751

Query: 450 KMASTTG 456
           ++   TG
Sbjct: 752 QLGIATG 758


>gi|37524397|ref|NP_927741.1| DNA polymerase I [Photorhabdus luminescens subsp. laumondii TTO1]
 gi|36783821|emb|CAE12681.1| DNA polymerase I [Photorhabdus luminescens subsp. laumondii TTO1]
          Length = 929

 Score = 60.1 bits (144), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 43/130 (33%), Positives = 64/130 (49%), Gaps = 10/130 (7%)

Query: 326 PQNL-PRPSRSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLVV 378
           PQ + P   R H    Q +T      + DP+ LQ I         +R   +A EG +++ 
Sbjct: 646 PQMVHPLTKRVHTSYHQAVTATGRLSSRDPN-LQNIPVRNKEGRRIRQAFVAPEGYRIMA 704

Query: 379 ADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELA 438
           AD + IE R++A ++ +Q  LKAF  G+D++  T A  F +   QVT +QR   K +   
Sbjct: 705 ADYSQIELRIMAHLSQDQGLLKAFAEGKDIHRATAAEVFGLPLEQVTSEQRRSAKAINFG 764

Query: 439 LGYQGGAKAF 448
           L Y  G  AF
Sbjct: 765 LIY--GMSAF 772


>gi|170717348|ref|YP_001784457.1| DNA polymerase I [Haemophilus somnus 2336]
 gi|168825477|gb|ACA30848.1| DNA polymerase I [Haemophilus somnus 2336]
          Length = 951

 Score = 60.1 bits (144), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 38/124 (30%), Positives = 62/124 (50%), Gaps = 9/124 (7%)

Query: 331 RPSRSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLVVADLAGI 384
           +  R H    Q +T      +SDP+ LQ I        C+R   IA +G K++ AD + I
Sbjct: 676 KTGRVHTSYHQAVTATGRLSSSDPN-LQNIPIKNEEGRCIRQAFIARKGYKIIAADYSQI 734

Query: 385 EARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGG 444
           E R++A ++ +   + AF  G+D++ +T A  F +   +VT +QR   K +   L Y  G
Sbjct: 735 ELRIMAHLSQDNGLIMAFNEGKDIHRSTAAEIFGIPLNEVTSEQRRSAKAINFGLIY--G 792

Query: 445 AKAF 448
             +F
Sbjct: 793 MSSF 796


>gi|121635640|ref|YP_975885.1| DNA polymerase I [Neisseria meningitidis FAM18]
 gi|120867346|emb|CAM11117.1| DNA polymerase I [Neisseria meningitidis FAM18]
 gi|325137472|gb|EGC60058.1| DNA polymerase I [Neisseria meningitidis ES14902]
          Length = 930

 Score = 60.1 bits (144), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 41/145 (28%), Positives = 64/145 (44%), Gaps = 7/145 (4%)

Query: 324 FPPQNLPRPSRSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLV 377
            P    P+  R H    Q +       +++P+ LQ I         VR    A +G  +V
Sbjct: 645 LPEMISPKDGRVHTTYAQAVAITGRLASNNPN-LQNIPIRTAEGRRVRRAFTAPQGSVIV 703

Query: 378 VADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMEL 437
            AD + IE R++A ++G++  + AF+ GED++  T A  F  AP  V+ +QR   K +  
Sbjct: 704 SADYSQIELRIMAHLSGDKTLIAAFQNGEDVHRRTAAEVFGTAPENVSSEQRRYAKTINF 763

Query: 438 ALGYQGGAKAFQKMASTTGLNLNTF 462
            L Y  G     K      L+   F
Sbjct: 764 GLIYGMGQYGLAKSLGIDNLSAKNF 788


>gi|325201030|gb|ADY96485.1| DNA polymerase I [Neisseria meningitidis H44/76]
          Length = 916

 Score = 59.7 bits (143), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 41/145 (28%), Positives = 64/145 (44%), Gaps = 7/145 (4%)

Query: 324 FPPQNLPRPSRSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLV 377
            P    P+  R H    Q +       +++P+ LQ I         VR    A +G  +V
Sbjct: 623 LPEMISPKDGRVHTTYAQAVAITGRLASNNPN-LQNIPIRTEEGRKVRRAFTAPQGSVIV 681

Query: 378 VADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMEL 437
            AD + IE R++A ++G++  + AF+ GED++  T A  F  AP  V+ +QR   K +  
Sbjct: 682 SADYSQIELRIMAHLSGDKTLIAAFQNGEDVHRRTAAEVFGTAPENVSSEQRRYAKTINF 741

Query: 438 ALGYQGGAKAFQKMASTTGLNLNTF 462
            L Y  G     K      L+   F
Sbjct: 742 GLIYGMGQYGLAKSLGIDNLSAKNF 766


>gi|325127400|gb|EGC50333.1| DNA polymerase I [Neisseria meningitidis N1568]
          Length = 937

 Score = 59.7 bits (143), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 50/99 (50%)

Query: 364 VRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQ 423
           VR    A +G  +V AD + IE R++A ++G++  + AF+ GED++  T A  F +AP  
Sbjct: 689 VRRAFTAPQGSVIVSADYSQIELRIMAHLSGDKTLIAAFQNGEDVHRRTAAEVFGIAPEN 748

