BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254781211|ref|YP_003065624.1| hypothetical protein
CLIBASIA_05590 [Candidatus Liberibacter asiaticus str. psy62]
         (234 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|254781211|ref|YP_003065624.1| hypothetical protein CLIBASIA_05590 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040888|gb|ACT57684.1| hypothetical protein CLIBASIA_05590 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|317120676|gb|ADV02499.1| hypothetical protein SC1_gp095 [Liberibacter phage SC1]
 gi|317120820|gb|ADV02641.1| hypothetical protein SC1_gp095 [Candidatus Liberibacter asiaticus]
          Length = 234

 Score =  453 bits (1165), Expect = e-125,   Method: Composition-based stats.
 Identities = 234/234 (100%), Positives = 234/234 (100%)

Query: 1   MSDETDQLTPLPSTPPVVECERSQRSNPPPSKEEAVQSDPQGRNPSSSSSSTEEAGEPKP 60
           MSDETDQLTPLPSTPPVVECERSQRSNPPPSKEEAVQSDPQGRNPSSSSSSTEEAGEPKP
Sbjct: 1   MSDETDQLTPLPSTPPVVECERSQRSNPPPSKEEAVQSDPQGRNPSSSSSSTEEAGEPKP 60

Query: 61  PIEDYTLSCPDYVSEAEVTAHIEAFKEAGVDARVAQKVVDKLVDHGRKIGEQFGASLEEE 120
           PIEDYTLSCPDYVSEAEVTAHIEAFKEAGVDARVAQKVVDKLVDHGRKIGEQFGASLEEE
Sbjct: 61  PIEDYTLSCPDYVSEAEVTAHIEAFKEAGVDARVAQKVVDKLVDHGRKIGEQFGASLEEE 120

Query: 121 RKLLQTKLGSDYETREKDIARYFRKEKIPDNDVQSLISAWGFEKTFNFFDRYAQQNKESS 180
           RKLLQTKLGSDYETREKDIARYFRKEKIPDNDVQSLISAWGFEKTFNFFDRYAQQNKESS
Sbjct: 121 RKLLQTKLGSDYETREKDIARYFRKEKIPDNDVQSLISAWGFEKTFNFFDRYAQQNKESS 180

Query: 181 TGDTFVRSEGSQEADRDFDKVFNTPDFGSRVLSGDKEATKTLRQWAEKQATLNQ 234
           TGDTFVRSEGSQEADRDFDKVFNTPDFGSRVLSGDKEATKTLRQWAEKQATLNQ
Sbjct: 181 TGDTFVRSEGSQEADRDFDKVFNTPDFGSRVLSGDKEATKTLRQWAEKQATLNQ 234


>gi|315122898|ref|YP_004063387.1| hypothetical protein CKC_05770 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313496300|gb|ADR52899.1| hypothetical protein CKC_05770 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 234

 Score =  226 bits (577), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 120/230 (52%), Positives = 163/230 (70%), Gaps = 6/230 (2%)

Query: 9   TPLPSTPPVVECERSQRSNPPPSKEEAVQSDPQGRNPSSSSSSTEEAGEPKPPIEDYTLS 68
           TP+ STP   E E  +  N P +KE+ V+S+P  +  S+  +STEEA   +P  EDYTL+
Sbjct: 7   TPV-STPIDTEVESPEVDNTPSTKEQ-VESNPFKKYASTEDTSTEEAEASQPNSEDYTLN 64

Query: 69  CPDYVSEAEVTAHIEAFKEAGVDARVAQKVVDKLVDHG----RKIGEQFGASLEEERKLL 124
           CP+Y+ + EV AH EAFKEAG+DA+ AQKV+D+LV HG    ++  E+   +L E++  L
Sbjct: 65  CPEYIPQEEVKAHSEAFKEAGIDAKTAQKVIDRLVAHGQENEKRSIERLDKALAEDKTAL 124

