RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254781210|ref|YP_003065623.1| hypothetical protein CLIBASIA_05585 [Candidatus Liberibacter asiaticus str. psy62] (343 letters) >d1vpra1 b.60.1.7 (A:868-1218) Dinoflagellate luciferase {Lingulodinium polyedrum [TaxId: 160621]} Length = 351 Score = 26.4 bits (58), Expect = 3.7 Identities = 11/21 (52%), Positives = 14/21 (66%) Query: 118 EAILKGMLGVNKKGKIGAETE 138 EAI GMLG + KI A+T+ Sbjct: 176 EAIKSGMLGAAEANKIVADTD 196 >d2fdbm1 b.42.1.1 (M:34-180) Fibroblast growth factor 8, FGF8 {Human (Homo sapiens) [TaxId: 9606]} Length = 147 Score = 25.2 bits (55), Expect = 7.4 Identities = 7/34 (20%), Positives = 19/34 (55%) Query: 125 LGVNKKGKIGAETEFFSKENILSAVEGDDFFKTF 158 + +NKKGK+ A++ K+ + + + ++ + Sbjct: 75 ICMNKKGKLIAKSNGKGKDCVFTEIVLENNYTAL 108 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.316 0.133 0.384 Gapped Lambda K H 0.267 0.0684 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 1,240,363 Number of extensions: 56753 Number of successful extensions: 100 Number of sequences better than 10.0: 1 Number of HSP's gapped: 100 Number of HSP's successfully gapped: 4 Length of query: 343 Length of database: 2,407,596 Length adjustment: 86 Effective length of query: 257 Effective length of database: 1,226,816 Effective search space: 315291712 Effective search space used: 315291712 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 53 (24.3 bits)