RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254781204|ref|YP_003065617.1| hypothetical protein CLIBASIA_05555 [Candidatus Liberibacter asiaticus str. psy62] (707 letters) >gnl|CDD|183426 PRK12309, PRK12309, transaldolase/EF-hand domain-containing protein; Provisional. Length = 391 Score = 32.4 bits (74), Expect = 0.46 Identities = 21/67 (31%), Positives = 36/67 (53%), Gaps = 15/67 (22%) Query: 373 SNPSLSLASTMMATKYKEILEKSHRQSMQELNQDA--------------ISWGIKYKQID 418 +NPSL A+ M +Y+ I++++ RQ+ +EL DA +++G+K +I Sbjct: 35 TNPSLITAAAQMP-QYQSIVDETLRQARKELGSDAPVEDVVALAFDRLAVAFGLKILKIV 93 Query: 419 PLRFDTE 425 P R TE Sbjct: 94 PGRVSTE 100 >gnl|CDD|178490 PLN02902, PLN02902, pantothenate kinase. Length = 876 Score = 31.8 bits (72), Expect = 0.59 Identities = 19/66 (28%), Positives = 34/66 (51%), Gaps = 4/66 (6%) Query: 468 RPASESVDLIRGAYNTLSDSDKEGVRSSFAHIEDNGLSA----VVRLSSEFSDDAKNAAM 523 R A+E+ L+ A D K+ S + +NG + + ++SSE + AK+A + Sbjct: 763 RRAAEAGGLLVDAMVNTDDGSKDDSTSVPLMVVENGCGSPCIDLRQVSSELAAAAKDADL 822 Query: 524 VILSGM 529 ++L GM Sbjct: 823 IVLEGM 828 >gnl|CDD|181758 PRK09287, PRK09287, 6-phosphogluconate dehydrogenase; Validated. Length = 459 Score = 32.0 bits (74), Expect = 0.61 Identities = 15/35 (42%), Positives = 23/35 (65%), Gaps = 2/35 (5%) Query: 362 KFLQKIDDEYISNPSLSLASTMMATKYKEILEKSH 396 +FLQKI D Y +NP LA+ ++ +K+ILE+ Sbjct: 358 QFLQKITDAYEANP--DLANLLLDPYFKDILEEYQ 390 >gnl|CDD|163162 TIGR03156, GTP_HflX, GTP-binding protein HflX. This protein family is one of a number of homologous small, well-conserved GTP-binding proteins with pleiotropic effects. Bacterial members are designated HflX, following the naming convention in Escherichia coli where HflX is encoded immediately downstream of the RNA chaperone Hfq, and immediately upstream of HflKC, a membrane-associated protease pair with an important housekeeping function. Over large numbers of other bacterial genomes, the pairing with hfq is more significant than with hflK and hlfC. The gene from Homo sapiens in this family has been named PGPL (pseudoautosomal GTP-binding protein-like). Length = 351 Score = 30.1 bits (69), Expect = 2.1 Identities = 16/53 (30%), Positives = 21/53 (39%), Gaps = 9/53 (16%) Query: 240 DVSDSARERSLEVVEDVSKAIGLAG---------WDRLDDTKRRRLLEHLSSR 283 D SD RE +E VE V + +G D LD+ + RL E Sbjct: 277 DASDPDREEQIEAVEKVLEELGAEDIPQLLVYNKIDLLDEPRIERLEEGYPEA 329 >gnl|CDD|162528 TIGR01776, TonB-tbp-lbp, TonB-dependent lactoferrin and transferrin receptors. This family of TonB-dependent receptors are responsible for import of iron from the mammalian iron carriers lactoferrin and transferrin across the outer membrane. These receptors are found only in bacteria which can infect mammals such as Moraxella, Mannheimia, Neisseria, Actinobacillus, Pasteurella, Haemophilus and Histophilus species. Length = 932 Score = 29.4 bits (66), Expect = 3.0 Identities = 9/26 (34%), Positives = 13/26 (50%) Query: 103 YDRFLSSISHRDVRKKFQAQVEHDIR 128 YD+F S +S D R++ IR Sbjct: 518 YDKFKSQLSRHDYRRQNAVGTYESIR 543 >gnl|CDD|178325 PLN02724, PLN02724, Molybdenum cofactor sulfurase. Length = 805 Score = 29.1 bits (65), Expect = 4.6 Identities = 11/34 (32%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 355 MSTF-DAKKFLQKIDDEYISNPSLSLASTMMATK 387 MSTF D +KF+ I ++S P T+ + + Sbjct: 