RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254781205|ref|YP_003065618.1| hypothetical protein CLIBASIA_05560 [Candidatus Liberibacter asiaticus str. psy62] (171 letters) >gnl|CDD|147573 pfam05461, ApoL, Apolipoprotein L. Apo L belongs to the high density lipoprotein family that plays a central role in cholesterol transport. The cholesterol content of membranes is important in cellular processes such as modulating gene transcription and signal transduction both in the adult brain and during neurodevelopment. There are six apo L genes located in close proximity to each other on chromosome 22q12 in humans. 22q12 is a confirmed high-susceptibility locus for schizophrenia and close to the region associated with velocardiofacial syndrome that includes symptoms of schizophrenia. Length = 313 Score = 26.9 bits (60), Expect = 3.0 Identities = 15/49 (30%), Positives = 22/49 (44%), Gaps = 1/49 (2%) Query: 11 GLSLASPLVGAGLRISSTLASHRSSIRDHEYRSLLAEENALRADVLYLD 59 G SL G GL ++ + S +SI ++ S AE A R +D Sbjct: 125 GGSLVLSATGLGLGAAAAVTSISTSIVENVSNS-SAEAKASRLVPTSMD 172 >gnl|CDD|35694 KOG0473, KOG0473, KOG0473, Leucine-rich repeat protein [Function unknown]. Length = 326 Score = 26.7 bits (58), Expect = 3.6 Identities = 15/79 (18%), Positives = 25/79 (31%), Gaps = 1/79 (1%) Query: 90 DLLVGQNTRNAYKGINTARTAREQTVARFAKEAGWHRANKEAVKNNRWASVAAIAGPPMV 149 DL+ N +A + R A + H +A + +W A V Sbjct: 170 DLMATGNKPSA-AFVKNTRAAYGSVKQGKHNQKKPHVKPVQAAVSKKWKQFAKSDVGGKV 228 Query: 150 ESASSAGMKMFRRYNVKGK 168 E ++ K VK + Sbjct: 229 EKIAANISKSIVDKWVKIQ 247 >gnl|CDD|40037 KOG4840, KOG4840, KOG4840, Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only]. Length = 299 Score = 25.8 bits (56), Expect = 7.1 Identities = 11/42 (26%), Positives = 19/42 (45%) Query: 29 LASHRSSIRDHEYRSLLAEENALRADVLYLDREDQARREGIM 70 A ++ + D EY+ L E +D+L +E R E + Sbjct: 136 AAILQAPVSDREYQFLEEHETKDLSDLLRAAKETIGRGEDVA 177 >gnl|CDD|145104 pfam01771, Herpes_alk_exo, Herpesvirus alkaline exonuclease. This family includes various alkaline exonucleases from members of the herpesviridae. Alkaline exonuclease appears to have an important role in the replication of herpes simplex virus. Length = 458 Score = 25.4 bits (56), Expect = 9.2 Identities = 7/13 (53%), Positives = 10/13 (76%) Query: 82 SGVSGASLDLLVG 94 +G+ GASLD+ V Sbjct: 189 TGIFGASLDMCVN 201 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.316 0.129 0.357 Gapped Lambda K H 0.267 0.0696 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 1,829,395 Number of extensions: 83792 Number of successful extensions: 192 Number of sequences better than 10.0: 1 Number of HSP's gapped: 192 Number of HSP's successfully gapped: 7 Length of query: 171 Length of database: 6,263,737 Length adjustment: 87 Effective length of query: 84 Effective length of database: 4,383,754 Effective search space: 368235336 Effective search space used: 368235336 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 54 (24.6 bits)