Query: 125 QTKLGSDYETREKDIARYFRKEKIPDNDVQSLISAWGFEKTFNFFDRYAQQNKESSTGDT 184
           +++ G DY  REKDIARYFR+EKI D DVQ+L+S WGF+KTF FFDRYAQ NKE+S GDT
Sbjct: 125 KSEYGVDYSRREKDIARYFRQEKIADADVQALVSTWGFQKTFKFFDRYAQMNKETSVGDT 184

Query: 185 FVRSEGSQEADRDFDKVFNTPDFGSRVLSGDKEATKTLRQWAEKQATLNQ 234
           F RSEGS+ +  D+DK+FN P+F  +  +GD  A   ++QWA +QA L+Q
Sbjct: 185 FARSEGSRGSQEDYDKLFNNPEFIEKRKAGDTSANNKIKQWANQQALLDQ 234


>gi|317120719|gb|ADV02541.1| hypothetical protein SC2_gp095 [Liberibacter phage SC2]
 gi|317120780|gb|ADV02601.1| hypothetical protein SC2_gp095 [Candidatus Liberibacter asiaticus]
          Length = 246

 Score =  118 bits (296), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 77/228 (33%), Positives = 115/228 (50%), Gaps = 24/228 (10%)

Query: 31  SKEEAVQSDPQGRNPSSSSSSTEEAGEPKPPI-------------------EDYTLSCPD 71
           +K E + +DP  +   S    +E   + KP +                   +DYT+  P 
Sbjct: 19  TKGEEINTDPSVKEMGSKVEVSEAKFDSKPDVSKKASLSDKLFSDEKVDIPKDYTIDFPK 78

Query: 72  YVSEAEVTAHIEAFKEAGVDARVAQKVVDKLV----DHGRKIGEQFGASLEEERKLLQTK 127
            VSEA+    +E+F + G+    AQ + D L     +H +   E+     +E+   L+ +
Sbjct: 79  GVSEADKKQALESFVKNGLSKADAQVLTDSLAKSFQEHIKSQEEKHNRIFDEDILKLKRE 138

Query: 128 LGSD-YETREKDIARYFRKEKIPDNDVQSLISAWGFEKTFNFFDRYAQQNKESSTGDTFV 186
            G + +    K +  + ++  +      + I+  G    F   ++ ++  ++SS      
Sbjct: 139 YGLEGFSQLNKKVKGFVKEVGLSGETFDNFIAVAGAYNAFKLLEKLSRSTRDSSYSPPPP 198

Query: 187 RSEGSQEADRDFDKVFNTPDFGSRVLSGDKEATKTLRQWAEKQATLNQ 234
              GSQEADRDFDKVF+TPDFGSRVLSGD EATKTLRQWAEKQATLNQ
Sbjct: 199 SQRGSQEADRDFDKVFDTPDFGSRVLSGDMEATKTLRQWAEKQATLNQ 246


>gi|315121936|ref|YP_004062425.1| hypothetical protein CKC_00930 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495338|gb|ADR51937.1| hypothetical protein CKC_00930 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 60

 Score = 67.5 bits (163), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 30/59 (50%), Positives = 42/59 (71%)

Query: 176 NKESSTGDTFVRSEGSQEADRDFDKVFNTPDFGSRVLSGDKEATKTLRQWAEKQATLNQ 234
           NKE+S GDTF RSEGS+ +  D+DK+FN P+F  +  +GD  A   ++QWA +QA L+Q
Sbjct: 2   NKETSVGDTFARSEGSRGSQEDYDKLFNNPEFIEKRKAGDTSANNKIKQWANQQALLDQ 60


>gi|222778489|ref|YP_002576126.1| DNA methylase/helicase [Campylobacter lari RM2100]
 gi|222539774|gb|ACM64874.1| DNA methylase/helicase [Campylobacter lari RM2100]
          Length = 1934

 Score = 47.8 bits (112), Expect = 0.001,   Method: Composition-based stats.
 Identities = 35/122 (28%), Positives = 53/122 (43%), Gaps = 9/122 (7%)

