BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254781199|ref|YP_003065612.1| hypothetical protein CLIBASIA_05530 [Candidatus Liberibacter asiaticus str. psy62] (157 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254781199|ref|YP_003065612.1| hypothetical protein CLIBASIA_05530 [Candidatus Liberibacter asiaticus str. psy62] Length = 157 Score = 315 bits (807), Expect = 2e-88, Method: Compositional matrix adjust. Identities = 157/157 (100%), Positives = 157/157 (100%) Query: 1 MIQSFLAGGLFRFLLRFIPSGFERIVDVVSEYLTKKQSIEYDKLKLEMAKNDSSTQLDLA 60 MIQSFLAGGLFRFLLRFIPSGFERIVDVVSEYLTKKQSIEYDKLKLEMAKNDSSTQLDLA Sbjct: 1 MIQSFLAGGLFRFLLRFIPSGFERIVDVVSEYLTKKQSIEYDKLKLEMAKNDSSTQLDLA 60 Query: 61 EIKAGIEELKIDKPIRLARIEAQKVKSGVKWVDGFTALIRPLTTFFWIIVYPLLVWWSVK 120 EIKAGIEELKIDKPIRLARIEAQKVKSGVKWVDGFTALIRPLTTFFWIIVYPLLVWWSVK Sbjct: 61 EIKAGIEELKIDKPIRLARIEAQKVKSGVKWVDGFTALIRPLTTFFWIIVYPLLVWWSVK 120 Query: 121 EGMFNSDPLTLLSPFTQEIIACILGFWYTDKIVQKKK 157 EGMFNSDPLTLLSPFTQEIIACILGFWYTDKIVQKKK Sbjct: 121 EGMFNSDPLTLLSPFTQEIIACILGFWYTDKIVQKKK 157 >gi|254780988|ref|YP_003065401.1| hypothetical protein CLIBASIA_04445 [Candidatus Liberibacter asiaticus str. psy62] Length = 151 Score = 160 bits (406), Expect = 7e-42, Method: Compositional matrix adjust. Identities = 79/158 (50%), Positives = 114/158 (72%), Gaps = 15/158 (9%) Query: 4 SFLAGGLFRFLLRFIPSGFERIVDVVSEYLTKKQSIEYDKLKLEMAKNDSSTQLDLAEIK 63 SFL G + RF ++F+PS F +++ EY+ K++SIE+D+L+LE+AK S+TQ+DL ++ Sbjct: 3 SFLTGSIARFFIKFVPSLF----NLLEEYIMKEKSIEHDRLRLEIAKIQSTTQVDLKALE 58 Query: 64 AGIEELKIDKPIRLARIEAQ----KVKSGVKWVDGFTALIRPLTTFFWIIVYPLLVWWSV 119 + + P+RLAR++ Q + + K + F ALIRP TT FWII+YPLL+WW V Sbjct: 59 S-------ETPVRLARLQNQANEDQFERESKAMIFFNALIRPFTTLFWIILYPLLIWWGV 111 Query: 120 KEGMFNSDPLTLLSPFTQEIIACILGFWYTDKIVQKKK 157 ++G DPLTLL+PFTQ+IIACILGFW+TD IVQ++K Sbjct: 112 EKGYLTKDPLTLLAPFTQDIIACILGFWFTDTIVQRRK 149 >gi|254780505|ref|YP_003064918.1| 6-phosphogluconolactonase [Candidatus Liberibacter asiaticus str. psy62] Length = 234 Score = 22.3 bits (46), Expect = 4.4, Method: Compositional matrix adjust. Identities = 10/29 (34%), Positives = 13/29 (44%) Query: 90 KWVDGFTALIRPLTTFFWIIVYPLLVWWS 118 K + G AL P+ W PL V W+ Sbjct: 205 KAISGDDALEMPIRAILWNAQSPLEVHWT 233 >gi|254780546|ref|YP_003064959.1| hypothetical protein CLIBASIA_02165 [Candidatus Liberibacter asiaticus str. psy62] Length = 423 Score = 21.6 bits (44), Expect = 7.1, Method: Compositional matrix adjust. Identities = 14/53 (26%), Positives = 23/53 (43%) Query: 70 KIDKPIRLARIEAQKVKSGVKWVDGFTALIRPLTTFFWIIVYPLLVWWSVKEG 122 K D P + I AQ+ S + +G L+ P + F P+ +S+ G Sbjct: 361 KADVPSGIPPIIAQRALSSMPSKEGGKPLLAPFSRFMTKFDLPVAYAFSISFG 413 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.324 0.141 0.425 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 99,925 Number of Sequences: 1233 Number of extensions: 3791 Number of successful extensions: 22 Number of sequences better than 100.0: 15 Number of HSP's better than 100.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 6 Number of HSP's gapped (non-prelim): 15 length of query: 157 length of database: 328,796 effective HSP length: 67 effective length of query: 90 effective length of database: 246,185 effective search space: 22156650 effective search space used: 22156650 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 35 (18.1 bits)