>TIGR01846 type_I_sec_HlyB type I secretion system ATPase; InterPro: IPR010132 Type I protein secretion is a system in some Gram-negative bacteria to export proteins (often proteases) across both inner and outer membranes to the extracellular medium. This entry contains one of three proteins of the type I secretion apparatus. Targeted proteins are not cleaved at the N terminus, but rather carry signals located toward the extreme C terminus to direct type I secretion.; GO: 0005524 ATP binding, 0008565 protein transporter activity, 0015031 protein transport, 0016021 integral to membrane.

Probab=97.66 E-value=5.7e-05 Score=49.64 Aligned_cols=47 Identities=15% Similarity=0.286 Sum_probs=33.6 Q ss_pred CCEEEEECCCCCCHHHHHHHHHHH--CCCEEEEEEECCCCCCCCCCCCCCCCCCCHHHHHH Q ss_conf 718999889999989999999851--89817998611888999832355300012354211 Q gi|254781197|r 2 AHIFVLIGASGVGETTIAKQVVLN--SEYLVMPVGVTTRRPRVDEKQYIDYRFISQSQFKG 60 (185) Q Consensus 2 ~kiivi~GpSGsGK~tl~~~L~~~--~~~~~~~is~TTR~~R~~E~~g~dY~Fvs~e~F~~ 60 (185) T Consensus 491 Ge~IGIvGpSGSGKSTLTK-L~QRLYtP~~GqVL-----------VDG~DLA~~DP~wLRR 539 (703) T TIGR01846 491 GEVIGIVGPSGSGKSTLTK-LLQRLYTPEHGQVL-----------VDGVDLAIADPAWLRR 539 (703) T ss_pred CEEEEEECCCCCCHHHHHH-HHHHHCCCCCCEEE-----------ECCCCCCCCCCCHHHH T ss_conf 6579987278986789999-98861488887477-----------7030001018520102

HHsearch alignment for GI: 254781197 and conserved domain: TIGR01846