Query: 82   IEAFKEAGVDARVAQKVVDKLVDHGRKIGEQFGASLEEERKLLQTKLGSDYETREKDIAR 141
            IE F++AG D R    +     D      E  G  L     LLQ +L SD    E   + 
Sbjct: 1621 IEQFRKAGADVRTLDDITSGAADAAEMKAEATGNPL----ILLQVQLSSDLRQEEMLYSG 1676

Query: 142  YFRKEKIPDNDVQSLISAWGF----EKTFNFFDRYAQQNKESS-TGDTFVRSEGSQEADR 196
            Y R+    +  ++S IS   F     K +N      Q+NK  +  G  F+ +E ++E+ +
Sbjct: 1677 YKRQIHNNEESLRSNISKIEFLEKETKKYNILQDIIQKNKSDNFQGKCFIYNENNEESAK 1736

Query: 197  DF 198
            DF
Sbjct: 1737 DF 1738


>gi|257056994|ref|YP_003134826.1| short chain enoyl-CoA hydratase /3-hydroxyacyl-CoA dehydrogenase
           [Saccharomonospora viridis DSM 43017]
 gi|256586866|gb|ACU97999.1| short chain enoyl-CoA hydratase /3-hydroxyacyl-CoA dehydrogenase
           [Saccharomonospora viridis DSM 43017]
          Length = 728

 Score = 44.0 bits (102), Expect = 0.018,   Method: Composition-based stats.
 Identities = 29/91 (31%), Positives = 46/91 (50%), Gaps = 9/91 (9%)

Query: 34  EAVQSDPQGRNPSSSSSSTEEAGEPKPPIE---DYTLSCPDYVSEAEVTAHIEAFKEAG- 89
           EAV +  +G  P++   +  +AG P PP++   + TL+ P  + E E  A +EA   AG 
Sbjct: 522 EAVAALGEGVEPATIEQAGAQAGYPAPPLQLMDELTLTLPRKIRE-ETKAAVEA---AGG 577

Query: 90  -VDARVAQKVVDKLVDHGRKIGEQFGASLEE 119
                 A  V+D+++D   + G  FGA   E
Sbjct: 578 TWTPHPADAVIDRMIDEFDRKGRSFGAGFYE 608


>gi|312220477|emb|CBY00418.1| predicted protein [Leptosphaeria maculans]
          Length = 141

 Score = 42.8 bits (99), Expect = 0.034,   Method: Composition-based stats.
 Identities = 26/72 (36%), Positives = 34/72 (47%), Gaps = 6/72 (8%)

Query: 9   TPLPSTPPVVECERSQRSNPPPSKEEAVQSDP--QGRNPSSSSSSTEEAG--EPKPPIED 64
           T LP   P + C+R   ++ PP   + + SDP      P+SSSS  E  G  E  P    
Sbjct: 35  TSLPG--PGLACKRRSNTSTPPLCHDCLASDPCATSDQPTSSSSHEEPRGPNEKHPRRRS 92

Query: 65  YTLSCPDYVSEA 76
           Y+ SCP   S A
Sbjct: 93  YSFSCPRKASLA 104


>gi|302529937|ref|ZP_07282279.1| fatty oxidation complex, alpha subunit FadB [Streptomyces sp. AA4]
 gi|302438832|gb|EFL10648.1| fatty oxidation complex, alpha subunit FadB [Streptomyces sp. AA4]
          Length = 735

 Score = 42.8 bits (99), Expect = 0.035,   Method: Composition-based stats.
 Identities = 29/90 (32%), Positives = 45/90 (50%), Gaps = 7/90 (7%)

Query: 34  EAVQSDPQGRNPSSSSSSTEEAGEPKPPIE---DYTLSCPDYVSEAEVTAHIEAFKEAGV 90
           EAV +  +G  P+S   +  +AG P PP++   + TL+ P  +  AE  A IEA  E G 
Sbjct: 529 EAVAALGEGVEPASIEQAGSQAGYPAPPLQLMDELTLTLPRKI-RAETRAAIEA--EGGT 585