469 MSTFEDCQKFIDFIISSFVSTPKKRGNVTLRSKR 502 >gnl|CDD|183531 PRK12447, PRK12447, histidinol dehydrogenase; Reviewed. Length = 426 Score = 29.1 bits (66), Expect = 4.6 Identities = 12/31 (38%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Query: 485 SDSD-KEGVRSSFAHIEDNGLSAVVRLSSEF 514 +DS +E V + A IE G +AV S +F Sbjct: 18 TDSKVRETVEAILADIEARGDAAVREYSRKF 48 >gnl|CDD|162366 TIGR01448, recD_rel, helicase, putative, RecD/TraA family. This model describes a family similar to RecD, the exodeoxyribonuclease V alpha chain of TIGR01447. Members of this family, however, are not found in a context of RecB and RecC and are longer by about 200 amino acids at the amino end. Chlamydia muridarum has both a member of this family and a RecD. Length = 720 Score = 29.0 bits (65), Expect = 4.8 Identities = 29/152 (19%), Positives = 50/152 (32%), Gaps = 18/152 (11%) Query: 286 ALNTKLRKETQAQARRIDAQLNHGITVKPSELIPLEDYTQAYGVEQGTELYNLQQFKSVA 345 ALN R A G T +P + ++Q L N+Q + + Sbjct: 204 ALNDPRRITAGLVYSLQQACTEEGHT-----YLPRNRF-----IKQVVHLLNVQPQERLL 253 Query: 346 APDVARIKLMSTFDAKKFLQKIDDEYISNPSLSLASTMMATKYKEILEKSHRQSMQELNQ 405 P+ ++ + + K +D I PSL A +A+ + +L S +N Sbjct: 254 VPEAVELERLYLDEEPKLAA--EDGRIYLPSLFRAEKQIASHIRRLLATSPAI--GAIND 309 Query: 406 DAISWGIKYKQIDPLRFDTEESFADSLRQRAG 437 W ++ LR E +L Sbjct: 310 QEHIWEVE----KKLRKGLSEEQKQALDTAIQ 337 >gnl|CDD|180998 PRK07488, PRK07488, indole acetimide hydrolase; Validated. Length = 472 Score = 28.4 bits (64), Expect = 6.3 Identities = 22/75 (29%), Positives = 29/75 (38%), Gaps = 15/75 (20%) Query: 235 STSLSDVSDSARERSLEVVEDVSKAIGLAGWDRLDDTKRRRLLEHLSSRDNALNTKLRKE 294 S SL++ + + R L +E V + R L L NA T + Sbjct: 10 SLSLTEAAAALRSGRLSCLELVEALL-----------ARAAALAPL----NAFTTVDAEG 54 Query: 295 TQAQARRIDAQLNHG 309 A ARRIDAQ G Sbjct: 55 ALAAARRIDAQRAAG 69 >gnl|CDD|151059 pfam10499, Pmp24, Peroxisomal membrane protein 24. Peroxisomes are single membrane bound organelles, present in practically all eukaryotic cells, and involved in a variety of metabolic pathways; the deduced protein is extremely basic, a characteristic of many other peroxisomal intrinsic membrane proteins. They carry two short stretches of hydrophobic residues shown to be necessary for the correct targeting of these proteins. A sequence with these characteristics is found in human PMP24 (amino acid residues 16-30). However, in the absence of experimental data, the involvement of this domain in the targeting of PMP24 remains to be proved. PMP24 was known as Pmp27. Length = 181 Score = 28.4 bits (64), Expect = 6.9 Identities = 12/36 (33%), Positives = 18/36 (50%), Gaps = 1/36 (2%) Query: 376 SLSLASTMMATKY-KEILEKSHRQSMQELNQDAISW 410 +++ M +Y E L+ S R SM L D+ SW Sbjct: 145 AVTWGLVMYLFRYHPETLQSSLRSSMTYLYHDSDSW 180 >gnl|CDD|148851 pfam07478, Dala_Dala_lig_C, D-ala D-ala ligase C-terminus. This family represents the C-terminal, catalytic domain of the D-alanine--D-alanine ligase enzyme EC:6.3.2.4. D-Alanine is one of the central molecules of the cross-linking step of peptidoglycan assembly. There are three enzymes involved in the D-alanine branch of peptidoglycan biosynthesis: the pyridoxal phosphate-dependent D-alanine racemase (Alr), the ATP-dependent D-alanine:D-alanine ligase (Ddl), and the ATP-dependent D-alanine:D-alanine-adding enzyme (MurF). Length = 201 Score = 28.4 bits (64), Expect = 7.0 Identities = 9/31 (29%), Positives = 16/31 (51%) Query: 239 SDVSDSARERSLEVVEDVSKAIGLAGWDRLD 269 +D+ + E+ E+ KA+G G R+D Sbjct: 125 ADLPEEVEEQIQELALKAYKALGCRGLARID 155 >gnl|CDD|183786 PRK12843, PRK12843, putative FAD-binding dehydrogenase; Reviewed. Length = 578 Score = 28.2 bits (63), Expect = 7.4 Identities = 16/64 (25%), Positives = 22/64 (34%), Gaps = 4/64 (6%) Query: 86 QAGDKIKEYVDGRIRSA---YDRFLSSISHRDVRKKFQAQVEH-DIRDYHTKGVDIQIGA 141 A D+I R+ R L S+ R VR Q VE + G + G Sbjct: 204 YARDRISYARGTRLVMGNALIGRLLYSLRARGVRILTQTDVESLETDHGRVIGATVVQGG 263 Query: 142 TQRA 145 +R Sbjct: 264 VRRR 267 >gnl|CDD|129951 TIGR00873, gnd, 6-phosphogluconate dehydrogenase, decarboxylating. This model does not specify whether the cofactor is NADP only (EC 1.1.1.44), NAD only, or both. The model does not assign an EC number for that reason. Length = 467 Score = 28.1 bits (63), Expect = 8.4 Identities = 21/73 (28%), Positives = 33/73 (45%), Gaps = 10/73 (13%) Query: 362 KFLQKIDDEYISNPSLSLASTMMATKYKEILEKSHRQSMQELNQDAISWGIKYKQIDPL- 420 FL KI + NP LA+ ++A +K+ L+ + + + AI +GI P+ Sbjct: 366 GFLDKITKAFAENP--DLANLLLAPYFKDALKDAQ-SGWRRVVALAIEYGI------PVP 416 Query: 421 RFDTEESFADSLR 433 F SF D R Sbjct: 417 AFSAALSFYDGYR 429 >gnl|CDD|131364 TIGR02311, HpaI, 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase. This model represents the aldolase which performs the final step unique to the 4-hydroxyphenylacetic acid catabolism pathway in which 2,4-dihydroxyhept-2-ene-1,7-dioic acid is split into pyruvate and succinate-semialdehyde. The gene for enzyme is generally found adjacent to other genes for this pathway organized into an operon. Length = 249 Score = 27.8 bits (62), Expect = 8.8 Identities = 11/36 (30%), Positives = 21/36 (58%) Query: 9 PLVEAVTPNQDAVRDSVNPQAGLRDLGDALGKATQF 44 P++E + AV + P G+R +G AL +A+++ Sbjct: 91 PMIETAEQAEAAVAATRYPPMGIRGVGSALARASRW 126 >gnl|CDD|185639 PTZ00460, PTZ00460, acyl-CoA dehydrogenase; Provisional. Length = 646 Score = 27.9 bits (62), Expect = 9.4 Identities = 19/59 (32%), Positives = 29/59 (49%), Gaps = 12/59 (20%) Query: 622 PPRGMSKTDFEDRLWYATKDTG--EYDPYTI-------KYMNVGS-GKYMIIKNGNPKV 670 P +G+ D ++ YA KD G +D Y I +Y+ V G+ + + GNPKV Sbjct: 212 PLQGVEVGDIGPKMGYAVKDNGFLSFDHYRIPLDSLLARYIKVSEDGQ--VERQGNPKV 268 >gnl|CDD|180867 PRK07187, PRK07187, ribonucleotide-diphosphate reductase subunit alpha; Validated. Length = 721 Score = 27.8 bits (62), Expect = 10.0 Identities = 13/33 (39%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Query: 552 YDSYIN-TPLTKLEQSTAGGNFNKDKEAIKLYL 583 DSY++ LTK ++ +F+ DKEA++ YL Sbjct: 5 NDSYLSLNALTKFKKPDGSYHFDSDKEAVERYL 37 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.314 0.130 0.361 Gapped Lambda K H 0.267 0.0684 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 11,261,384 Number of extensions: 731657 Number of successful extensions: 1190 Number of sequences better than 10.0: 1 Number of HSP's gapped: 1190 Number of HSP's successfully gapped: 36 Length of query: 707 Length of database: 5,994,473 Length adjustment: 100 Effective length of query: 607 Effective length of database: 3,833,673 Effective search space: 2327039511 Effective search space used: 2327039511 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 61 (27.4 bits)