RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254781208|ref|YP_003065621.1| hypothetical protein CLIBASIA_05575 [Candidatus Liberibacter asiaticus str. psy62] (578 letters) >d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 281 Score = 27.4 bits (59), Expect = 3.6 Identities = 16/138 (11%), Positives = 35/138 (25%), Gaps = 1/138 (0%) Query: 296 SKDGRSISVAPQSQTLFQAGVSVVSWFMSAWGEQEGYPSHVTFHNNRLLFSGSKGD-ELS 354 I A + + + + W G + V + + S Sbjct: 139 LGPATHILFADGRRVIGRNTFELPHWKGYRGGTRGKIWIEVNSGAFKKIVDMSTHVSSPV 198 Query: 355 VYLSSFGAFYDFSLDGEYGCYDPTKALTTAVTDFSASTIHWMHPFGEGVLVGCDTSLWLL 414 + D G+ D T F+ ++ G +L S+++ Sbjct: 199 IVGHRIYFITDIDGFGQIYSTDLDGKDLRKHTSFTDYYPRHLNTDGRRILFSKGGSIYIF 258 Query: 415 SISLSKGLSIDFRRVSGS 432 + K I+ + Sbjct: 259 NPDTEKIEKIEIGDLESP 276 >d1uhua_ a.61.1.6 (A:) Product of RIKEN cDNA 3110009e22 {Unclassified, murine endogenous retrovirus [TaxId: 12908]} Length = 105 Score = 26.3 bits (58), Expect = 6.2 Identities = 11/40 (27%), Positives = 15/40 (37%), Gaps = 11/40 (27%) Query: 134 HKDHPPHHLLYIQDGDKISFTFDEIKFLPPPWLGDGMISG 173 H D P YI + ++ PPW+ G SG Sbjct: 77 HPDQQP----YIT-------VWQDLVQNSPPWIKSGPSSG 105 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.320 0.136 0.420 Gapped Lambda K H 0.267 0.0692 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 2,171,947 Number of extensions: 100908 Number of successful extensions: 246 Number of sequences better than 10.0: 1 Number of HSP's gapped: 246 Number of HSP's successfully gapped: 7 Length of query: 578 Length of database: 2,407,596 Length adjustment: 90 Effective length of query: 488 Effective length of database: 1,171,896 Effective search space: 571885248 Effective search space used: 571885248 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 55 (25.0 bits)