>cd01895 EngA2 EngA2 subfamily. This CD represents the second GTPase domain of EngA and its orthologs, which are composed of two adjacent GTPase domains. Since the sequences of the two domains are more similar to each other than to other GTPases, it is likely that an ancient gene duplication, rather than a fusion of evolutionarily distinct GTPases, gave rise to this family. Although the exact function of these proteins has not been elucidated, studies have revealed that the E. coli EngA homolog, Der, and Neisseria gonorrhoeae EngA are essential for cell viability. A recent report suggests that E. coli Der functions in ribosome assembly and stability.

Probab=97.30 E-value=0.00013 Score=47.63 Aligned_cols=51 Identities=20% Similarity=0.292 Sum_probs=35.9 Q ss_pred EEEECCCCCCHHHHHHHHHHHCCCEEEEEEECCCCCCCCCCC--CCCCCCCCH Q ss_conf 999889999989999999851898179986118889998323--553000123 Q gi|254781197|r 5 FVLIGASGVGETTIAKQVVLNSEYLVMPVGVTTRRPRVDEKQ--YIDYRFISQ 55 (185) Q Consensus 5 ivi~GpSGsGK~tl~~~L~~~~~~~~~~is~TTR~~R~~E~~--g~dY~Fvs~ 55 (185) T Consensus 5 V~ivG~pN~GKSTL~N~l~g~~~~~vs~~pgtTr~~~~~~~~~~~~~~~~vDt 57 (174) T cd01895 5 IAIIGRPNVGKSSLVNALLGEERVIVSDIAGTTRDSIDVPFEYDGKKYTLIDT 57 (174) T ss_pred EEEECCCCCCHHHHHHHHHCCCCEEECCCCCCEEECCEEEEEECCEEEEEEEC T ss_conf 99998999989999999838984443499991573328999999988999857

HHsearch alignment for GI: 254781197 and conserved domain: cd01895