RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254781209|ref|YP_003065622.1| hypothetical protein CLIBASIA_05580 [Candidatus Liberibacter asiaticus str. psy62] (175 letters) >gnl|CDD|39965 KOG4768, KOG4768, KOG4768, Mitochondrial mRNA maturase [RNA processing and modification]. Length = 796 Score = 26.9 bits (59), Expect = 3.2 Identities = 13/38 (34%), Positives = 17/38 (44%), Gaps = 1/38 (2%) Query: 15 GQRPLENWNERSLKADYC-RLLLPPIHKGLLRSFSWSF 51 G+RPL N R C R+ L I+ G + S F Sbjct: 302 GERPLSVGNPRDKLVQECMRMGLEIIYGGEFSTVSHGF 339 >gnl|CDD|48363 cd02033, BchX, Chlorophyllide reductase converts chlorophylls into bacteriochlorophylls by reducing the chlorin B-ring. This family contains the X subunit of this three-subunit enzyme. Sequence and structure similarity between bchX, protochlorophyllide reductase L subunit (bchL and chlL) and nitrogenase Fe protein (nifH gene) suggest their functional similarity. Members of the BchX family serve as the unique electron donors to their respective catalytic subunits (bchN-bchB, bchY-bchZ and nitrogenase component 1). Mechanistically, they hydrolyze ATP and transfer electrons through a Fe4-S4 cluster.. Length = 329 Score = 25.8 bits (56), Expect = 6.5 Identities = 17/54 (31%), Positives = 25/54 (46%), Gaps = 2/54 (3%) Query: 111 EVPLSDCDPLYQEAFALKLAGELCPPLIMDDQMRSYLKGESERVLAVAMDMDGV 164 V L CDP + +L G+ CP +I + + L GE ++ V DGV Sbjct: 61 RVLLIGCDP-KSDTTSLLFGGKACPTII-ETSAKKKLAGEEVQIGDVCFKRDGV 112 >gnl|CDD|31871 COG1685, COG1685, Archaeal shikimate kinase [Amino acid transport and metabolism / Coenzyme metabolism]. Length = 278 Score = 26.0 bits (57), Expect = 6.6 Identities = 16/64 (25%), Positives = 26/64 (40%), Gaps = 10/64 (15%) Query: 87 TQLRGRCIVARGDTPRPLSLKYI--GEVPLSDCD--------PLYQEAFALKLAGELCPP 136 T R I+ R D P L + ++ D P+ +EAF L L GE Sbjct: 145 TDNRKMRILRRLDLPELTVLILAPGEKRLSANVDVNRLRLIAPVVEEAFRLALKGEYFKA 204 Query: 137 LIMD 140 ++++ Sbjct: 205 MVLN 208 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.321 0.140 0.437 Gapped Lambda K H 0.267 0.0552 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 2,216,920 Number of extensions: 109698 Number of successful extensions: 218 Number of sequences better than 10.0: 1 Number of HSP's gapped: 218 Number of HSP's successfully gapped: 5 Length of query: 175 Length of database: 6,263,737 Length adjustment: 87 Effective length of query: 88 Effective length of database: 4,383,754 Effective search space: 385770352 Effective search space used: 385770352 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 54 (25.0 bits)