BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254781207|ref|YP_003065620.1| hypothetical protein CLIBASIA_05570 [Candidatus Liberibacter asiaticus str. psy62] (80 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254781207|ref|YP_003065620.1| hypothetical protein CLIBASIA_05570 [Candidatus Liberibacter asiaticus str. psy62] Length = 80 Score = 156 bits (395), Expect = 6e-41, Method: Compositional matrix adjust. Identities = 80/80 (100%), Positives = 80/80 (100%) Query: 1 MGFWNSITSIAATVGAVVGTVATAAALATPIGWVGAAVAGVGAAVVGAGASDLAMHKMRE 60 MGFWNSITSIAATVGAVVGTVATAAALATPIGWVGAAVAGVGAAVVGAGASDLAMHKMRE Sbjct: 1 MGFWNSITSIAATVGAVVGTVATAAALATPIGWVGAAVAGVGAAVVGAGASDLAMHKMRE 60 Query: 61 QEEEEKKLLKKGLKKRQKNY 80 QEEEEKKLLKKGLKKRQKNY Sbjct: 61 QEEEEKKLLKKGLKKRQKNY 80 >gi|254781009|ref|YP_003065422.1| hypothetical protein CLIBASIA_04555 [Candidatus Liberibacter asiaticus str. psy62] Length = 750 Score = 23.1 bits (48), Expect = 0.98, Method: Composition-based stats. Identities = 9/15 (60%), Positives = 12/15 (80%) Query: 52 DLAMHKMREQEEEEK 66 DL H+M E++EEEK Sbjct: 603 DLYKHQMIEKKEEEK 617 >gi|254780561|ref|YP_003064974.1| thiamine transporter substrate binding subunit [Candidatus Liberibacter asiaticus str. psy62] Length = 338 Score = 23.1 bits (48), Expect = 1.0, Method: Composition-based stats. Identities = 10/33 (30%), Positives = 16/33 (48%) Query: 1 MGFWNSITSIAATVGAVVGTVATAAALATPIGW 33 +GF N++ +A G + A+ L PI W Sbjct: 90 LGFDNNLIDLARKTGLFAKSNIDASQLKLPIKW 122 >gi|254780439|ref|YP_003064852.1| carbamoyl phosphate synthase large subunit [Candidatus Liberibacter asiaticus str. psy62] Length = 1162 Score = 22.7 bits (47), Expect = 1.2, Method: Composition-based stats. Identities = 12/30 (40%), Positives = 17/30 (56%), Gaps = 1/30 (3%) Query: 48 AGASDLAMHKMREQEEEEKKLLKKGLKKRQ 77 A A+D+ H + EEE + LKK L K + Sbjct: 149 ANATDIKEHDRKLHEEEREN-LKKTLSKEE 177 >gi|254780967|ref|YP_003065380.1| probable multidrug resistance transporter protein [Candidatus Liberibacter asiaticus str. psy62] Length = 398 Score = 21.9 bits (45), Expect = 2.1, Method: Composition-based stats. Identities = 11/38 (28%), Positives = 19/38 (50%), Gaps = 2/38 (5%) Query: 2 GFWNSITSIAATVGAVVGTVATAAALATPIGWVGAAVA 39 GF N++ I+ +G ++G IG+ G AV+ Sbjct: 343 GFINTV--ISTILGIIIGQSFNGTTYPITIGFFGIAVS 378 >537021.9.peg.410_1 Length = 952 Score = 21.6 bits (44), Expect = 2.9, Method: Composition-based stats. Identities = 9/25 (36%), Positives = 14/25 (56%) Query: 51 SDLAMHKMREQEEEEKKLLKKGLKK 75 SDL H + +EE +LL G+ + Sbjct: 633 SDLIKHLKKSTQEEYNRLLYVGMTR 657 >gi|255764483|ref|YP_003065151.2| hypothetical protein CLIBASIA_03125 [Candidatus Liberibacter asiaticus str. psy62] Length = 135 Score = 20.8 bits (42), Expect = 4.6, Method: Compositional matrix adjust. Identities = 7/19 (36%), Positives = 14/19 (73%) Query: 55 MHKMREQEEEEKKLLKKGL 73 MH+ R++E + + + KKG+ Sbjct: 1 MHRKRQREIKNETVRKKGI 19 >gi|254780705|ref|YP_003065118.1| phosphate ABC transporter, permease protein PstA [Candidatus Liberibacter asiaticus str. psy62] Length = 425 Score = 20.4 bits (41), Expect = 5.8, Method: Composition-based stats. Identities = 8/11 (72%), Positives = 10/11 (90%) Query: 38 VAGVGAAVVGA 48 VAG+G AVVG+ Sbjct: 200 VAGIGVAVVGS 210 >gi|254781123|ref|YP_003065536.1| putative ABC transporter, ATP-binding protein [Candidatus Liberibacter asiaticus str. psy62] Length = 610 Score = 20.0 bits (40), Expect = 8.7, Method: Composition-based stats. Identities = 6/18 (33%), Positives = 13/18 (72%) Query: 56 HKMREQEEEEKKLLKKGL 73 H ++++ E EK+ L+ G+ Sbjct: 221 HNLKKKNEAEKEWLRYGV 238 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.313 0.126 0.355 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 42,662 Number of Sequences: 1233 Number of extensions: 1239 Number of successful extensions: 17 Number of sequences better than 100.0: 13 Number of HSP's better than 100.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of query: 80 length of database: 328,796 effective HSP length: 49 effective length of query: 31 effective length of database: 268,379 effective search space: 8319749 effective search space used: 8319749 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.1 bits) S2: 31 (16.5 bits)