Query         gi|254781204|ref|YP_003065617.1| hypothetical protein CLIBASIA_05555 [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 707
No_of_seqs    6 out of 8
Neff          1.8 
Searched_HMMs 23785
Date          Wed Jun  1 04:02:39 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254781204.hhm -d /home/congqian_1/database/pdb/pdb70.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 3p04_A Uncharacterized BCR; SE  46.9     7.3 0.00031   16.7   1.8   16  672-687    26-41  (87)
  2 2oga_A Transaminase; PLP-depen  44.0      11 0.00046   15.5   2.3   68  159-228     4-78  (399)
  3 1j7q_A CAVP, calcium vector pr  29.0      21 0.00089   13.6   3.1   34  467-500    30-63  (86)
  4 1neq_A DNA-binding protein NER  26.1      24   0.001   13.2   3.1   28  424-451    10-37  (74)
  5 2db7_A Hairy/enhancer-OF-split  20.1      31  0.0013   12.5   2.8   19  268-286    43-61  (64)
  6 1j5w_A Glycyl-tRNA synthetase   17.8      35  0.0015   12.1   1.4   24  346-369   270-293 (298)
  7 1edi_A Staphylococcal protein   15.8      30  0.0013   12.6   0.3   41  160-206    13-53  (56)
  8 2w31_A Globin; oxygen transpor  14.9      41  0.0017   11.7   6.5   52   65-120     3-54  (162)
  9 2o35_A Hypothetical protein DU  14.3      42  0.0018   11.5   1.7   20  272-291    18-37  (105)
 10 3ivr_A Putative long-chain-fat  14.1      40  0.0017   11.8   0.6   38  628-666   369-407 (509)

No 1  
>3p04_A Uncharacterized BCR; SEPF homolog, DUF552, PSI-2, NESG, structural genomics, PROT structure initiative; 2.20A {Corynebacterium glutamicum}
Probab=46.90  E-value=7.3  Score=16.69  Aligned_cols=16  Identities=13%  Similarity=0.634  Sum_probs=6.0

Q ss_pred             CCCCEEEEEHHHCCHH
Q ss_conf             4898789971435857
Q gi|254781204|r  672 KEGKTIIINVEDVNRD  687 (707)
Q Consensus       672 k~g~~iii~~~~~~~~  687 (707)
                      |+|++||+|++.+..+
T Consensus        26 r~~~~VivNl~~ld~~   41 (87)
T 3p04_A           26 RDGDAVVFDMSLLSRE   41 (87)
T ss_dssp             HTTCCEEEECTTSCHH
T ss_pred             HCCCEEEEECCCCCHH
T ss_conf             7699799997789989


No 2  
>2oga_A Transaminase; PLP-dependent enzyme, desosamine, deoxysugars, antibiotics, hydrolase; HET: PGU; 2.05A {Streptomyces venezuelae} PDB: 2oge_A*
Probab=44.01  E-value=11  Score=15.54  Aligned_cols=68  Identities=25%  Similarity=0.364  Sum_probs=34.8

Q ss_pred             HHHHCCCCCCH-HHHHHHHHHHHHHCCCC-HHH-----HHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHC
Q ss_conf             55430776304-99999988853101762-146-----578888888852170000012356826899999999845
Q gi|254781204|r  159 AHVLHDPSNEN-YFQRVQSITDHINSLPI-DLR-----LKQKLLSEAKEKLNTNQIIGAHARDPRVFENFMRAFYKK  228 (707)
Q Consensus       159 ~~~~~~~~~~~-~~~~~~~~~~~~~~~~~-~~~-----~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  228 (707)
                      .|--|..|||| ||+--.+.+.-+-..|. ||.     ++..++...++-|...++++.  ..-+-||.-+..|...
T Consensus         4 ~~~~~~~~~~~~~~~~~~~~~~~~~~ip~~~l~~~~~~~~~~~~~~~~~vl~sg~~~~G--~~v~~fE~~~a~~~g~   78 (399)
T 2oga_A            4 SHHHHHHSSENLYFQGHMSSRAETPRVPFLDLKAAYEELRAETDAAIARVLDSGRYLLG--PELEGFEAEFAAYCET   78 (399)
T ss_dssp             -----------------------CCCBCSCCHHHHHHHTHHHHHHHHHHHHHHTCCSSS--HHHHHHHHHHHHHTTS
T ss_pred             CCCCCCCCCCHHHHHCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCC--HHHHHHHHHHHHHHCC
T ss_conf             64454455210445403333378998697684999999899999999999967997789--7799999999999784


No 3  
>1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A
Probab=29.03  E-value=21  Score=13.58  Aligned_cols=34  Identities=15%  Similarity=0.244  Sum_probs=25.6

