BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= gi|254781209|ref|YP_003065622.1| hypothetical protein
CLIBASIA_05580 [Candidatus Liberibacter asiaticus str. psy62]
         (175 letters)

Database: las_proteome 
           1233 sequences; 328,796 total letters

Searching...................................................done



>gi|254781209|ref|YP_003065622.1| hypothetical protein CLIBASIA_05580 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 175

 Score =  360 bits (924), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 175/175 (100%), Positives = 175/175 (100%)

Query: 1   MTELEICNWALLKLGQRPLENWNERSLKADYCRLLLPPIHKGLLRSFSWSFATQSMDLLP 60
           MTELEICNWALLKLGQRPLENWNERSLKADYCRLLLPPIHKGLLRSFSWSFATQSMDLLP
Sbjct: 1   MTELEICNWALLKLGQRPLENWNERSLKADYCRLLLPPIHKGLLRSFSWSFATQSMDLLP 60

Query: 61  LYFTYNGELKYYIPLKCLKVLNTSEETQLRGRCIVARGDTPRPLSLKYIGEVPLSDCDPL 120
           LYFTYNGELKYYIPLKCLKVLNTSEETQLRGRCIVARGDTPRPLSLKYIGEVPLSDCDPL
Sbjct: 61  LYFTYNGELKYYIPLKCLKVLNTSEETQLRGRCIVARGDTPRPLSLKYIGEVPLSDCDPL 120

Query: 121 YQEAFALKLAGELCPPLIMDDQMRSYLKGESERVLAVAMDMDGVEIPEDRGYHNG 175
           YQEAFALKLAGELCPPLIMDDQMRSYLKGESERVLAVAMDMDGVEIPEDRGYHNG
Sbjct: 121 YQEAFALKLAGELCPPLIMDDQMRSYLKGESERVLAVAMDMDGVEIPEDRGYHNG 175


>gi|254780947|ref|YP_003065360.1| transcription-repair coupling factor [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 1187

 Score = 25.8 bits (55), Expect = 0.49,   Method: Composition-based stats.
 Identities = 16/62 (25%), Positives = 36/62 (58%), Gaps = 8/62 (12%)

Query: 114 LSDCDPLY----QEAFALKLA---GELCPPLIMDDQMRSYLKGESERVLAVAMDMDGVEI 166
           LSD +  Y     E   LK+A   G++ P   ++D+M ++ +G+ + +L+ ++   G+++
Sbjct: 844 LSDLEKCYTFLQSEVPELKIAMAHGQMSPK-NLEDKMNAFYEGQYDVLLSTSIVESGLDL 902

Query: 167 PE 168
           P+
Sbjct: 903 PK 904


  Database: las_proteome
    Posted date:  Jun 5, 2011  6:30 PM
  Number of letters in database: 328,796
  Number of sequences in database:  1233
  
Lambda     K      H
   0.321    0.140    0.437 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 112,802
Number of Sequences: 1233
Number of extensions: 4202
Number of successful extensions: 8
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 5
Number of HSP's gapped (non-prelim): 3
length of query: 175
length of database: 328,796
effective HSP length: 68
effective length of query: 107
effective length of database: 244,952
effective search space: 26209864
effective search space used: 26209864
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 35 (18.1 bits)