Query: 91  -DARVAQKVVDKLVDHGRKIGEQFGASLEE 119
                ++ V+D ++D   + G   GA   E
Sbjct: 586 WTPHASEAVIDTMLDKYDRKGRSTGAGFYE 615


>gi|149576877|ref|XP_001519974.1| PREDICTED: similar to NFI-B protein [Ornithorhynchus anatinus]
          Length = 473

 Score = 42.4 bits (98), Expect = 0.054,   Method: Composition-based stats.
 Identities = 31/123 (25%), Positives = 55/123 (44%), Gaps = 14/123 (11%)

Query: 28  PPPSKEEAVQSDPQGRNPSSSSSSTEEAGEPKPPIEDYTLSCPDYVSE-----AEVTAHI 82
           PPPS   + ++DP G +P +  ++   AGEP+   +   +SCP +  E       +  H+
Sbjct: 49  PPPSPGTSARADPVGVSPDTRDAA-RRAGEPRSGADGPPVSCPLFQDEFHPFIEALLPHV 107

Query: 83  EAFKEAGVDARVAQKVVDKLVDHGRKIGEQFGASLEEERKLLQTKLGSDYETREKDIARY 142
            AF     + +  ++   K   H +++      S EEER +    L    E ++K  +R 
Sbjct: 108 RAFAYTWFNLQARKRKYFK--KHEKRM------SKEEERAVKDELLSEKPEVKQKWASRL 159

Query: 143 FRK 145
             K
Sbjct: 160 LAK 162


>gi|311275070|ref|XP_003134561.1| PREDICTED: hypothetical protein LOC100524409 [Sus scrofa]
          Length = 756

 Score = 42.1 bits (97), Expect = 0.059,   Method: Composition-based stats.
 Identities = 24/60 (40%), Positives = 32/60 (53%), Gaps = 8/60 (13%)

Query: 10  PLPSTPPVVECERSQRS--NPPPSKEEAVQSDPQ----GRNPS--SSSSSTEEAGEPKPP 61
           P PS P +V   R++R+   PPP    A + DP     G +PS  S S + E+ G PKPP
Sbjct: 539 PAPSAPSLVHPTRTRRAPLQPPPGSRAAPRLDPPRCLPGPHPSLPSPSGTDEDRGRPKPP 598


>gi|77555337|gb|ABA98133.1| retrotransposon protein, putative, Ty3-gypsy subclass [Oryza sativa
           Japonica Group]
          Length = 838

 Score = 42.1 bits (97), Expect = 0.072,   Method: Composition-based stats.
 Identities = 30/131 (22%), Positives = 58/131 (44%), Gaps = 3/131 (2%)

Query: 3   DETDQLTPLPSTPPVVECERSQRSNPPPSKEEAVQSDPQGRNPS-SSSSSTEEAGEPKPP 61
           ++T +  P   + P  E + +  S P  +     ++DP  + P+ + S +TE A   +PP
Sbjct: 417 EQTAENQPTAESQPTAESQPTAESQPTGAHASDDKADPSDQPPTGNQSEATETATTQEPP 476

Query: 62  IEDYTLSCPDY-VSEAEVTAHIEAFKEAGVDARVAQKVVDKLVDHGRKIGEQFGASLEEE 120
             + +   PD  + E E         EAG D+ +     ++   H  ++G   G   ++E
Sbjct: 477 TGNQSDVGPDQEIPEVEAQTTTSQGPEAGNDSIIGSPNKEQGSPHA-QLGTSSGPPGDDE 535