Query: 424 VTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTF 462
           V+ +QR   K +   L Y  G     K      ++   F
Sbjct: 749 VSPEQRRYAKTINFGLIYGMGQYGLAKSLGIDNISAKNF 787


>gi|157959932|ref|YP_001499966.1| DNA polymerase I [Shewanella pealeana ATCC 700345]
 gi|157844932|gb|ABV85431.1| DNA polymerase I [Shewanella pealeana ATCC 700345]
          Length = 918

 Score = 59.7 bits (143), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 33/85 (38%), Positives = 49/85 (57%), Gaps = 2/85 (2%)

Query: 364 VRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQ 423
           +R   IA EGKK++ AD + IE R++A ++ +   L AF  G+D++  T A  F+V  ++
Sbjct: 678 IRHAFIAPEGKKILAADYSQIELRIMAHLSQDTGLLTAFAEGKDIHKATAAEVFDVDFSE 737

Query: 424 VTKDQRAIGKVMELALGYQGGAKAF 448
           VT DQR   K +   L Y  G  AF
Sbjct: 738 VTSDQRRRAKAVNFGLIY--GMSAF 760


>gi|316985617|gb|EFV64564.1| DNA polymerase I [Neisseria meningitidis H44/76]
 gi|325139302|gb|EGC61843.1| DNA polymerase I [Neisseria meningitidis CU385]
          Length = 983

 Score = 59.7 bits (143), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 49/99 (49%)

Query: 364 VRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQ 423
           VR    A +G  +V AD + IE R++A ++G++  + AF+ GED++  T A  F  AP  
Sbjct: 735 VRRAFTAPQGSVIVSADYSQIELRIMAHLSGDKTLIAAFQNGEDVHRRTAAEVFGTAPEN 794

Query: 424 VTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTF 462
           V+ +QR   K +   L Y  G     K      L+   F
Sbjct: 795 VSSEQRRYAKTINFGLIYGMGQYGLAKSLGIDNLSAKNF 833


>gi|254673763|emb|CBA09444.1| DNA polymerase I [Neisseria meningitidis alpha275]
          Length = 931

 Score = 59.7 bits (143), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 42/145 (28%), Positives = 64/145 (44%), Gaps = 7/145 (4%)

Query: 324 FPPQNLPRPSRSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLV 377
            P    PR +R H    Q +       +++P+ LQ I         VR    A  G  +V
Sbjct: 645 LPDMISPRDNRVHTTYAQAVAITGRLASNNPN-LQNIPIRTAEGRRVRRAFTAPPGSVIV 703

Query: 378 VADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMEL 437
            AD + IE R++A ++G++  + AF+ GED++  T A  F  AP  V+ +QR   K +  
Sbjct: 704 SADYSQIELRIMAHLSGDKTLIAAFQNGEDVHRRTAAEVFGTAPENVSPEQRRYAKTINF 763

Query: 438 ALGYQGGAKAFQKMASTTGLNLNTF 462
            L Y  G     K      L+   F
Sbjct: 764 GLIYGMGQYGLAKSLGIDNLSAKNF 788


>gi|254670866|emb|CBA07349.1| DNA polymerase I [Neisseria meningitidis alpha153]
          Length = 930

 Score = 59.7 bits (143), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 49/99 (49%)

Query: 364 VRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQ 423
           VR    A +G  +V AD + IE R++A ++G++  + AF+ GED++  T A  F  AP  
Sbjct: 690 VRRAFTAPQGSVIVSADYSQIELRIMAHLSGDKTLIAAFQNGEDVHRRTAAEVFGTAPEN 749

Query: 424 VTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTF 462
           V+ +QR   K +   L Y  G     K      L+   F
Sbjct: 750 VSSEQRRYAKTINFGLIYGMGQYGLAKSLGIDNLSAKNF 788


>gi|325199072|gb|ADY94528.1| DNA polymerase I [Neisseria meningitidis G2136]
          Length = 930

 Score = 59.7 bits (143), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 49/99 (49%)

Query: 364 VRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQ 423
           VR    A +G  +V AD + IE R++A ++G++  + AF+ GED++  T A  F  AP  
Sbjct: 690 VRRAFTAPQGSVIVSADYSQIELRIMAHLSGDKTLIAAFQNGEDVHRRTAAEVFGTAPEN 749

Query: 424 VTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTF 462
           V+ +QR   K +   L Y  G     K      L+   F
Sbjct: 750 VSSEQRRYAKTINFGLIYGMGQYGLAKSLGIDNLSAKNF 788


>gi|212711548|ref|ZP_03319676.1| hypothetical protein PROVALCAL_02622 [Providencia alcalifaciens DSM
           30120]
 gi|212685650|gb|EEB45178.1| hypothetical protein PROVALCAL_02622 [Providencia alcalifaciens DSM
           30120]
          Length = 934

 Score = 59.7 bits (143), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 41/125 (32%), Positives = 61/125 (48%), Gaps = 9/125 (7%)

Query: 330 PRPSRSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLVVADLAG 383
           PR  R H    Q +T      + DP+ LQ I         +R   +A +G K++ AD + 
Sbjct: 656 PRTQRVHTSYHQAVTATGRLSSRDPN-LQNIPVRTEEGRRIRQAFVARDGYKVMAADYSQ 714

