RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254781208|ref|YP_003065621.1| hypothetical protein CLIBASIA_05575 [Candidatus Liberibacter asiaticus str. psy62] (578 letters) >gnl|CDD|147387 pfam05176, ATP-synt_10, ATP10 protein. ATP 10 is essential for the assembly of a functional mitochondrial ATPase complex. Length = 255 Score = 29.6 bits (67), Expect = 2.3 Identities = 15/32 (46%), Positives = 21/32 (65%), Gaps = 1/32 (3%) Query: 299 GRSISVAPQS-QTLFQAGVSVVSWFMSAWGEQ 329 GR+++ PQ+ L + VSVV F SAWGE+ Sbjct: 108 GRTLAGPPQNTTDLLRGKVSVVRLFSSAWGEK 139 >gnl|CDD|38448 KOG3238, KOG3238, KOG3238, Chloride ion current inducer protein [Inorganic ion transport and metabolism]. Length = 216 Score = 28.9 bits (64), Expect = 3.7 Identities = 13/47 (27%), Positives = 24/47 (51%) Query: 400 GEGVLVGCDTSLWLLSISLSKGLSIDFRRVSGSGVYACPPVSVGDCL 446 G G L +++L LS S +KG S+++ +S + P + + L Sbjct: 34 GTGTLYIAESTLSWLSTSGAKGFSVEYPTISLHAISRDPSDCLSEHL 80 >gnl|CDD|73154 cd01647, RT_LTR, RT_LTR: Reverse transcriptases (RTs) from retrotransposons and retroviruses which have long terminal repeats (LTRs) in their DNA copies but not in their RNA template. RT catalyzes DNA replication from an RNA template, and is responsible for the replication of retroelements. An RT gene is usually indicative of a mobile element such as a retrotransposon or retrovirus. RTs are present in a variety of mobile elements, including retrotransposons, retroviruses, group II introns, bacterial msDNAs, hepadnaviruses, and Caulimoviruses.. Length = 177 Score = 27.9 bits (62), Expect = 9.0 Identities = 11/40 (27%), Positives = 13/40 (32%), Gaps = 2/40 (5%) Query: 50 SMPLMQEYRDCRLDPRSNRVFSFSIPDGGYALLV--FGDK 87 + L Y L S +F P G Y FG K Sbjct: 62 KLDLRSGYHQIPLAEESRPKTAFRTPFGLYEYTRMPFGLK 101 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.320 0.136 0.420 Gapped Lambda K H 0.267 0.0730 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 7,120,418 Number of extensions: 374177 Number of successful extensions: 673 Number of sequences better than 10.0: 1 Number of HSP's gapped: 673 Number of HSP's successfully gapped: 5 Length of query: 578 Length of database: 6,263,737 Length adjustment: 99 Effective length of query: 479 Effective length of database: 4,124,446 Effective search space: 1975609634 Effective search space used: 1975609634 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 60 (26.9 bits)