PSIBLAST alignment of GI: 254781193 and protein with PDB id: 3hpo

>gi|299688943|pdb|3HPO|A Chain A, Crystal Structure Of Fragment Dna Polymerase I From Bacillus Stearothermophilus Y714s Mutant Bound To G:t Mismatch Length = 580
 Score =  304 bits (778), Expect = 4e-80,   Method: Composition-based stats.
 Identities = 86/661 (13%), Positives = 178/661 (26%), Gaps = 141/661 (21%)

Query: 33  FAFGFDDHPVELWDCVHDPVMPQVLKEALENTDVTIVAHNSYFE---RTVLKACFNLDIP 89
                 +     +      +        L +         S F+     V      +++ 
Sbjct: 37  VGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKK----SMFDSKRAAVALKWKGIELX 92

Query: 90  IHRWICTLVLARSNGLPSALKAVGEALKLSSQKMEEGKELIARFCKGETHECLYDRNKPN 149
              +   L+ A        +  V  A      KM++ + +               R  P+
Sbjct: 93  GVSFD-LLLAAYLLDPAQGVDDVAAA-----AKMKQYEAVRPDEAVYGKGA---KRAVPD 143

Query: 150 HREAWRLFGEYCKGDVTVTR----EIFKRLEPLS--SKEQELWYLDQTINDRGYCVDVAL 203
                            + R    E+ +  +       EQ L  +   +   G  VD   
Sbjct: 144 EPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKR 203

Query: 204 AHTLNQIVDVERTKLDQELESLTYGLVSSSRCLEKLKTWLFLETGLHLEDLTE---TTCQ 260
              + + +  +   ++Q +  L      +    ++L   LF +  L +   T+   +T  
Sbjct: 204 LEQMGKELAEQLGTVEQRIYELAGQ-EFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSA 262

Query: 261 RVLSSNKKLTPQAIQVFNNRMRASRSAVLKLNTLVEAMNSDGRLRGTLQFLGASRTGRWS 320
            VL            + + R    +     +  L++ +  D +   T+     ++TGR S
Sbjct: 263 DVLEKLAPYHEIVENILHYRQ-LGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLS 321

Query: 321 GCVFPPQNLPRPSRSHEELDQIITHLPTSITSDPDPLQIISDCVRSCVIASE-GKKLVVA 379
                 QN+P       +                         +R   + SE    +  A
Sbjct: 322 STEPNLQNIPIRLEEGRK-------------------------IRQAFVPSESDWLIFAA 356

Query: 380 DLAGIEARVLAWMAGEQWKLKAFETGEDLYVTTYARSFNVAPAQVTKDQRAIGKVMELAL 439
           D + IE RVLA +A +   ++AF    D++  T    F V+  +VT + R   K +    
Sbjct: 357 DYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVN--- 413

Query: 440 GYQGGAKAFQKMASTTGLNLNTFAHLVKTNSAPEEWEDAENFCRWMQENHPEHAIEDLFI 499
                          +G++    A                                    
Sbjct: 414 -----------FGIVSGISDYGLAQ------------------------------NLNIS 432

Query: 500 GTACERVKKAWRQKHSRVSELWNELHQAFEQTIENGKAIIARKRRDVPLVYMKKDKNNLI 559
                   + + +    V           ++  + G                        
Sbjct: 433 RKEAAEFIERYFESFPGVKRYM---ENIVQEAKQKGYVTTLLH----------------- 472

Query: 560 LMLPSGRSLVYRDVGNNRSYLNTTTRQLTREYTYGGKLTENIVQAVSRDILAEGMMNA-- 617
                 R     D+ +             R            +Q  + DI+ + M++   
Sbjct: 473 ------RRRYLPDITSRNF---NVRSFAERMAMNTP------IQGSAADIIKKAMIDLNA 517

Query: 618 ----TKAGYDIVLTVHDEIVCETPDTDEFNASMLY-HLMTSNPSWAKGLPLKAEGYESKR 672
                +    ++L VHDE++ E P  +      L   +M    +    +PLK + +    
Sbjct: 518 RLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVT--LRVPLKVDYHYGST 575

Query: 673 Y 673
           +
Sbjct: 576 W 576