Q ss_pred             HCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCC
Q ss_conf             0564778999999742046431457889874067
Q gi|254781204|r  467 KRPASESVDLIRGAYNTLSDSDKEGVRSSFAHIE  500 (707)
Q Consensus       467 kAPASQsI~LL~aI~qtLSns~aeAyrA~l~qi~  500 (707)
                      -+|||++|+||.-.+|+..+-..|+.----++--
T Consensus        30 iapvsdtmdmltklgqtytkreteaimkeargpk   63 (86)
T 1j7q_A           30 IAPVSDTMDMLTKLGQTYTKRETEAIMKEARGPK   63 (86)
T ss_dssp             CBCHHHHHHHHHHTSCCCSHHHHHHHHHHHHCSS
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCC
T ss_conf             5771028999999614776888999999800888


No 4  
>1neq_A DNA-binding protein NER; NMR {Enterobacteria phage MU} SCOP: a.35.1.2 PDB: 1ner_A
Probab=26.14  E-value=24  Score=13.24  Aligned_cols=28  Identities=7%  Similarity=0.216  Sum_probs=24.3

Q ss_pred             CHHHHHHHHHHHCCCHHHHHHHHCCCHH
Q ss_conf             9888899997520336888987188603
Q gi|254781204|r  424 TEESFADSLRQRAGFVKKIKDDYNLTTS  451 (707)
Q Consensus       424 tpe~FtASLaqR~S~V~sLkr~YGt~la  451 (707)
                      .+.+|-+.|..|+.+..+|++.+|.+-.
T Consensus        10 h~adI~AaL~krG~sLa~lsr~~Gls~~   37 (74)
T 1neq_A           10 HRADVIAGLKKRKLSLSALSRQFGYAPT   37 (74)
T ss_dssp             CHHHHHHHHHTTSCCHHHHHHHHSSCHH
T ss_pred             CHHHHHHHHHHCCCCHHHHHHHHCCCHH
T ss_conf             9999999999968969999999099889


No 5  
>2db7_A Hairy/enhancer-OF-split related with YRPW motif 1; structural genomics, unknown function, DNA binding protein, NPPSFA; 1.90A {Homo sapiens} SCOP: a.273.1.1
Probab=20.13  E-value=31  Score=12.47  Aligned_cols=19  Identities=32%  Similarity=0.454  Sum_probs=14.4

Q ss_pred             CCHHHHHHHHHHHHHHHHH
Q ss_conf             0037899999975310123
Q gi|254781204|r  268 LDDTKRRRLLEHLSSRDNA  286 (707)
Q Consensus       268 ~~~~~~~~~~~~~~~~~~~  286 (707)
                      .+|.-|.|||-||.+.-+-
T Consensus        43 ~~d~~r~RLl~HL~~C~~q   61 (64)
T 2db7_A           43 ASDPLRVRLVSHLNNYASQ   61 (64)
T ss_dssp             TTCHHHHHHHHHHHHHHHH
T ss_pred             CCHHHHHHHHHHHHHHHHH
T ss_conf             7638999999999999972


No 6  
>1j5w_A Glycyl-tRNA synthetase alpha chain; structural genomics, TM0216, JCSG, PSI, protein structure initiative; 1.95A {Thermotoga maritima} SCOP: d.104.1.1
Probab=17.77  E-value=35  Score=12.12  Aligned_cols=24  Identities=29%  Similarity=0.350  Sum_probs=22.0

Q ss_pred             HHHHHHHHCCCHHHHHHHHHHCCC
Q ss_conf             564544323570579999974086
Q gi|254781204|r  346 APDVARIKLMSTFDAKKFLQKIDD  369 (707)
Q Consensus       346 G~DIatvq~MSt~~qtA~Leq~~P  369 (707)
                      ..||++||.|.-.-+++|+++++.
T Consensus       270 ~~YI~RVR~LAk~~A~~y~e~r~~  293 (298)
T 1j5w_A          270 QTYVKRIQAMARKAARVFLEVQAN  293 (298)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHCC
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             999999999999999999998875


No 7  
>1edi_A Staphylococcal protein A; immunoglobulin-binding protein, repeat, transmembrane, cell WALL, signal, IGG-binding protein; NMR {Staphylococcus aureus} SCOP: a.8.1.1 PDB: 1edj_A 1edk_A 1edl_A
Probab=15.81  E-value=30  Score=12.57  Aligned_cols=41  Identities=44%  Similarity=0.430  Sum_probs=19.8