Query: 384 IEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQG 443
           IE R++A ++ ++  L AF  G+D++  T A  F V   +VT DQR   K +   L Y  
Sbjct: 715 IELRIMAHLSQDKGLLTAFAQGKDIHRATAAEVFGVPLEEVTSDQRRSAKAINFGLIY-- 772

Query: 444 GAKAF 448
           G  AF
Sbjct: 773 GMSAF 777


>gi|218886806|ref|YP_002436127.1| DNA polymerase I [Desulfovibrio vulgaris str. 'Miyazaki F']
 gi|218757760|gb|ACL08659.1| DNA polymerase I [Desulfovibrio vulgaris str. 'Miyazaki F']
          Length = 872

 Score = 59.7 bits (143), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 84/319 (26%), Positives = 127/319 (39%), Gaps = 62/319 (19%)

Query: 227 YGLVSSSRCLEKLKTWLFLETGLHLEDLTETTCQRVLS--SNKKLTPQAIQVFNNRMRAS 284
           + + SS +  E L   L L TG   +    +T Q VL   S +     AI  F  ++   
Sbjct: 519 FNIRSSQQLAELLFGTLGLPTGGKTKGGQTSTAQDVLEKLSGRHPVVDAILEFR-KLEKL 577

Query: 285 RSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIIT 344
           RS  L+   L   ++  GR+  T   L A+ TGR S      QN+P              
Sbjct: 578 RSTYLE--PLPRLVDGAGRIHTTFNQL-ATATGRLSSSNPNLQNIP-------------- 620

Query: 345 HLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFET 404
                +  D      +   +R+C  A+ G +LV AD + +E RVLA M+ +   L AF  
Sbjct: 621 -----VRGD------LGRRMRTCFTAAPGLRLVSADYSQVELRVLAHMSQDPTLLAAFRE 669

Query: 405 GEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAH 464
           G D++  T +  ++VA  QV+ DQR   K +   L Y  G    QK+A    + L     
Sbjct: 670 GADIHSRTASLLYDVAQDQVSTDQRRNAKTINFGLIYGMGP---QKLAQELRIPLTEAKA 726

Query: 465 LV-----KTNSAPEEWEDAENFC-------------RWMQENHPEH----------AIED 496
            +     K     E +++AE                R + E H E+          AI  
Sbjct: 727 FIERYFSKLQKLREFYDEAETTARELGYVTTMAGRRRLLPEIHSENTQLKSQARRQAINT 786

Query: 497 LFIGTACERVKKAWRQKHS 515
           L  G+A + +K A    H+
Sbjct: 787 LIQGSAADIIKLAMLAAHA 805


>gi|88802075|ref|ZP_01117603.1| DNA polymerase I [Polaribacter irgensii 23-P]
 gi|88782733|gb|EAR13910.1| DNA polymerase I [Polaribacter irgensii 23-P]
          Length = 980

 Score = 59.7 bits (143), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 43/152 (28%), Positives = 78/152 (51%), Gaps = 11/152 (7%)

Query: 324 FPPQNLPRPSRSHEELDQIITHLPTSITSDPDPLQIIS-------DCVRSCVIASEGKKL 376
            P +  P+  R H +  Q +       +++P+ LQ I        +  ++ V   E   L
Sbjct: 695 LPNEVNPKTGRIHTQYMQAVAATGRLSSNNPN-LQNIPIRTARGREVRKAFVPRDENHVL 753

Query: 377 VVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVME 436
           + AD + IE R++A ++ E+  + AF+ GED++ +T A+ FNV   +VT+DQR+  K + 
Sbjct: 754 LAADYSQIELRIIAALSEEENMINAFKNGEDIHASTAAKVFNVPLNEVTRDQRSNAKTVN 813

Query: 437 LALGYQGGAKAFQKMASTTGLNLNTFAHLVKT 468
             + Y  G  AF  +++ T L+ +    L+ T
Sbjct: 814 FGIVY--GVSAF-GLSNQTDLSRSEAKELIDT 842


>gi|325131391|gb|EGC54100.1| DNA polymerase I [Neisseria meningitidis M6190]
          Length = 975

 Score = 59.7 bits (143), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 49/99 (49%)

Query: 364 VRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQ 423
           VR    A +G  +V AD + IE R++A ++G++  + AF+ GED++  T A  F  AP  
Sbjct: 735 VRRAFTAPQGSVIVSADYSQIELRIMAHLSGDKTLIAAFQNGEDVHRRTAAEVFGTAPEN 794

Query: 424 VTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTF 462
           V+ +QR   K +   L Y  G     K      L+   F
Sbjct: 795 VSSEQRRYAKTINFGLIYGMGQYGLAKSLGIDNLSAKNF 833


>gi|240949360|ref|ZP_04753702.1| DNA polymerase I [Actinobacillus minor NM305]
 gi|240296210|gb|EER46863.1| DNA polymerase I [Actinobacillus minor NM305]
          Length = 950

 Score = 59.7 bits (143), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 39/117 (33%), Positives = 60/117 (51%), Gaps = 7/117 (5%)

