BLAST/PSIBLAST alignment of GI: 254781209 and GI: 332160973 at iteration 1
>gi|332160973|ref|YP_004297550.1| hypothetical protein YE105_C1351 [Yersinia enterocolitica subsp. palearctica 105.5R(r)] Length = 186
>gi|325665203|gb|ADZ41847.1| hypothetical protein YE105_C1351 [Yersinia enterocolitica subsp. palearctica 105.5R(r)] Length = 186
>gi|330862129|emb|CBX72293.1| hypothetical protein YEW_AK02300 [Yersinia enterocolitica W22703] Length = 186
 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 46/175 (26%), Positives = 78/175 (44%), Gaps = 14/175 (8%)

Query: 2   TELEICNWALLKLGQRPLENWNERSLKADYCRLLLPPIHKGLLRSFSWSFATQSMDLLPL 61
           +++ IC+ ALL LG  P+ ++ E +  A  C  + P +   LLR   W+ A   + L P 
Sbjct: 3   SDISICSNALLMLGAHPINSFTENTDHARLCSNIYPSVRDDLLRKHPWNCAVSRVSLAPS 62

Query: 62  ----YFTYNGELKYYIPLKCLKVLNTSEET-----QLRGRCIVARGDTPRPLSLKYIGEV 112
                F Y  +  + IP  CL++L+   E      Q+ G+ I+A       ++L+YI   
Sbjct: 63  TSLPVFGYANQ--FPIPSDCLRILSVGAEGYEIPYQVEGKNILANTTV---VALRYIKRT 117

Query: 113 PLSDCDPLYQEAFALKLAGELCPPLIMDDQMRSYLKGESERVLAVAMDMDGVEIP 167
             +  DP       + +A +L   +     +R  +  E+   L  A  +DG E P
Sbjct: 118 DEASWDPALAHVAEMAMAAKLAYAVTSSASLRDSMAQEAAYALRQAKAIDGQEEP 172