Q ss_pred             HHHCCCCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHCCCCC
Q ss_conf             54307763049999998885310176214657888888885217000
Q gi|254781204|r  160 HVLHDPSNENYFQRVQSITDHINSLPIDLRLKQKLLSEAKEKLNTNQ  206 (707)
Q Consensus       160 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  206 (707)
                      .+||-| |-|--||.-    .|.||--|-.....+|.||| |||..|
T Consensus        13 eil~lP-NLne~Qrn~----fIqSLkDDPSqSan~LaEAk-klNd~Q   53 (56)
T 1edi_A           13 QVLNMP-NLNADQRNG----FIQSLKDDPSQSANVLGEAQ-KLNDSQ   53 (56)
T ss_dssp             HHHSCT-TSCHHHHHH----HHHHHHHCGGGHHHHHHHHH-HHHHHT
T ss_pred             HHHHCC-CCCHHHHHH----HHHHHCCCHHHHHHHHHHHH-HCCCCC
T ss_conf             999477-899899988----99883138037789999998-722123


No 8  
>2w31_A Globin; oxygen transport, hexacoordination; HET: HEM; 1.50A {Geobacter sulfurreducens}
Probab=14.88  E-value=41  Score=11.65  Aligned_cols=52  Identities=12%  Similarity=0.101  Sum_probs=29.8

Q ss_pred             HHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             38987767765410121133321356888730023668999974212578999988
Q gi|254781204|r   65 SFKAVQDFHDFTNSLDTRDSLQAGDKIKEYVDGRIRSAYDRFLSSISHRDVRKKFQ  120 (707)
Q Consensus        65 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  120 (707)
                      +++-+..|-+||.. |..--.+..+.+.++.+.-+..-|+++++   +.+.++-|.
T Consensus         3 ~~~~~~~~~~~t~~-d~~~l~~~~~~l~~~~~~i~~~FY~~l~~---~P~~~~~f~   54 (162)
T 2w31_A            3 TMQEIKAHYRFTDE-DAELLGSLFPLAETNKERLADQFYDYLLG---IPETAEFLK   54 (162)
T ss_dssp             SHHHHHHHHTCCHH-HHHHHHHTHHHHHHTHHHHHHHHHHHHHT---SHHHHGGGS
T ss_pred             CHHHHHHHCCCCHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHC---CHHHHHHHC
T ss_conf             69999988099999-99999997999998799999999999861---969998768


No 9  
>2o35_A Hypothetical protein DUF1244; helix bundle, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.12A {Sinorhizobium meliloti} SCOP: a.293.1.1
Probab=14.28  E-value=42  Score=11.55  Aligned_cols=20  Identities=50%  Similarity=0.662  Sum_probs=12.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHH
Q ss_conf             89999997531012334677
Q gi|254781204|r  272 KRRRLLEHLSSRDNALNTKL  291 (707)
Q Consensus       272 ~~~~~~~~~~~~~~~~~~~~  291 (707)
                      --|||+.||..|...-|..|
T Consensus        18 aFRrL~~HL~~r~DVQNIDl   37 (105)
T 2o35_A           18 VFRRLLEHLRERSDVQNIDL   37 (105)
T ss_dssp             HHHHHHHHHHHTTTSCHHHH
T ss_pred             HHHHHHHHHHHCCCHHHHHH
T ss_conf             99999999862773057899


No 10 
>3ivr_A Putative long-chain-fatty-acid COA ligase; structural genomics, PSI-2, protein structure initiative, fatty acid synthesis; HET: GOL; 2.00A {Rhodopseudomonas palustris}
Probab=14.14  E-value=40  Score=11.75  Aligned_cols=38  Identities=26%  Similarity=0.492  Sum_probs=0.0

Q ss_pred             HHHHHHHHHHCCCCCCCCCCE-EEEEEECCCCEEEEEECC
Q ss_conf             334777753127655652500-043452178506898379
Q gi|254781204|r  628 KTDFEDRLWYATKDTGEYDPY-TIKYMNVGSGKYMIIKNG  666 (707)
Q Consensus       628 kstFkDRl~y~~~~~g~~~~~-~i~~~~~g~~~y~i~~~~  666 (707)
                      ...|+++ ||+|-|+|.++.+ -+-+..-.+.+.+|+.+|
T Consensus       369 ~~~~~~g-~~~TGDlg~~~~dG~l~~~gR~~~~~~i~~~G  407 (509)
T 3ivr_A          369 QHAFRNG-WHHTGDMGRFDADGYLFYAGRAPEKELIKTGG  407 (509)
T ss_dssp             HHHTGGG-SEEEEEEEEECTTSCEEEEEEC----------
T ss_pred             HHHHCCC-CCCCCCEEEECCCCCEECCCCCCCEEEEEECC
T ss_conf             6552589-97578679997898730137766425999899


Done!