PSIBLAST alignment of GI: 254781193 and protein with PDB id: 1zyq

>gi|83753886|pdb|1ZYQ|A Chain A, T7 Dna Polymerase In Complex With 8og And Incoming Ddatp Length = 698
 Score = 85.9 bits (211), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 78/691 (11%), Positives = 159/691 (23%), Gaps = 135/691 (19%)

Query: 67  TIVAHNS-YFERTVLKACFN------LDIPIHRWICTLVLARSNG--------------- 104
            IV HN   ++   L             +P    I TLVL+R                  
Sbjct: 55  LIVFHNGHKYDVPALTKLAKLQLNREFHLPRENCIDTLVLSRLIHSNLKDTDMGLLRSGK 114

Query: 105 LPSALKAVGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPNHREAWRLFGEYCKGD 164
           LP AL+A G  L     + ++  + +      E  + +   N            +Y   D
Sbjct: 115 LPGALEAWGYRLGEMKGEYKDDFKRMLEEQGEEYVDGMEWWNFN------EEMMDYNVQD 168

Query: 165 VTVTREI-------------------------FKRLEPLSSKEQELWYLDQTINDRGYCV 199
           V VT+ +                         +         E    +L       G+  
Sbjct: 169 VVVTKALLEKLLSDKHYFPPEIDFTDVGYTTFWSESLEAVDIEHRAAWLLAKQERNGFPF 228

Query: 200 DVALAHTLNQIVDVERTKLDQELESLTYGLVSSSRCLEKLKTWLFLETGLHLED----LT 255
           D      L   +   R++L ++L              E         TG  L       T
Sbjct: 229 DTKAIEELYVELAARRSELLRKLTETFGSWYQPKGGTEMF---CHPRTGKPLPKYPRIKT 285

Query: 256 ETTC---QRVLSSNKKLTPQAIQVFNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLG 312
                  ++  +  ++   +  +  + R   + +    +  +V   +S   ++  LQ  G
Sbjct: 286 PKVGGIFKKPKNKAQREGREPCE-LDTREYVAGAPYTPVEHVVFNPSSRDHIQKKLQEAG 344

Query: 313 A-----SRTGRWSGCVFPPQNLPRPSRSHEELDQIITHLPTSITSDPDPLQIISDCVRSC 367
                 +  G         + +       +    +I              +     +R  
Sbjct: 345 WVPTKYTDKGAPVVDDEVLEGVRVDDPEKQAAIDLIKEYLMIQKRIGQSAEGDKAWLR-- 402

Query: 368 VIASEGKKLVVADLAGIEARVLAWMAGEQWKLKAFETGEDLYV-------TTYARSFNVA 420
            +A +GK     +  G              ++    +                       
Sbjct: 403 YVAEDGKIHGSVNPNGAVTGRATHAFPNLAQIPGVRSPYGEQCRAAFGAEHHLDGITGKP 462

Query: 421 PAQVTKDQRAIGKVMEL-ALGYQGGAKAFQKMASTTGLNLNTFAHLVKTNSAPEEWEDAE 479
             Q   D       +EL  L +        + A           + +       +     
Sbjct: 463 WVQAGID----ASGLELRCLAHFMARFDNGEYAHEILNGDIHTKNQIAAELPTRDNAKTF 518

Query: 480 NFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELHQAFEQTIENGKAII 539
            +                      + +KK + +    ++ L   + Q   ++ +      
Sbjct: 519 IYGFLYGAGDEAIGQIVGAGKERGKELKKKFLENTPAIAALRESIQQTLVESSQWVAGEQ 578

Query: 540 ARKRRDVPLVYMKKDKNNLILMLPSGRSLVYRDVGNNRSYLNTTTRQLTREYTYGGKLTE 599
             K +               +    GR +  R                            
Sbjct: 579 QVKWKRR------------WIKGLDGRKVHVRSPHA---------------------ALN 605

Query: 600 NIVQAVSRDILAEGMMN----ATKAGYDI--------VLTVHDEIVCETPDTDEFNASML 647
            ++Q+    I    ++       + G           +  VHDEI       +      +
Sbjct: 606 TLLQSAGALICKLWIIKTEEMLVEKGLKHGWDGDFAYMAWVHDEIQVGCRTEEIAQV--V 663

Query: 648 YHLMTSNPSWAKG-----LPLKAEGYESKRY 673
                    W          L  EG     +
Sbjct: 664 IETAQEAMRWVGDHWNFRCLLDTEGKMGPNW 694