Query: 121 RKLLQTKLGSD 131
            ++L+ K   D
Sbjct: 536 EEILRIKAADD 546


>gi|162452351|ref|YP_001614718.1| hypothetical protein sce4075 [Sorangium cellulosum 'So ce 56']
 gi|161162933|emb|CAN94238.1| hypothetical protein predicted by Glimmer/Critica [Sorangium
           cellulosum 'So ce 56']
          Length = 273

 Score = 41.3 bits (95), Expect = 0.11,   Method: Composition-based stats.
 Identities = 39/152 (25%), Positives = 65/152 (42%), Gaps = 18/152 (11%)

Query: 21  ERSQR---SNPPPSKEEA---VQSDPQGRNPSSSSSSTEEAGEPKPPIEDYTLSCPDYVS 74
           ER++R   + P P  + A   V S P GR+ +  +     A   + P+ +  LS      
Sbjct: 42  ERARRGRSAQPGPRAKPAAGPVPSPPGGRSNAGGAREYVCAAPTRSPVLNAFLSELGTEG 101

Query: 75  EAEVTAHIEAFKEAGVDARVA----QKVVDKLVDHGRK-----IGEQFGASLEEERKLLQ 125
           EA V A++  F E  +  R+     Q+VV  L+  GR      + +    + E   +L  
Sbjct: 102 EALVPANVHVFDEHALAPRLVELARQRVVSMLLAVGRTEVALTLAQMPSITNERAARLFM 161

Query: 126 TK---LGSDYETREKDIARYFRKEKIPDNDVQ 154
            +   +G D      D AR++R+   P+ D Q
Sbjct: 162 RQAVHVGGDLGAITGDYARHYRRSGAPERDDQ 193


>gi|221505605|gb|EEE31250.1| conserved hypothetical protein [Toxoplasma gondii VEG]
          Length = 661

 Score = 40.1 bits (92), Expect = 0.23,   Method: Composition-based stats.
 Identities = 24/79 (30%), Positives = 37/79 (46%), Gaps = 6/79 (7%)

Query: 26  SNPPPSKEEAVQSDPQGRNPSSSSSSTEEAGEP------KPPIEDYTLSCPDYVSEAEVT 79
           S+ PP  E++  S P  R PSSS    EE  EP      + P +D  +   + + EA V 
Sbjct: 259 SSKPPGTEDSTDSLPGVRTPSSSPDLPEEGSEPAGSAVIRRPEKDIRVGAGESLIEAMVE 318

Query: 80  AHIEAFKEAGVDARVAQKV 98
             ++  +E  + AR  Q +
Sbjct: 319 QSLKEAEEKALHARRHQGI 337


>gi|221484422|gb|EEE22718.1| conserved hypothetical protein [Toxoplasma gondii GT1]
          Length = 661

 Score = 40.1 bits (92), Expect = 0.23,   Method: Composition-based stats.
 Identities = 24/79 (30%), Positives = 37/79 (46%), Gaps = 6/79 (7%)

Query: 26  SNPPPSKEEAVQSDPQGRNPSSSSSSTEEAGEP------KPPIEDYTLSCPDYVSEAEVT 79
           S+ PP  E++  S P  R PSSS    EE  EP      + P +D  +   + + EA V 
Sbjct: 259 SSKPPGTEDSTDSLPGVRTPSSSPDLPEEGSEPAGSAVIRRPEKDIRVGAGESLIEAMVE 318

Query: 80  AHIEAFKEAGVDARVAQKV 98
             ++  +E  + AR  Q +
Sbjct: 319 QSLKEAEEKALHARRHQGI 337


>gi|301756176|ref|XP_002913962.1| PREDICTED: pituitary homeobox 3-like [Ailuropoda melanoleuca]
          Length = 438

 Score = 40.1 bits (92), Expect = 0.25,   Method: Composition-based stats.
 Identities = 32/152 (21%), Positives = 61/152 (40%), Gaps = 35/152 (23%)

