RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254781199|ref|YP_003065612.1| hypothetical protein CLIBASIA_05530 [Candidatus Liberibacter asiaticus str. psy62] (157 letters) >gnl|CDD|148704 pfam07253, Gypsy, Gypsy protein. This family consists of several Gypsy/Env proteins from Drosophila and Ceratitis fruit fly species. Gypsy is an endogenous retrovirus of Drosophila melanogaster. Phylogenetic studies suggest that occasional horizontal transfer events of gypsy occur between Drosophila species. gypsy possesses infective properties associated with the products of the envelope gene that might be at the origin of these interspecies transfers. Length = 472 Score = 31.4 bits (71), Expect = 0.12 Identities = 23/80 (28%), Positives = 40/80 (50%), Gaps = 14/80 (17%) Query: 36 KQSIEYDKLKLEMAKND--SSTQLDLAEIKAGIEELKIDKPIRLARIEAQKVKSGVKWVD 93 K+ I+ KL + +AK + + T LD A++++ +EE K + PI +EA K+K Sbjct: 167 KEEIQNLKLTITLAKLNIVNPTILDHADLESLVEENKENTPIVEL-LEAAKIK------- 218 Query: 94 GFTALIRPLTTFFWIIVYPL 113 +++ II YP Sbjct: 219 ----VLQSENIIHIIIKYPK 234 >gnl|CDD|162705 TIGR02103, pullul_strch, alpha-1,6-glucosidases, pullulanase-type. Members of this protein family include secreted (or membrane-anchored) pullulanases of Gram-negative bacteria and pullulanase-type starch debranching enzymes of plants. Both enzymes hydrolyze alpha-1,6 glycosidic linkages. Pullulan is an unusual, industrially important polysaccharide in which short alpha-1,4 chains (maltotriose) are connected in alpha-1,6 linkages. Enzymes that cleave alpha-1,6 linkages in pullulan and release maltotriose are called pullulanases although pullulan itself may not be the natural substrate. This family is closely homologous to, but architecturally different from, the Gram-positive pullulanases of Gram-positive bacteria (TIGR02102). Length = 898 Score = 30.6 bits (69), Expect = 0.19 Identities = 20/100 (20%), Positives = 35/100 (35%), Gaps = 16/100 (16%) Query: 29 VSEYLTKKQSIEYDKLKLEMAKNDSSTQLDLAEIKAGIEELKIDKPIRLARIEAQKVKSG 88 V+E K I+ KL DS + +G + + D E Q + + Sbjct: 314 VNEEKEKVADIQQPFSKLCELNPDSKSSEFAGYCDSGSQLKQNDSK---DNPEVQALNTL 370 Query: 89 VKWVDGFTALIRPLTTFFWIIVYPLLVWWSVKEGMFNSDP 128 V+ +D + P ++V EG + +DP Sbjct: 371 VRNLDSYNWGYDP-------------FHYTVPEGSYATDP 397 >gnl|CDD|185380 PRK15483, PRK15483, type III restriction-modification system StyLTI enzyme res; Provisional. Length = 986 Score = 29.2 bits (66), Expect = 0.46 Identities = 15/56 (26%), Positives = 23/56 (41%), Gaps = 5/56 (8%) Query: 18 IPSGFERIVDVVSEYLTKKQSIEYDKLKLEMAKNDSSTQLDLAEIKAGIEELKIDK 73 +P V +V KK + K E+A + +LA+I G E L I+ Sbjct: 283 MPEEQANNVKIVDSVTAKKLILRRGKKTFELAVGE-----NLADIDPGFEGLTIEY 333 >gnl|CDD|185669 PTZ00491, PTZ00491, major vault protein; Provisional. Length = 850 Score = 28.1 bits (63), Expect = 0.96 Identities = 18/53 (33%), Positives = 25/53 (47%), Gaps = 4/53 (7%) Query: 34 TKKQSIEYDKLKLEMAKNDSSTQLDLAEIKAGIEELKIDKPIRLARIEAQKVK 86 K IE + LE + +L+L +A EL+I K LA IEA K + Sbjct: 743 AKALRIEAEAE-LEKLRKRQ--ELELEYEQA-QNELEIAKAKELADIEATKFE 791 >gnl|CDD|163538 TIGR03826, YvyF, flagellar operon protein TIGR03826. This gene is found in flagellar operons of Bacillus-related organisms. Its function has not been determined and an official gene symbol has not been assigned, although the gene is designated yvyF in B. subtilus. A tentative assignment as a regulator is suggested in the NCBI record GI:16080597. Length = 137 Score = 27.7 bits (62), Expect = 1.3 Identities = 15/60 (25%), Positives = 26/60 (43%), Gaps = 14/60 (23%) Query: 23 ERIVDVVSEYLTKKQSIEYDKLKLEMAKNDSSTQLDLAEIKAGIEELKIDKPIRLARIEA 82 ER + V ++L K + N +T ++ E + G+ E I K IR R++ Sbjct: 29 