RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254781209|ref|YP_003065622.1| hypothetical protein CLIBASIA_05580 [Candidatus Liberibacter asiaticus str. psy62] (175 letters) >3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3k7t_A* (X:85-193,X:276-360) Length = 194 Score = 26.8 bits (59), Expect = 1.8 Identities = 13/45 (28%), Positives = 23/45 (51%), Gaps = 4/45 (8%) Query: 17 RPLENWNERSLK---ADYC-RLLLPPIHKGLLRSFSWSFATQSMD 57 + LEN + L +Y +L LPP+ + L +++W+ Q D Sbjct: 45 KGLENQDLEDLDIPLNEYVDKLDLPPVSRQFLLAWAWNMLGQPAD 89 >1whm_A Cylindromatosis tumor suppressor CYLD; deubiquitinating enzyme, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} (A:) Length = 92 Score = 25.9 bits (57), Expect = 3.3 Identities = 4/22 (18%), Positives = 10/22 (45%) Query: 92 RCIVARGDTPRPLSLKYIGEVP 113 R + G+T ++ + +P Sbjct: 15 RVSLKVGETIESGTVIFCDVLP 36 >3ecf_A NTF2-like protein; YP_324687.1, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 1.90A {Anabaena variabilis atcc 29413} (A:) Length = 130 Score = 24.9 bits (54), Expect = 5.7 Identities = 11/36 (30%), Positives = 17/36 (47%) Query: 136 PLIMDDQMRSYLKGESERVLAVAMDMDGVEIPEDRG 171 L +++ +LKG + RV V + VE P G Sbjct: 42 TLKGTEEVIPFLKGVTTRVAEVNIXSTTVEYPRASG 77 >1nnl_A L-3-phosphoserine phosphatase; PSP, HPSP, phospho-aspartyl, hydrolase; 1.53A {Homo sapiens} (A:) Length = 225 Score = 24.8 bits (52), Expect = 7.5 Identities = 7/30 (23%), Positives = 11/30 (36%), Gaps = 4/30 (13%) Query: 148 KGESERVL----AVAMDMDGVEIPEDRGYH 173 E ++ AV D+D I E+ Sbjct: 4 HSELRKLFYSADAVCFDVDSTVIREEGIDE 33 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.321 0.140 0.437 Gapped Lambda K H 0.267 0.0604 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 1,374,528 Number of extensions: 57510 Number of successful extensions: 97 Number of sequences better than 10.0: 1 Number of HSP's gapped: 97 Number of HSP's successfully gapped: 4 Length of query: 175 Length of database: 4,956,049 Length adjustment: 83 Effective length of query: 92 Effective length of database: 2,150,234 Effective search space: 197821528 Effective search space used: 197821528 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (23.7 bits)