Query: 9   TPLPSTPPVVECERSQRSNPPPSKEEAVQSDPQGRNPSSSSSSTEEAGEPKPPIEDYTLS 68
           TP P   P    E SQ    PPS E  + S+ + R+P+ S S   +AG P PP+ ++   
Sbjct: 118 TPPPKAGP----ENSQLERCPPSMEFGLLSEAEARSPALSLS---DAGTPHPPLPEHGCK 170

Query: 69  CPDYVSEAEVTAHIEAFKEAGVDARVAQKVVDKLVDHGRKIGEQFGASLEEERKLLQTKL 128
             ++    + +A +                           G     SL+++++  +T  
Sbjct: 171 GQEHSDSEKASASLPG-------------------------GSPEDGSLKKKQRRQRTHF 205

Query: 129 GSDYETREKDIARYFRKEKIPDNDVQSLISAW 160
            S    + +++   F++ + PD   +  I+ W
Sbjct: 206 TSQ---QLQELEATFQRNRYPDMSTREEIAVW 234


>gi|239943321|ref|ZP_04695258.1| putative sensor-like histidine kinase [Streptomyces roseosporus
           NRRL 15998]
 gi|239989777|ref|ZP_04710441.1| putative sensor-like histidine kinase [Streptomyces roseosporus
           NRRL 11379]
          Length = 520

 Score = 40.1 bits (92), Expect = 0.26,   Method: Composition-based stats.
 Identities = 20/66 (30%), Positives = 32/66 (48%), Gaps = 3/66 (4%)

Query: 28  PPPSKEEAVQSDPQGRNPSSSSSSTEEAGEPKPPIEDYTLSCPDYVSEAEVTAHIEAFKE 87
           P PS   A  +DP    P++ S +T++A  P  P  +     P+  S +E T  +  F E
Sbjct: 401 PEPSHASAAGTDPSDAAPAARSLATDDASTPLTPAAE---PAPESESVSESTGSVPEFGE 457

Query: 88  AGVDAR 93
           +G+  R
Sbjct: 458 SGLPKR 463


>gi|241888531|ref|ZP_04775839.1| hypothetical protein GEMHA0001_0073 [Gemella haemolysans ATCC
           10379]
 gi|241864798|gb|EER69172.1| hypothetical protein GEMHA0001_0073 [Gemella haemolysans ATCC
           10379]
          Length = 978

 Score = 39.7 bits (91), Expect = 0.29,   Method: Composition-based stats.
 Identities = 34/127 (26%), Positives = 53/127 (41%), Gaps = 6/127 (4%)

Query: 2   SDETDQLTPLPSTPPVVECERSQRSNPPPSKEEAVQSDPQGRNPSSSSSSTEEAGEPKPP 61
           ++E    +P    P     +  + + P P  EE     P+   P++ +   EE   P P 
Sbjct: 429 AEEPAAPSPKAEEPAAPALKVEEPAAPAPKAEEPAAPSPKAEEPAAPALKVEEPAAPAPK 488

Query: 62  IEDYTLSCPDYVSEAEVTAHIEAFKEAGVDARVAQKVVDKLVDHGRKIGEQFGASLEEER 121
            E+ T    D  SE EVT   E  +EA  D +    V++K+     K+ E      E E+
Sbjct: 489 AEEPTAPKEDTPSE-EVTPKDEKLEEAKKDGK---DVIEKIA--ASKLSEIEKVKDEAEK 542

Query: 122 KLLQTKL 128
             L+ KL
Sbjct: 543 AKLEAKL 549


>gi|169619313|ref|XP_001803069.1| hypothetical protein SNOG_12851 [Phaeosphaeria nodorum SN15]
 gi|160703793|gb|EAT79651.2| hypothetical protein SNOG_12851 [Phaeosphaeria nodorum SN15]
          Length = 1581

 Score = 39.7 bits (91), Expect = 0.30,   Method: Composition-based stats.
 Identities = 22/58 (37%), Positives = 32/58 (55%), Gaps = 3/58 (5%)