EREFEKVYKFLRKHE-------------NRQATVSEIVE-ETGVSEKLILKFIREGRLQL 74 >gnl|CDD|180570 PRK06457, PRK06457, pyruvate dehydrogenase; Provisional. Length = 549 Score = 27.5 bits (61), Expect = 1.8 Identities = 22/75 (29%), Positives = 30/75 (40%), Gaps = 9/75 (12%) Query: 19 PSGFERIVDV-------VSEYLTKKQSIEYDKLKLEMAKNDSSTQLDLAEIKAGIEELKI 71 S + +DV V+E+L + DK E+ K LD K K Sbjct: 289 NSNIGKRLDVDLSYPIPVAEFLNIDIEEKSDKFYEEL-KGKKEDWLDSIS-KQENSLDKP 346 Query: 72 DKPIRLARIEAQKVK 86 KP R+A I +QK K Sbjct: 347 MKPQRVAYIVSQKCK 361 >gnl|CDD|183410 PRK12292, hisZ, ATP phosphoribosyltransferase regulatory subunit; Provisional. Length = 391 Score = 26.8 bits (60), Expect = 2.7 Identities = 18/63 (28%), Positives = 32/63 (50%), Gaps = 3/63 (4%) Query: 9 GLFRFLLRFIPSGF-ERIVDVVSEYLTKKQSIEYDKLKLEMAKNDSSTQLDLAEIKAGIE 67 GLFR LL +G E + +V+ L K + ++L L++++ L L ++ G E Sbjct: 164 GLFRALLE--AAGLSEELEEVLRRALANKDYVALEELVLDLSEELRDALLALPRLRGGRE 221 Query: 68 ELK 70 L+ Sbjct: 222 VLE 224 >gnl|CDD|171504 PRK12445, PRK12445, lysyl-tRNA synthetase; Reviewed. Length = 505 Score = 26.2 bits (57), Expect = 3.6 Identities = 14/53 (26%), Positives = 29/53 (54%), Gaps = 4/53 (7%) Query: 13 FLLRFIPSGFERIVDV----VSEYLTKKQSIEYDKLKLEMAKNDSSTQLDLAE 61 +L R + GFER+ ++ +E ++ + + E+ ++L MA D ++L E Sbjct: 243 YLKRLVVGGFERVFEINRNFRNEGISVRHNPEFTMMELYMAYADYHDLIELTE 295 >gnl|CDD|162728 TIGR02146, LysS_fung_arch, homocitrate synthase. This model includes the yeast LYS21 gene which carries out the first step of the alpha-aminoadipate (AAA) lysine biosynthesis pathway. A related pathway is found in Thermus thermophilus. This enzyme is closely related to 2-isopropylmalate synthase (LeuA) and citramalate synthase (CimA), both of which are present in the euryarchaeota. Some archaea have a separate homocitrate synthase (AksA) which also synthesizes longer homocitrate analogs. Length = 344 Score = 26.3 bits (58), Expect = 4.0 Identities = 13/46 (28%), Positives = 22/46 (47%) Query: 19 PSGFERIVDVVSEYLTKKQSIEYDKLKLEMAKNDSSTQLDLAEIKA 64 P F R ++ LT K +I+ K KL + + + A+IK+ Sbjct: 299 PEVFGRKRHILIARLTGKHAIKARKEKLGVKLIEEELKRVTAKIKS 344 >gnl|CDD|180189 PRK05667, dnaG, DNA primase; Validated. Length = 580 Score = 26.0 bits (58), Expect = 4.4 Identities = 9/19 (47%), Positives = 11/19 (57%), Gaps = 1/19 (5%) Query: 24 RIVDVVSEYLT-KKQSIEY 41 IVDV+ EY+ KK Y Sbjct: 17 DIVDVIGEYVKLKKAGRNY 35 >gnl|CDD|173501 PTZ00265, PTZ00265, multidrug resistance protein (mdr1); Provisional. Length = 1466 Score = 25.4 bits (55), Expect = 6.6 Identities = 15/43 (34%), Positives = 25/43 (58%), Gaps = 3/43 (6%) Query: 1 MIQSFLAGGLFRFLLRFIPSGFERIVDVVSEYLTKKQSIEYDK 43 +I S + G+F+F+L FI S +DVV+ + K +E+ K Sbjct: 99 IIFSLVLIGIFQFILSFISS---FCMDVVTTKILKTLKLEFLK 138 >gnl|CDD|172649 PRK14161, PRK14161, heat shock protein GrpE; Provisional. Length = 178 Score = 25.3 bits (55), Expect = 6.7 Identities = 12/38 (31%), Positives = 20/38 (52%), Gaps = 4/38 (10%) Query: 39 IEYDKLKLEMAKNDSSTQLDLAEIKAGIEELKIDKPIR 76 + + E+ + + ++ +KA IEELK DK IR Sbjct: 11 QTINDIAEEIVETANP---EITALKAEIEELK-DKLIR 44 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.324 0.141 0.425 Gapped Lambda K H 0.267 0.0693 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 2,623,530 Number of extensions: 160311 Number of successful extensions: 479 Number of sequences better than 10.0: 1 Number of HSP's gapped: 479 Number of HSP's successfully gapped: 30 Length of query: 157 Length of database: 5,994,473 Length adjustment: 86 Effective length of query: 71 Effective length of database: 4,136,185 Effective search space: 293669135 Effective search space used: 293669135 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 53 (24.3 bits)