Query: 331 RPSRSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLVVADLAGI 384
           +  R H    Q +T      +SDP+ LQ I         +R   IA +G K+V AD + I
Sbjct: 674 KTGRVHTSYHQAVTATGRLSSSDPN-LQNIPIRNEEGRRIRQAFIARKGYKIVAADYSQI 732

Query: 385 EARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGY 441
           E R++A +A ++  LKAF  G+D++ +T +  F V   +VT +QR   K +   L Y
Sbjct: 733 ELRIMAHLANDEGMLKAFAEGKDIHRSTASEIFGVPLDEVTGEQRRNAKAINFGLIY 789


>gi|330501084|ref|YP_004377953.1| DNA polymerase I [Pseudomonas mendocina NK-01]
 gi|328915370|gb|AEB56201.1| DNA polymerase I [Pseudomonas mendocina NK-01]
          Length = 960

 Score = 59.7 bits (143), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 45/131 (34%), Positives = 61/131 (46%), Gaps = 9/131 (6%)

Query: 324 FPPQNLPRPSRSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLV 377
            P Q  PR  R H    Q +       +SDP+ LQ I         +R   +A +G KL+
Sbjct: 676 LPEQINPRTGRIHTSYHQAVAATGRLSSSDPN-LQNIPIRTAEGRRIRQAFVAPKGYKLM 734

Query: 378 VADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMEL 437
            AD + IE R++A +A ++  L AF    D++  T A  F V   QVT DQR   K +  
Sbjct: 735 AADYSQIELRIMAHLAKDEGLLDAFRYDLDVHKATAAEVFGVPLDQVTSDQRRKAKAINF 794

Query: 438 ALGYQGGAKAF 448
            L Y  G  AF
Sbjct: 795 GLIY--GMSAF 803


>gi|325204933|gb|ADZ00387.1| DNA polymerase I [Neisseria meningitidis M01-240355]
          Length = 908

 Score = 59.7 bits (143), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 41/145 (28%), Positives = 64/145 (44%), Gaps = 7/145 (4%)

Query: 324 FPPQNLPRPSRSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLV 377
            P    P+  R H    Q +       +++P+ LQ I         VR    A +G  +V
Sbjct: 623 LPEMISPKDGRVHTTYAQAVAITGRLASNNPN-LQNIPIRTAEGRRVRRAFTAPQGSVIV 681

Query: 378 VADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMEL 437
            AD + IE R++A ++G++  + AF+ GED++  T A  F  AP  V+ +QR   K +  
Sbjct: 682 SADYSQIELRIMAHLSGDKTLIAAFQNGEDVHRRTAAEVFGTAPENVSSEQRRYAKTINF 741

Query: 438 ALGYQGGAKAFQKMASTTGLNLNTF 462
            L Y  G     K      L+   F
Sbjct: 742 GLIYGMGQYGLAKSLGIDNLSAKNF 766


>gi|320157741|ref|YP_004190120.1| DNA polymerase I [Vibrio vulnificus MO6-24/O]
 gi|319933053|gb|ADV87917.1| DNA polymerase I [Vibrio vulnificus MO6-24/O]
          Length = 931

 Score = 59.7 bits (143), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 61/125 (48%), Gaps = 9/125 (7%)

Query: 330 PRPSRSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLVVADLAG 383
           P   R H    Q +T      ++DP+ LQ I         +R   +A  G K++  D + 
Sbjct: 652 PHTGRVHTSYHQAVTATGRLSSTDPN-LQNIPIRNEEGRRIRQAFVAPHGYKILAVDYSQ 710

Query: 384 IEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQG 443
           IE R++A ++G+Q  L AF+ G+D++  T A    V+  QV+ +QR   K +   L Y  
Sbjct: 711 IELRIMAHLSGDQALLDAFQQGKDIHAATAAEIMGVSIEQVSSEQRRRAKAVNFGLIY-- 768

Query: 444 GAKAF 448
           G  AF
Sbjct: 769 GMSAF 773


>gi|310822212|ref|YP_003954570.1| DNA polymerase I [Stigmatella aurantiaca DW4/3-1]
 gi|309395284|gb|ADO72743.1| DNA polymerase I [Stigmatella aurantiaca DW4/3-1]
          Length = 899

 Score = 59.7 bits (143), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 68/253 (26%), Positives = 104/253 (41%), Gaps = 31/253 (12%)

Query: 192 INDRGYCVDVALAHTLNQIVDVE-RTKLDQ--ELESLTYGLVSSSRCLEKLKTWLFLETG 248
           +  +G  +D A+  TL+  VD E  TKL     L    + + S+ +  + L   L L   
Sbjct: 513 MEQQGVKLDTAVFKTLSTQVDAECETKLKHIHTLAGQEFNVGSNPQLAQVLYEKLQLPI- 571

Query: 249 LHLEDLTETTCQRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLNTLVEAMNSDGRLRGTL 308
           L       +T Q VL    +  P    +   R   S+     L+TL   +  DGR+  T 
Sbjct: 572 LKKGKTGPSTDQEVLEKLAEQHPLPGAILEYR-SLSKLKSTYLDTLPGLVAKDGRIHTTY 630