Query: 23   SQRSNPPPSKEEAVQSDPQGRNPSSSSSSTEEAGEPKPPIEDYTLSCPDYVSEAEVTA 80
            S+R   PPS+EE+VQS P G   S  SSS E+A  P+    D  +   +  S+ E+ +
Sbjct: 1091 SKRIRLPPSREESVQSSPDG---SEGSSSDEDADTPQSIDVDAAIDAANVSSDEEMQS 1145


>gi|291446794|ref|ZP_06586184.1| predicted protein [Streptomyces roseosporus NRRL 15998]
 gi|291349741|gb|EFE76645.1| predicted protein [Streptomyces roseosporus NRRL 15998]
          Length = 598

 Score = 39.7 bits (91), Expect = 0.32,   Method: Composition-based stats.
 Identities = 20/66 (30%), Positives = 32/66 (48%), Gaps = 3/66 (4%)

Query: 28  PPPSKEEAVQSDPQGRNPSSSSSSTEEAGEPKPPIEDYTLSCPDYVSEAEVTAHIEAFKE 87
           P PS   A  +DP    P++ S +T++A  P  P  +     P+  S +E T  +  F E
Sbjct: 479 PEPSHASAAGTDPSDAAPAARSLATDDASTPLTPAAE---PAPESESVSESTGSVPEFGE 535

Query: 88  AGVDAR 93
           +G+  R
Sbjct: 536 SGLPKR 541


>gi|258571311|ref|XP_002544459.1| predicted protein [Uncinocarpus reesii 1704]
 gi|237904729|gb|EEP79130.1| predicted protein [Uncinocarpus reesii 1704]
          Length = 921

 Score = 39.4 bits (90), Expect = 0.38,   Method: Composition-based stats.
 Identities = 30/95 (31%), Positives = 43/95 (45%), Gaps = 20/95 (21%)

Query: 7   QLTPLPSTPPVVECERSQRSNPPPSKEEAVQSDPQGRNPSSSSSSTEEAGEPKPPIEDYT 66
           +L P PS PPV        S+ PPS+E  ++S P  R+ + S        +P+ P+ D T
Sbjct: 700 ELPPRPSDPPV------HTSSKPPSRENTIRSPPSSRHRAKSIQ------QPQKPLVDLT 747

Query: 67  LSCPDYVSEAEVTAHIEAFKEAGVDARVAQKVVDK 101
              P Y    +      A K  GV A+    +VDK
Sbjct: 748 ---PTYQEPPQ-----HARKGRGVAAQPGTLLVDK 774


>gi|320102339|ref|YP_004177930.1| serine/threonine protein kinase [Isosphaera pallida ATCC 43644]
 gi|319749621|gb|ADV61381.1| serine/threonine protein kinase [Isosphaera pallida ATCC 43644]
          Length = 2069

 Score = 39.0 bits (89), Expect = 0.52,   Method: Composition-based stats.
 Identities = 19/60 (31%), Positives = 29/60 (48%), Gaps = 2/60 (3%)

Query: 8   LTPLPSTPPVVECERSQRSNPPPSKEEAVQSDPQGRNPSSSSSSTEEAGEPKPPIEDYTL 67
           LTP PSTP     +     + P + +  + S P  RN  + +S T +   P+PP E  T+
Sbjct: 239 LTPPPSTPDRFFHDSESAGDSPQTPQVPIHSSPPNRN--TPASDTPKGCSPEPPFETSTI 296


>gi|239831712|ref|ZP_04680041.1| Anther-specific proline-rich protein APG [Ochrobactrum intermedium
           LMG 3301]
 gi|239823979|gb|EEQ95547.1| Anther-specific proline-rich protein APG [Ochrobactrum intermedium
           LMG 3301]
          Length = 353

 Score = 39.0 bits (89), Expect = 0.61,   Method: Composition-based stats.
 Identities = 26/100 (26%), Positives = 45/100 (45%), Gaps = 8/100 (8%)

