RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254781205|ref|YP_003065618.1| hypothetical protein CLIBASIA_05560 [Candidatus Liberibacter asiaticus str. psy62] (171 letters) >gnl|CDD|169558 PRK08719, PRK08719, ribonuclease H; Reviewed. Length = 147 Score = 27.5 bits (61), Expect = 1.6 Identities = 12/56 (21%), Positives = 26/56 (46%), Gaps = 4/56 (7%) Query: 120 KEAGWHRANKEAVKNNR-WASVAAIAGPPMVE---SASSAGMKMFRRYNVKGKDAS 171 K+ GW +++K+ V N W V + VE + +G++ ++ + A+ Sbjct: 90 KQKGWRKSDKKPVANRDLWQQVDELRARKYVEVEKVTAHSGIEGNEAADMLAQAAA 145 >gnl|CDD|183321 PRK11809, putA, trifunctional transcriptional regulator/proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase; Reviewed. Length = 1318 Score = 26.9 bits (60), Expect = 3.0 Identities = 9/20 (45%), Positives = 11/20 (55%) Query: 113 QTVARFAKEAGWHRANKEAV 132 Q+V R A A + R EAV Sbjct: 88 QSVLRAAITAAYRRPETEAV 107 >gnl|CDD|177394 PHA02562, 46, endonuclease subunit; Provisional. Length = 562 Score = 26.9 bits (60), Expect = 3.2 Identities = 14/74 (18%), Positives = 29/74 (39%), Gaps = 4/74 (5%) Query: 61 EDQARREGIMDTGVFRMKAVLSGVSGASLDLLV----GQNTRNAYKGINTARTAREQTVA 116 E+ AR++ D V K + + + + +LL ++ A +NTA + + Sbjct: 213 ENIARKQNKYDELVEEAKTIKAEIEELTDELLNLVMDIEDPSAALNKLNTAAAKIKSKIE 272 Query: 117 RFAKEAGWHRANKE 130 +F K + Sbjct: 273 QFQKVIKMYEKGGV 286 >gnl|CDD|184554 PRK14179, PRK14179, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional. Length = 284 Score = 26.6 bits (59), Expect = 3.7 Identities = 12/27 (44%), Positives = 16/27 (59%), Gaps = 2/27 (7%) Query: 146 PPMVESASSAGMKMFRRYNV--KGKDA 170 P M+ + M+MFR YNV +GK A Sbjct: 135 PVMIPCTPAGIMEMFREYNVELEGKHA 161 >gnl|CDD|152197 pfam11761, CbiG_mid, Cobalamin biosynthesis central region. Members of this family are involved in cobalamin synthesis. The Synechocystis sp. PCC 6803 precorrin methylase has been designated cbiH but in fact represents a fusion between cbiH and cbiG. As other multi-functional proteins involved in cobalamin biosynthesis catalyse adjacent steps in the pathway, including CysG, CobL (CbiET), CobIJ and CobA-HemD, it is therefore possible that CbiG catalyses a reaction step adjacent to CbiH. In the anaerobic pathway such a step could be the formation of a gamma lactone, which is thought to help to mediate the anaerobic ring contraction process. Length = 80 Score = 26.1 bits (58), Expect = 4.3 Identities = 9/16 (56%), Positives = 10/16 (62%) Query: 118 FAKEAGWHRANKEAVK 133 AKE GW A+ E VK Sbjct: 7 LAKENGWRIADPEDVK 22 >gnl|CDD|179415 PRK02362, PRK02362, ski2-like helicase; Provisional. Length = 737 Score = 25.7 bits (57), Expect = 6.3 Identities = 14/31 (45%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Query: 42 RSLLAEENALRADVLYLDREDQAR-REGIMD 71 RS LA E ALR VL AR R+G+++ Sbjct: 416 RSKLATEPALRTHVLSTIASGFARTRDGLLE 446 >gnl|CDD|148573 pfam07037, DUF1323, Putative transcription regulator (DUF1323). This family consists of several hypothetical Enterobacterial proteins of around 120 residues in length. This family appears to have an HTH domain and is therefore likely to act as a transcriptional regulator. Length = 122 Score = 25.5 bits (56), Expect = 7.3 Identities = 8/24 (33%), Positives = 14/24 (58%) Query: 113 QTVARFAKEAGWHRANKEAVKNNR 136 QT+ R+ ++ GW + K VK + Sbjct: 15 QTINRWVRKEGWKTSPKPGVKGGK 38 >gnl|CDD|163225 TIGR03348, VI_IcmF, type VI secretion protein IcmF. Members of this protein family are IcmF homologs and tend to be associated with type VI secretion systems. Length = 1169 Score = 25.4 bits (56), Expect = 8.6 Identities = 18/81 (22%), Positives = 25/81 (30%), Gaps = 9/81 (11%) Query: 86 GASLDLLVGQNTRNAYKGINTARTAREQTVARFAK---------EAGWHRANKEAVKNNR 136 G +D L+G R AR + + F K EAG N+ A + R Sbjct: 369 GTPIDRLLGALARGFGLSPGPPAAARGEGRSYFLKDLFKEVIFPEAGLAGLNRRAERRRR 428 Query: 137 WASVAAIAGPPMVESASSAGM 157 W A A + Sbjct: 429 WLRRGAYAAAALAALGLLGLW 449 >gnl|CDD|184731 PRK14536, cysS, cysteinyl-tRNA synthetase; Provisional. Length = 490 Score = 24.9 bits (54), Expect = 9.9 Identities = 15/64 (23%), Positives = 29/64 (45%), Gaps = 4/64 (6%) Query: 100 AYKGINTARTAREQTVARFAKEAGWHRANKEAVKNNRWASVAAIAGPPMVESASSAGMKM 159 +++ + TA+ AR V R A+ RA +V+ ++A A + ES +S + Sbjct: 319 SWEALKTAKAARRSLVRRVARVVDAARATTGSVR----GTLAECAAERVAESRASESELL 374 Query: 160 FRRY 163 + Sbjct: 375 LTDF 378 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.316 0.129 0.357 Gapped Lambda K H 0.267 0.0821 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 2,689,679 Number of extensions: 160936 Number of successful extensions: 345 Number of sequences better than 10.0: 1 Number of HSP's gapped: 345 Number of HSP's successfully gapped: 22 Length of query: 171 Length of database: 5,994,473 Length adjustment: 87 Effective length of query: 84 Effective length of database: 4,114,577 Effective search space: 345624468 Effective search space used: 345624468 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 54 (24.4 bits)