RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254781203|ref|YP_003065616.1| hypothetical protein CLIBASIA_05550 [Candidatus Liberibacter asiaticus str. psy62] (478 letters) >gnl|CDD|148701 pfam07246, Phlebovirus_NSM, Phlebovirus nonstructural protein NS-M. This family consists of several Phlebovirus nonstructural NS-M proteins which represent the N-terminal region of the M polyprotein precursor. The function of this family is unknown. Length = 264 Score = 30.6 bits (68), Expect = 0.91 Identities = 44/229 (19%), Positives = 73/229 (31%), Gaps = 43/229 (18%) Query: 189 PFGMVERGWSSKVLEDHGYPDMAQHYRIFDMESLITDGLIGAFFGGMHSKQVQNMS-LRL 247 ++ER W + + P H R F K + + + + Sbjct: 38 GPEIIERYWGFESAKHDYMPGFDLHCR----------------FNEGDFKYMTHENAISQ 81 Query: 248 VNDLKEGITERLPYKHGVKSSSPGLHTSFDA-------YEAHTDTLAHGVDSLVRGEYPH 300 + ++ E L + G ++ S GL + D + DT + + P Sbjct: 82 IKEVTTSPDE-LKFSCGDETKSLGLSITNDGLNNMMGPAIIYCDTNDFIRNITTGEQSPR 140 Query: 301 FDQEKLQTIADNTLEDPHFKPHLPEPEPLPQYKEHSDRQKPSEPLAEHPHPKRKEVEREL 360 D EKL+ A+ K E + Q H +QK +E R +++R Sbjct: 141 VDYEKLKKNAEEKDATIQRKTKEMEEDSRNQIAHHEIQQKKNE-----IQKLRNDLKRG- 194 Query: 361 SEIEGAKK---ESSAR---------KFFDEGSPDHSPFKGERNQKLDPM 397 E AK ES AR + DE S + R + D Sbjct: 195 QEHRDAKLRVEESMARVKGLKEELKQLTDELQHAKSEMQSLRKKIKDFE 243 >gnl|CDD|131973 TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase. This model represents an Actinobacterial clade of E2 enzyme, a component of the 2-oxoglutarate dehydrogenase complex involved in the TCA cycle. These proteins have multiple domains including the catalytic domain (pfam00198), one or two biotin domains (pfam00364) and an E3-component binding domain (pfam02817). Length = 590 Score = 29.7 bits (66), Expect = 1.5 Identities = 14/80 (17%), Positives = 27/80 (33%) Query: 324 PEPEPLPQYKEHSDRQKPSEPLAEHPHPKRKEVERELSEIEGAKKESSARKFFDEGSPDH 383 + + + + + E + + E E + E E A+K+ + D Sbjct: 216 AAEDAKAEEEAEAKAEAKPEEKPDPKKDEAAEPEPDEPEAEKAEKKEEKAAAAPAANSDG 275 Query: 384 SPFKGERNQKLDPMRGADFT 403 SP+ +KL G D Sbjct: 276 SPYVTPLVRKLAAEHGIDLN 295 >gnl|CDD|171536 PRK12488, PRK12488, acetate permease; Provisional. Length = 549 Score = 29.0 bits (65), Expect = 2.5 Identities = 23/79 (29%), Positives = 36/79 (45%), Gaps = 5/79 (6%) Query: 69 TDPHSVGTGAHLVEGLTSLAPYIAGAALAGKLLSFIP-----TPLTRLAGLALQSAPLAA 123 T+P G ++ G +A ++A A L FI T L +AGLAL A + Sbjct: 324 TEPSYRDAGGKIIGGGNMVAVHLAQAVGGNLFLGFISAVAFATILAVVAGLALSGASAVS 383 Query: 124 GALYAYLSHKAESSIHHQI 142 LYA + K ++S ++ Sbjct: 384 HDLYACVIRKGQASEAQEM 402 >gnl|CDD|181264 PRK08168, PRK08168, NADH dehydrogenase subunit L; Provisional. Length = 516 Score = 29.3 bits (66), Expect = 2.6 Identities = 17/72 (23%), Positives = 23/72 (31%), Gaps = 2/72 (2%) Query: 65 RGSRTDPHSVGTGAHLVEGLTSLAPYIAGAALAGKLLSFIPTPLTRLAGLALQSAPLAAG 124 S + L GL +A A A LA L + GLA + A Sbjct: 396 WQPCASGASTLS--GLGLGLLLVAGLTALAFLAHLLPLGLADAPGPALGLAALAGMAALY 453 Query: 125 ALYAYLSHKAES 136 L A L + + Sbjct: 454 LLQALLQRRPQH 465 >gnl|CDD|179256 PRK01229, PRK01229, N-glycosylase/DNA lyase; Provisional. Length = 208 Score = 29.1 bits (66), Expect = 2.7 Identities = 16/56 (28%), Positives = 25/56 (44%), Gaps = 11/56 (19%) Query: 428 HRFSELKERHPVEAREVLEGLQEKLQGTKEIKTKSLI----------KEAINCFLR 473 HRF + + VEAR++ L+E ++ K+ KEA + FLR Sbjct: 83 HRFYNKRAEYIVEARKLYGKLKEIIKADKDQFEAREFLVKNIKGIGYKEA-SHFLR 137 >gnl|CDD|148682 pfam07222, PBP_sp32, Proacrosin binding protein sp32. This family consists of several mammalian specific proacrosin binding protein sp32 sequences. sp32 is a sperm specific protein which is known to bind with with 55- and 53-kDa proacrosins and the 49-kDa acrosin intermediate. The exact function of sp32 is unclear, it is thought however that the binding of sp32 to proacrosin may be involved in packaging the acrosin zymogen into the acrosomal matrix. Length = 243 Score = 28.9 bits (64), Expect = 2.9 Identities = 13/49 (26%), Positives = 19/49 (38%), Gaps = 2/49 (4%) Query: 325 