Query: 309 QFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITSDPDPLQIISDCVRSCV 368
               A+ TGR S      QN+P  +    E                         +R   
Sbjct: 631 H-QAATATGRLSSSDPNLQNIPVRTELGRE-------------------------IRRAF 664

Query: 369 IASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQ 428
           +A  G +LV AD + +E R+LA +A +   L AF+  ED++  T A  F V P +V +DQ
Sbjct: 665 VAEAGYQLVSADYSQVELRLLAHIAEDPVLLDAFQHDEDIHSRTAAEIFGVTPDKVDRDQ 724

Query: 429 RAIGKVMELALGY 441
           R + K +   + Y
Sbjct: 725 RRVAKTVNFGIAY 737


>gi|304388549|ref|ZP_07370650.1| DNA-directed DNA polymerase I [Neisseria meningitidis ATCC 13091]
 gi|304337469|gb|EFM03637.1| DNA-directed DNA polymerase I [Neisseria meningitidis ATCC 13091]
          Length = 975

 Score = 59.7 bits (143), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 49/99 (49%)

Query: 364 VRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQ 423
           VR    A +G  +V AD + IE R++A ++G++  + AF+ GED++  T A  F  AP  
Sbjct: 735 VRRAFTAPQGSVIVSADYSQIELRIMAHLSGDKTLIAAFQNGEDVHRRTAAEVFGTAPEN 794

Query: 424 VTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTF 462
           V+ +QR   K +   L Y  G     K      L+   F
Sbjct: 795 VSSEQRRYAKTINFGLIYGMGQYGLAKSLGIDNLSAKNF 833


>gi|27364348|ref|NP_759876.1| DNA polymerase I [Vibrio vulnificus CMCP6]
 gi|27360467|gb|AAO09403.1| DNA polymerase I [Vibrio vulnificus CMCP6]
          Length = 931

 Score = 59.7 bits (143), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 61/125 (48%), Gaps = 9/125 (7%)

Query: 330 PRPSRSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLVVADLAG 383
           P   R H    Q +T      ++DP+ LQ I         +R   +A  G K++  D + 
Sbjct: 652 PHTGRVHTSYHQAVTATGRLSSTDPN-LQNIPIRNEEGRRIRQAFVAPHGYKILAVDYSQ 710

Query: 384 IEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQG 443
           IE R++A ++G+Q  L AF+ G+D++  T A    V+  QV+ +QR   K +   L Y  
Sbjct: 711 IELRIMAHLSGDQALLDAFQQGKDIHAATAAEIMGVSIEQVSSEQRRRAKAVNFGLIY-- 768

Query: 444 GAKAF 448
           G  AF
Sbjct: 769 GMSAF 773


>gi|57233870|ref|YP_182100.1| DNA-directed DNA polymerase I [Dehalococcoides ethenogenes 195]
 gi|57224318|gb|AAW39375.1| DNA-directed DNA polymerase I [Dehalococcoides ethenogenes 195]
          Length = 903

 Score = 59.7 bits (143), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 45/170 (26%), Positives = 77/170 (45%), Gaps = 24/170 (14%)

Query: 330 PRPSRSHEELDQIITHLPTSITSDPDPLQI-----ISDCVRSCVIASEGKKLVVADLAGI 384
           P   R H   +Q  T      +S+P+   I     +   +R   IA  G  L+  D + I
Sbjct: 625 PHTRRLHTSFNQTRTATGRLSSSEPNLQNIPVRGEMGREIRRAFIAPPGTVLLAGDYSQI 684

Query: 385 EARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGG 444
           + RVLA ++ +   ++AF++ +D++  T AR  N+ P++VTK+QR + K +   + Y   
Sbjct: 685 DLRVLAHLSQDPALIEAFQSDQDIHTATAARLLNIPPSKVTKEQRRLAKTVNFGVIYG-- 742

Query: 445 AKAFQKMASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAI 494
                   S+ GL   T   L          E+A+ F +   E +P  A+
Sbjct: 743 -------MSSYGLEQATELSL----------EEADKFIKAYFEKYPRVAV 775


>gi|257464896|ref|ZP_05629267.1| DNA polymerase I [Actinobacillus minor 202]
 gi|257450556|gb|EEV24599.1| DNA polymerase I [Actinobacillus minor 202]
          Length = 950

 Score = 59.7 bits (143), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 39/117 (33%), Positives = 60/117 (51%), Gaps = 7/117 (5%)

Query: 331 RPSRSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIASEGKKLVVADLAGI 384
           +  R H    Q +T      +SDP+ LQ I         +R   IA +G K+V AD + I
Sbjct: 674 KTGRVHTSYHQAVTATGRLSSSDPN-LQNIPIRNEEGRRIRQAFIARKGYKIVAADYSQI 732

Query: 385 EARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGY 441
           E R++A +A ++  LKAF  G+D++ +T +  F V   +VT +QR   K +   L Y
Sbjct: 733 ELRIMAHLANDKGMLKAFAEGKDIHRSTASEIFGVPLDEVTGEQRRNAKAINFGLIY 789


>gi|94311560|ref|YP_584770.1| DNA polymerase I [Cupriavidus metallidurans CH34]
 gi|93355412|gb|ABF09501.1| fused DNA polymerase I 5'->3' exonuclease ; 3'->5' polymerase ;
           3'->5' exonuclease [Cupriavidus metallidurans CH34]
          Length = 934

