BLAST/PSIBLAST alignment of GI: 254781199 and GI: 315122770 at iteration 1
>gi|315122770|ref|YP_004063259.1| hypothetical protein CKC_05125 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 124
>gi|313496172|gb|ADR52771.1| hypothetical protein CKC_05125 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 124
 Score =  185 bits (469), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 90/122 (73%), Positives = 105/122 (86%)

Query: 1   MIQSFLAGGLFRFLLRFIPSGFERIVDVVSEYLTKKQSIEYDKLKLEMAKNDSSTQLDLA 60
           MIQSFL G +FRF LRFIPS FE+I D V EYL +KQSIEYDK+KLE+A+ +SSTQLDLA
Sbjct: 1   MIQSFLVGEVFRFALRFIPSVFEKIADGVLEYLMQKQSIEYDKMKLELARINSSTQLDLA 60

Query: 61  EIKAGIEELKIDKPIRLARIEAQKVKSGVKWVDGFTALIRPLTTFFWIIVYPLLVWWSVK 120
           +IK  IEELK D+ IRLARI+AQKVKSG++W+DGF A +RPLT+ FWIIVYPLLVWWSVK
Sbjct: 61  DIKLEIEELKADQLIRLARIKAQKVKSGIQWIDGFNAFVRPLTSLFWIIVYPLLVWWSVK 120

Query: 121 EG 122
            G
Sbjct: 121 GG 122