EPEPLPQYKEHSDRQKPSEPLAEHPHPKRKEVER--ELSEIEGAKKESS 371 P+ K+ K E L EH +++ E E E AK+E Sbjct: 190 VQVKAPKPKQEQLLSKLQEYLQEHKTEEKQPQEEQEEEEVEEEAKQEEG 238 >gnl|CDD|114855 pfam06160, EzrA, Septation ring formation regulator, EzrA. During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerizes into a ring structure that establishes the location of the nascent division site. EzrA modulates the frequency and position of FtsZ ring formation. Length = 559 Score = 28.7 bits (65), Expect = 3.4 Identities = 19/70 (27%), Positives = 34/70 (48%), Gaps = 9/70 (12%) Query: 411 DATTFTESLPHVDEQ------TMHRFSELKER-HPVEAREVLEGLQEKLQGTKEI--KTK 461 + ++ +L +++Q +F EL E +EAREVL L+E+ ++ + Sbjct: 155 KSFSYGPALDELEKQLDELEEEFEQFVELTESGDYLEAREVLLKLEEETDALEQKMEEIP 214 Query: 462 SLIKEAINCF 471 L+KE N F Sbjct: 215 PLLKELQNEF 224 >gnl|CDD|150235 pfam09490, CbtA, Probable cobalt transporter subunit (CbtA). This entry represents a family of proteins which have been proposed to act as cobalt transporters acting in concert with vitamin B12 biosynthesis systems. Evidence for this assignment includes 1) prediction of five transmembrane segments, 2) positional gene linkage with known B12 biosynthesis genes, 3) upstream proximity of B12 transcriptional regulatory sites, 4) the absence of other known cobalt import systems and 5) the obligate co-localisation with a small protein (CbtB) having a single additional transmembrane segment and a C-terminal histidine-rich motif likely to be a metal-binding site. Length = 228 Score = 28.1 bits (63), Expect = 4.6 Identities = 12/35 (34%), Positives = 15/35 (42%) Query: 91 IAGAALAGKLLSFIPTPLTRLAGLALQSAPLAAGA 125 A AL LL+F + L L +AP GA Sbjct: 151 AAATALGLALLAFGRNWWAKALALVLLAAPHVIGA 185 >gnl|CDD|161841 TIGR00365, TIGR00365, monothiol glutaredoxin, Grx4 family. The gene for the member of this glutaredoxin family in E. coli, originally designated ydhD, is now designated grxD. Its protein, Grx4, is a monothiol glutaredoxin similar to Grx5 of yeast, which is involved in iron-sulfur cluster formation. Length = 97 Score = 28.2 bits (64), Expect = 5.2 Identities = 9/21 (42%), Positives = 13/21 (61%) Query: 2 YFNAVSDEDIRDNIKEWAQRP 22 Y N + D +IR IKE++ P Sbjct: 46 YVNVLEDPEIRQGIKEYSNWP 66 >gnl|CDD|182344 PRK10263, PRK10263, DNA translocase FtsK; Provisional. Length = 1355 Score = 27.7 bits (61), Expect = 6.9 Identities = 13/101 (12%), Positives = 24/101 (23%), Gaps = 3/101 (2%) Query: 260 PYKHGVKSSSPGLHTSFDA--YEAHTDTLAHGVDSLVRGEYPHFDQEKLQTIADNTLE-D 316 P + +P Y + A E P +T Sbjct: 400 PVQPQQPYYAPAAEQPAQQPYYAPAPEQPAQQPYYAPAPEQPVAGNAWQAEEQQSTFAPQ 459 Query: 317 PHFKPHLPEPEPLPQYKEHSDRQKPSEPLAEHPHPKRKEVE 357 ++ +P Q + Q + P P +E + Sbjct: 460 STYQTEQTYQQPAAQEPLYQQPQPVEQQPVVEPEPVVEETK 500 >gnl|CDD|183147 PRK11465, PRK11465, putative mechanosensitive channel protein; Provisional. Length = 741 Score = 27.4 bits (61), Expect = 8.3 Identities = 8/19 (42%), Positives = 12/19 (63%) Query: 403 TDAPHAKFDATTFTESLPH 421 T +PH F+ TF+ +L H Sbjct: 122 TGSPHKPFNPQTFSNALTH 140 >gnl|CDD|183666 PRK12666, PRK12666, putative monovalent cation/H+ antiporter subunit D; Reviewed. Length = 528 Score = 27.1 bits (61), Expect = 9.1 Identities = 11/24 (45%), Positives = 13/24 (54%), Gaps = 1/24 (4%) Query: 109 TRLAGLALQSAPLAAGALYAYLSH 132 T LA + L + A ALY YL H Sbjct: 317 TLLAAIGLGNPAATAAALY-YLVH 339 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.314 0.132 0.388 Gapped Lambda K H 0.267 0.0506 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 8,064,801 Number of extensions: 535864 Number of successful extensions: 914 Number of sequences better than 10.0: 1 Number of HSP's gapped: 910 Number of HSP's successfully gapped: 19 Length of query: 478 Length of database: 5,994,473 Length adjustment: 97 Effective length of query: 381 Effective length of database: 3,898,497 Effective search space: 1485327357 Effective search space used: 1485327357 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 59 (27.0 bits)