 Score = 59.7 bits (143), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 35/103 (33%), Positives = 54/103 (52%), Gaps = 3/103 (2%)

Query: 364 VRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQ 423
           +R   IA+ G  +V AD + IE R++A ++G++  L+AF  GED++  T    F V    
Sbjct: 695 IREAFIAAPGNVIVSADYSQIELRIMAHISGDENLLRAFANGEDIHRATAGEIFGVEREA 754

Query: 424 VTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLV 466
           V+ +QR   KV+   L Y  G  AF  +AS  G+      H +
Sbjct: 755 VSSEQRRYAKVINFGLIY--GMSAF-GLASNLGIEREAAKHYI 794


>gi|325294546|ref|YP_004281060.1| DNA polymerase I [Desulfurobacterium thermolithotrophum DSM 11699]
 gi|325064994|gb|ADY73001.1| DNA polymerase I [Desulfurobacterium thermolithotrophum DSM 11699]
          Length = 838

 Score = 59.7 bits (143), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 87/355 (24%), Positives = 134/355 (37%), Gaps = 114/355 (32%)

Query: 290 KLNT-----LVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIIT 344
           KLN+     +++ M+ DGR+R T    G + TGR S      QNLP              
Sbjct: 551 KLNSTFVKGILKHMDEDGRVRTTFIQTGTA-TGRLSSAEPNLQNLP-------------- 595

Query: 345 HLPTSITSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFET 404
                  SD      IS  +R  V A  G  LV AD + IE R+LA ++ ++  L+A+  
Sbjct: 596 ------VSDE-----ISKKIRYAVTAPAGYNLVWADYSQIELRILAHLSQDEKLLEAYRK 644

Query: 405 GEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAH 464
           G D++  T +  F ++  +V +  R I K +   + Y         ++   G+++     
Sbjct: 645 GRDIHTETASYLFGISAEEVDERLRRIAKTVNFGIIYGMSPHG---LSERLGISV----- 696

Query: 465 LVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNEL 524
                      E+AE +     E  P              +VK+           + N L
Sbjct: 697 -----------EEAEKYIDRYFEKFP--------------KVKEY----------IENTL 721

Query: 525 HQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNNRSYLNTTT 584
            +A+E+     K I  RKR   PL  +K    N+            R  G  R+ +N T 
Sbjct: 722 REAYEKGY--VKTIFGRKR---PLPELKSSNKNI------------RSFG-ERAAVNAT- 762

Query: 585 RQLTREYTYGGKLTENIVQAVSRDILAEGMMNATKA----GYDIVLTVHDEIVCE 635
                            +Q  + DI+   M+   K     G  +VL VHDEIV E
Sbjct: 763 -----------------IQGTAADIMKLAMVKLYKKLEKLGAYMVLQVHDEIVIE 800


>gi|254518126|ref|ZP_05130182.1| DNA polymerase I [Clostridium sp. 7_2_43FAA]
 gi|226911875|gb|EEH97076.1| DNA polymerase I [Clostridium sp. 7_2_43FAA]
          Length = 532

 Score = 59.7 bits (143), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 43/165 (26%), Positives = 75/165 (45%), Gaps = 32/165 (19%)

Query: 294 LVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITSD 353
           L + +++DGR+R   + +G SR+GR S C  PP                           
Sbjct: 266 LKKFIDNDGRIRAHWRLIG-SRSGRMS-CNNPP--------------------------- 296

Query: 354 PDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTY 413
              LQ +    R   +A EG KL+ +D + IE RVLA ++ ++  +  F  G DL++ T 
Sbjct: 297 ---LQAMPGNSREFFVADEGYKLIGSDYSQIELRVLASISKDETLISYFNNGIDLHLGTA 353

Query: 414 ARSFNVAPAQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLN 458
           +  F     +++K++R + K +   + Y   A   QK    +G++
Sbjct: 354 SLIFKKPIDEISKEERQVAKSLNFGIVYGITAYGIQKNLRKSGVD 398


>gi|325133441|gb|EGC56105.1| DNA polymerase I [Neisseria meningitidis M13399]
          Length = 931

 Score = 59.7 bits (143), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 49/99 (49%)

Query: 364 VRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQ 423
           VR    A +G  +V AD + IE R++A ++G++  + AF+ GED++  T A  F  AP  
Sbjct: 690 VRRAFTAPQGSVIVSADYSQIELRIMAHLSGDKTLIAAFQNGEDVHRRTAAEVFGTAPEN 749

Query: 424 VTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTF 462
           V+ +QR   K +   L Y  G     K      L+   F
Sbjct: 750 VSPEQRRYAKTINFGLIYGMGQYGLAKSLGIDNLSAKNF 788


>gi|212637750|ref|YP_002314275.1| DNA polymerase A [Shewanella piezotolerans WP3]
 gi|212559234|gb|ACJ31688.1| DNA polymerase A [Shewanella piezotolerans WP3]
          Length = 916

 Score = 59.7 bits (143), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 32/85 (37%), Positives = 50/85 (58%), Gaps = 2/85 (2%)

