BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254781198|ref|YP_003065611.1| guanylate kinase [Candidatus Liberibacter asiaticus str. psy62] (117 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254781198|ref|YP_003065611.1| guanylate kinase [Candidatus Liberibacter asiaticus str. psy62] Length = 117 Score = 238 bits (608), Expect = 2e-65, Method: Compositional matrix adjust. Identities = 117/117 (100%), Positives = 117/117 (100%) Query: 1 MNSMERRSVMDTNHKGSNLPPEEIKNIQDHRITLLEKNYERLSDKVEASHTKLMEAILDN 60 MNSMERRSVMDTNHKGSNLPPEEIKNIQDHRITLLEKNYERLSDKVEASHTKLMEAILDN Sbjct: 1 MNSMERRSVMDTNHKGSNLPPEEIKNIQDHRITLLEKNYERLSDKVEASHTKLMEAILDN 60 Query: 61 REDIANVRIEVANVRIEVANVRTEMLGLIWKIPATAIGISICLRFLANVMDKGIHLF 117 REDIANVRIEVANVRIEVANVRTEMLGLIWKIPATAIGISICLRFLANVMDKGIHLF Sbjct: 61 REDIANVRIEVANVRIEVANVRTEMLGLIWKIPATAIGISICLRFLANVMDKGIHLF 117 >gi|254780339|ref|YP_003064752.1| hypothetical protein CLIBASIA_01120 [Candidatus Liberibacter asiaticus str. psy62] Length = 88 Score = 34.7 bits (78), Expect = 5e-04, Method: Compositional matrix adjust. Identities = 18/50 (36%), Positives = 32/50 (64%), Gaps = 3/50 (6%) Query: 51 TKLMEAILDNREDIANVRIEVANVRIEVANVRTEMLGLIWKIPATAIGIS 100 + L EAI +NR +IAN+R +++ ++ +++E+ + WKI T IG S Sbjct: 8 SNLKEAITNNRVEIANIRADMSGTSMK---IQSEINNMSWKILTTMIGCS 54 >gi|254781224|ref|YP_003065637.1| hypothetical protein CLIBASIA_05655 [Candidatus Liberibacter asiaticus str. psy62] Length = 103 Score = 29.6 bits (65), Expect = 0.017, Method: Compositional matrix adjust. Identities = 25/84 (29%), Positives = 41/84 (48%), Gaps = 20/84 (23%) Query: 31 RITLLEKNYERLSDKVEASHTKLMEAILDNREDIANVRIE----VANVRIEVANVRTEM- 85 R T LE L+ K + L + + ++DIANVR E +A+VR E+A ++E+ Sbjct: 18 RFTKLETALPYLATKAD-----LADVRTELKQDIANVRTELKADIADVRTELACTKSELK 72 Query: 86 ----------LGLIWKIPATAIGI 99 +G+I + + IGI Sbjct: 73 DAINSQTKWFMGIIVSVLVSTIGI 96 >537021.9.peg.472_1 Length = 369 Score = 22.7 bits (47), Expect = 2.1, Method: Compositional matrix adjust. Identities = 10/28 (35%), Positives = 18/28 (64%) Query: 32 ITLLEKNYERLSDKVEASHTKLMEAILD 59 ++LL++ R +DK+ S +LM A+ D Sbjct: 205 LSLLDQAIARCNDKIVTSSVRLMLALAD 232 >gi|254780316|ref|YP_003064729.1| phenylalanyl-tRNA synthetase subunit beta [Candidatus Liberibacter asiaticus str. psy62] Length = 805 Score = 21.2 bits (43), Expect = 6.5, Method: Compositional matrix adjust. Identities = 11/28 (39%), Positives = 15/28 (53%) Query: 41 RLSDKVEASHTKLMEAILDNREDIANVR 68 RLSD +E S + ++ NR D VR Sbjct: 145 RLSDYLELSDPIIDVSLTPNRSDCIGVR 172 >gi|255764494|ref|YP_003065050.2| molecular chaperone DnaK [Candidatus Liberibacter asiaticus str. psy62] Length = 652 Score = 20.4 bits (41), Expect = 10.0, Method: Composition-based stats. Identities = 10/52 (19%), Positives = 27/52 (51%) Query: 5 ERRSVMDTNHKGSNLPPEEIKNIQDHRITLLEKNYERLSDKVEASHTKLMEA 56 +RR ++T + +L +++++H + E + + + ++A T L +A Sbjct: 523 KRREAVETKNHAESLIYSTEQSLREHGDKIAEAEQKSIRESIDALRTLLNDA 574 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.320 0.134 0.375 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 70,623 Number of Sequences: 1233 Number of extensions: 2515 Number of successful extensions: 20 Number of sequences better than 100.0: 14 Number of HSP's better than 100.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of query: 117 length of database: 328,796 effective HSP length: 63 effective length of query: 54 effective length of database: 251,117 effective search space: 13560318 effective search space used: 13560318 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 33 (17.3 bits)