RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254781205|ref|YP_003065618.1| hypothetical protein CLIBASIA_05560 [Candidatus Liberibacter asiaticus str. psy62] (171 letters) >d2b9ea1 c.66.1.38 (A:133-425) NOL1R {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Score = 25.1 bits (53), Expect = 3.4 Identities = 7/49 (14%), Positives = 19/49 (38%) Query: 104 INTARTAREQTVARFAKEAGWHRANKEAVKNNRWASVAAIAGPPMVESA 152 +NT +T + V F ++ ++ ++ + R P++ Sbjct: 8 VNTLKTCSDDVVDYFKRQGFSYQGRASSLDDLRALKGKHFLLDPLMPEL 56 >d2pofa1 d.13.1.4 (A:31-250) CDP-diacylglycerol pyrophosphatase CDH {Escherichia coli [TaxId: 562]} Length = 220 Score = 24.4 bits (53), Expect = 5.7 Identities = 19/73 (26%), Positives = 26/73 (35%), Gaps = 7/73 (9%) Query: 25 ISSTLASHRSSIRDHEYRSLLAEENALRADVLY--LDREDQARREGIMDTGVFRMKAVLS 82 ISS +R HEY + E+ L + L E RE + G+ + Sbjct: 131 ISSRWLPLPGGLRGHEYLARRVTESELVQRSPFMMLAEEVPEAREHMGSYGL-----AMV 185 Query: 83 GVSGASLDLLVGQ 95 S S LL Q Sbjct: 186 RQSDNSFVLLATQ 198 >d3eeqa2 c.152.1.1 (A:8-214) Cobalamin biosynthesis protein G, CbiG {Sulfolobus solfataricus [TaxId: 2287]} Length = 207 Score = 24.1 bits (52), Expect = 7.7 Identities = 12/56 (21%), Positives = 20/56 (35%), Gaps = 1/56 (1%) Query: 79 AVLSGVSGASLDLLVGQNTRNAYKGINTARTAREQ-TVARFAKEAGWHRANKEAVK 133 +L G GA+ N+ I TA + + ++ R A N E + Sbjct: 95 PLLGGHWGANDIARELSVILNSTPIITTAAEIKGKLSIERIANILIAKIINPENIV 150 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.316 0.129 0.357 Gapped Lambda K H 0.267 0.0606 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 560,296 Number of extensions: 21781 Number of successful extensions: 35 Number of sequences better than 10.0: 1 Number of HSP's gapped: 35 Number of HSP's successfully gapped: 4 Length of query: 171 Length of database: 2,407,596 Length adjustment: 79 Effective length of query: 92 Effective length of database: 1,322,926 Effective search space: 121709192 Effective search space used: 121709192 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.3 bits)