Query: 364 VRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQ 423
           +R   IA EG+K++ AD + IE R++A ++ ++  L AF  G+D++  T A  F+V  ++
Sbjct: 676 IRHAFIAPEGRKILAADYSQIELRIMAHLSQDKGLLTAFAEGKDIHKATAAEVFDVDFSE 735

Query: 424 VTKDQRAIGKVMELALGYQGGAKAF 448
           VT DQR   K +   L Y  G  AF
Sbjct: 736 VTSDQRRRAKAVNFGLIY--GMSAF 758


>gi|188581651|ref|YP_001925096.1| DNA polymerase I [Methylobacterium populi BJ001]
 gi|179345149|gb|ACB80561.1| DNA polymerase I [Methylobacterium populi BJ001]
          Length = 1047

 Score = 59.7 bits (143), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 84/307 (27%), Positives = 125/307 (40%), Gaps = 78/307 (25%)

Query: 364  VRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQ 423
            +R   +A EGKKL+ AD + IE R+LA +A      +AFE G D++  T +  F V   Q
Sbjct: 804  IRRAFVAPEGKKLISADYSQIELRLLAHIADIPQLREAFEQGLDIHAATASAMFGVPLDQ 863

Query: 424  VTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVKTNSAPEEWEDAENFCR 483
            +T D R   K +   + Y  G  AF  +A   G+                  E+A  F +
Sbjct: 864  MTGDLRRRAKTINFGIIY--GISAF-GLADRLGIG----------------REEASAFIK 904

Query: 484  WMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELHQAFEQTIENGKAIIARKR 543
               E  P   I D +I T     K++ R+K   V+ L+  +                   
Sbjct: 905  QYFERFP--GIRD-YIDT----TKRSCREK-GYVTTLFGRVCH----------------- 939

Query: 544  RDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNNRSYLNTTTRQLTREYTYGGKLTENIVQ 603
                  Y +   NN     PS R+ V       R  +N   +         G   + I +
Sbjct: 940  ------YPQIRSNN-----PSERASV------ERQAINAPIQ---------GTAADIIRR 973

Query: 604  AVSRDILAEGMMNATKAGYDIVLTVHDEIVCETPDTDEFNASM--LYHLMTSNPSWAKGL 661
            A++R    E  + A K    ++L VHDE+V E PD DE  A++  + H+M   P+ A  L
Sbjct: 974  AMTR---MEDALGAEKLAARMLLQVHDELVFEVPD-DEVEATIPVIAHVMEEAPAPALSL 1029

Query: 662  --PLKAE 666
              PL  E
Sbjct: 1030 SVPLVVE 1036


>gi|126663071|ref|ZP_01734069.1| DNA polymerase I [Flavobacteria bacterium BAL38]
 gi|126624729|gb|EAZ95419.1| DNA polymerase I [Flavobacteria bacterium BAL38]
          Length = 950

 Score = 59.7 bits (143), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 36/106 (33%), Positives = 61/106 (57%), Gaps = 4/106 (3%)

Query: 363 CVRSCVIA-SEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAP 421
            +R   IA  E   L+ AD + IE R++A + GE+  +KAF+  ED++ +T A+ FN+  
Sbjct: 709 LIRKAFIARDENYTLLSADYSQIELRIIAALCGEENMIKAFQNHEDIHKSTAAKVFNIPL 768

Query: 422 AQVTKDQRAIGKVMELALGYQGGAKAFQKMASTTGLNLNTFAHLVK 467
            +VTK+QR+  K +   + Y  G  AF  +++ T L+    A L++
Sbjct: 769 DEVTKEQRSHAKTVNFGIIY--GVSAF-GLSNQTNLSRKESAELIE 811


>gi|225013103|ref|ZP_03703517.1| DNA polymerase I [Flavobacteria bacterium MS024-2A]
 gi|225002761|gb|EEG40743.1| DNA polymerase I [Flavobacteria bacterium MS024-2A]
          Length = 940

 Score = 59.3 bits (142), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 44/152 (28%), Positives = 75/152 (49%), Gaps = 11/152 (7%)

Query: 324 FPPQNLPRPSRSHEELDQIITHLPTSITSDPDPLQII------SDCVRSCVIA-SEGKKL 376
            P +  P+  R H   +Q +       +++P+ LQ I         VR   I   E   L
Sbjct: 655 LPNEINPKTGRVHTIYNQAVAATGRLSSNNPN-LQNIPIRTERGQQVRKAFIPRDENHVL 713

Query: 377 VVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVME 436
           + AD + IE R++A ++G++  L AF+  ED++  T ++ FNV   +VT++QR   K + 
Sbjct: 714 MAADYSQIELRIIAALSGDEGMLSAFQNNEDIHSATASKVFNVPLEEVTREQRGNAKTVN 773

Query: 437 LALGYQGGAKAFQKMASTTGLNLNTFAHLVKT 468
             + Y  G  AF  ++  T LN +    L++T
Sbjct: 774 FGIIY--GVSAF-GLSQQTNLNRSEAKELIET 802


>gi|297242718|ref|ZP_06926656.1| family A DNA-dependent DNA polymerase, putative [Gardnerella
          vaginalis AMD]
 gi|296888929|gb|EFH27663.1| family A DNA-dependent DNA polymerase, putative [Gardnerella
          vaginalis AMD]
          Length = 96

