RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254781198|ref|YP_003065611.1| guanylate kinase [Candidatus Liberibacter asiaticus str. psy62] (117 letters) >3k89_A Malonyl COA-ACP transacylase; bacterial blight, XOO0880, FABD, xanthomonas oryzae PV. oryzae KACC10331; 1.60A {Xanthomonas oryzae PV} PDB: 3een_A (A:1-129,A:203-314) Length = 241 Score = 24.7 bits (53), Expect = 4.3 Identities = 9/47 (19%), Positives = 17/47 (36%), Gaps = 2/47 (4%) Query: 41 RLSDKVEASHTKLMEAILDN-REDIANVRIEVANVRIEVANVRTEML 86 + +HT LM + E +A + + + V NV + Sbjct: 121 QFMQAAAPAHTPLMRDAANQLGEAMAGLSWHAPQIPV-VQNVDARVH 166 >1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} (A:94-246) Length = 153 Score = 24.5 bits (53), Expect = 5.5 Identities = 11/47 (23%), Positives = 21/47 (44%), Gaps = 1/47 (2%) Query: 6 RRSVMDTNHKGSNLPPEEIKNIQDHRITLLEKNYERLSDKVEASHTK 52 R MD NH + P Q R + + ++ +++ A+HT+ Sbjct: 48 RNMTMDPNHVPGSEPNFAAYRTQSRRGPIAREFFKHFAEEH-AAHTE 93 >1nm2_A Malonyl COA:acyl carrier protein malonyltransferase; alpha/beta hydrolase-like core; 2.00A {Streptomyces coelicolor A3} (A:1-134,A:202-317) Length = 250 Score = 24.3 bits (52), Expect = 6.5 Identities = 8/46 (17%), Positives = 17/46 (36%), Gaps = 2/46 (4%) Query: 42 LSDKVEASHTKLMEAILDN-REDIANVRIEVANVRIEVANVRTEML 86 +++ +HT+ M +D E + V V+N + Sbjct: 127 MAEAAAVTHTRHMAPAVDKLAEAAKALTPADPKVTY-VSNKDGRAV 171 >1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} (A:1-73,A:153-290) Length = 211 Score = 24.1 bits (52), Expect = 7.0 Identities = 4/55 (7%), Positives = 16/55 (29%) Query: 14 HKGSNLPPEEIKNIQDHRITLLEKNYERLSDKVEASHTKLMEAILDNREDIANVR 68 G + E++ D + + + +D+ ++ + + Sbjct: 152 KVGKGMTDEQVHAFVDRYMPSYKLYLNDFVRSESLGSIATLTLGIDSNRNVYSTK 206 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.320 0.134 0.375 Gapped Lambda K H 0.267 0.0523 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 838,502 Number of extensions: 33368 Number of successful extensions: 125 Number of sequences better than 10.0: 1 Number of HSP's gapped: 121 Number of HSP's successfully gapped: 17 Length of query: 117 Length of database: 4,956,049 Length adjustment: 70 Effective length of query: 47 Effective length of database: 2,589,699 Effective search space: 121715853 Effective search space used: 121715853 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.5 bits)