 Score = 59.3 bits (142), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 32/82 (39%), Positives = 46/82 (56%), Gaps = 2/82 (2%)

Query: 1  MATLFIDFETRSPIDLTKCGICKYAE--DVCVILFAFGFDDHPVELWDCVHDPVMPQVLK 58
          M  L +D ET S ++L KCG+ KYAE  D  ++LF +  D   V++ D      +P+V+ 
Sbjct: 1  MENLSVDLETFSSVNLGKCGVYKYAESDDFEILLFGYSVDGSEVQVVDLAQGETIPEVVL 60

Query: 59 EALENTDVTIVAHNSYFERTVL 80
           AL +  VT  A N+ FER  L
Sbjct: 61 SALTDETVTKWAFNAQFERVCL 82


>gi|307243137|ref|ZP_07525311.1| DNA-directed DNA polymerase [Peptostreptococcus stomatis DSM 17678]
 gi|306493497|gb|EFM65476.1| DNA-directed DNA polymerase [Peptostreptococcus stomatis DSM 17678]
          Length = 880

 Score = 59.3 bits (142), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 59/116 (50%), Gaps = 5/116 (4%)

Query: 331 RPSRSHEELDQIITHLPTSITSDPDPLQI-----ISDCVRSCVIASEGKKLVVADLAGIE 385
           +  R H   +Q IT      ++DP+   I     +   +R   IA +   LV AD + +E
Sbjct: 603 KDGRIHSSFNQTITTTGRISSTDPNMQNIPVRTDMGRQIRKVFIAGDSMSLVDADYSQVE 662

Query: 386 ARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGY 441
            RVLA M+ +   ++AF +GED++  T ++ FNV   QVT + R+  K +   + Y
Sbjct: 663 LRVLAHMSQDPHMIEAFNSGEDIHRKTASQVFNVDFNQVTPELRSAAKAVNFGIIY 718


>gi|256825133|ref|YP_003149093.1| DNA polymerase I [Kytococcus sedentarius DSM 20547]
 gi|256688526|gb|ACV06328.1| DNA polymerase I [Kytococcus sedentarius DSM 20547]
          Length = 904

 Score = 59.3 bits (142), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 43/151 (28%), Positives = 72/151 (47%), Gaps = 25/151 (16%)

Query: 291 LNTLVEAMNSDGRLRGTLQFLGASRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSI 350
           +  L +A+++DGR+  T Q   A+ TGR S      QN+P  + +   + ++        
Sbjct: 616 VQGLQKAVDADGRIHTTYQQTIAA-TGRLSSVDPNLQNIPIRTEAGRRIREVF------- 667

Query: 351 TSDPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYV 410
                            V+ S    L+ AD + IE R++A ++G++  ++AF  GEDL+ 
Sbjct: 668 -----------------VVGSGFDHLMSADYSQIEMRIMAHLSGDEGLIEAFRAGEDLHR 710

Query: 411 TTYARSFNVAPAQVTKDQRAIGKVMELALGY 441
              ++ F VAP +VT + RA  K M   L Y
Sbjct: 711 YVGSKVFQVAPEEVTAEMRAKVKAMSYGLAY 741


>gi|302344141|ref|YP_003808670.1| DNA polymerase I [Desulfarculus baarsii DSM 2075]
 gi|301640754|gb|ADK86076.1| DNA polymerase I [Desulfarculus baarsii DSM 2075]
          Length = 890

 Score = 59.3 bits (142), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 41/134 (30%), Positives = 66/134 (49%), Gaps = 8/134 (5%)

Query: 330 PRPSRSHEELDQIITHLPTSITSDPDPLQI-----ISDCVRSCVIASEGKKLVVADLAGI 384
           P   R H   +Q +T      +SDP+   I     +   +R C + + G+ LV AD + I
Sbjct: 612 PDTGRVHTSFNQCVTATGRLSSSDPNLQNIPVRGELGRRMRGCFVPAPGRLLVSADYSQI 671

Query: 385 EARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELALGYQGG 444
           E RVLA ++ +   L+    G D++  T AR F+V P  VT++ R   K +   + Y  G
Sbjct: 672 ELRVLAHLSQDPLMLQDMAEGLDVHTQTAARIFDVMPGLVTREMRVRAKTVNFGVLY--G 729

Query: 445 AKAFQKMASTTGLN 458
             AF ++A   G++
Sbjct: 730 MSAF-RLAREQGVS 742


>gi|58257968|gb|AAW69379.1| DNA polymerase I [Hydrogenobacter hydrogenophilus]
          Length = 169

 Score = 59.3 bits (142), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 35/108 (32%), Positives = 60/108 (55%), Gaps = 1/108 (0%)

Query: 353 DPDPLQIISDCVRSCVIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYVTT 412
           DP+ LQ I   +RS   A EGK LV++D + IE R+ +   G++  ++AF+ G DL+  T
Sbjct: 1   DPN-LQNIPRELRSVFKAREGKILVISDFSQIELRIASEYVGDEKMIRAFKEGRDLHRYT 59

Query: 413 YARSFNVAPAQV