Query: 7   QLTPLPSTPPVVECERSQRSNPPPSKEEAVQSDPQGRNPSSSSSSTEEAGEPKPPIED-- 64
           + TPLP      E +   R  P PS E+  +      NP  +    ++A    P IE+  
Sbjct: 112 EATPLPEENAGTEPQEQPRPAPAPSPEKPARPAEPADNPKQADEKRQDA---MPEIEERI 168

Query: 65  YTLSCPDYVS---EAEVTAHIEAFKEAGVDARVAQKVVDK 101
           Y +SCP  +S   E ++   I+  ++ GV + ++   + K
Sbjct: 169 YQVSCPALISGQVEGKLLPPIKDGEQCGVHSPLSLTAIGK 208


>gi|119964455|ref|YP_947518.1| hypothetical protein AAur_1758 [Arthrobacter aurescens TC1]
 gi|119951314|gb|ABM10225.1| putative protein of unknown function (DUF75) [Arthrobacter
           aurescens TC1]
          Length = 340

 Score = 38.6 bits (88), Expect = 0.72,   Method: Composition-based stats.
 Identities = 36/135 (26%), Positives = 55/135 (40%), Gaps = 6/135 (4%)

Query: 10  PLPSTPPVVECERSQRSNPPPSKEEAVQSDPQGRNPSSSSSSTE-EAGEPKPPIEDYTLS 68
           P+P T PV     +   N P   E      P    P++     E    E +  +  Y + 
Sbjct: 177 PVPHTRPV---GVTVHGNMPDLIEGISSWKPTVDVPAAIGHILELRLTEAERNVAGYVIH 233

Query: 69  CPDYVSEAEVTAHIEAFKEAGVDARVAQKVVDKLVDHGRKIGEQFGASLE--EERKLLQT 126
            P Y+SEAE      A  E    A       D+L + GR++G Q    +E  EE + + T
Sbjct: 234 VPHYLSEAEYPPAAVAGLEYLGAATSLMLPTDRLREAGREVGRQIAEQIEASEEVQAVVT 293

Query: 127 KLGSDYETREKDIAR 141
            L + Y+ + + I R
Sbjct: 294 NLETRYDEKSEGIVR 308


>gi|260797161|ref|XP_002593572.1| hypothetical protein BRAFLDRAFT_88144 [Branchiostoma floridae]
 gi|229278798|gb|EEN49583.1| hypothetical protein BRAFLDRAFT_88144 [Branchiostoma floridae]
          Length = 728

 Score = 38.6 bits (88), Expect = 0.74,   Method: Composition-based stats.
 Identities = 42/162 (25%), Positives = 64/162 (39%), Gaps = 29/162 (17%)

Query: 8   LTPLPSTPPVVECERSQRSN--------PP--PSKEEAVQSDPQGRNPSSSSSSTEEAGE 57
           LT L    P  E    Q +         PP  P K  A ++ P+ + P SSS  T+E+GE
Sbjct: 526 LTRLEKPKPTAEKSLQQHTTNGLLRETIPPRVPGKPLAAKAIPENQIPDSSSKGTDESGE 585

Query: 58  PK----PPIEDYTLSCPDYVSEAEVT-AHIEAFKEAGVDARVAQKVVDKLVDHGRKIGEQ 112
           P       +ED          E ++T  H+    + G     A  VV         +  Q
Sbjct: 586 PGTLGVTGVEDLPPP----PPELQITPKHVAESDDPGTPTSQAASVVTT----DSHLSSQ 637

Query: 113 FGASLEEERKLLQTKLGSDYETREKDIARYFRKEKIPDNDVQ 154
            G ++ EER+++  K   D ++      R    E++   DVQ
Sbjct: 638 VGGTVLEEREVVAKK---DEDSESYHTPRTLTTEEV---DVQ 673


>gi|145482197|ref|XP_001427121.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 gi|124394200|emb|CAK59723.1| unnamed protein product [Paramecium tetraurelia]
          Length = 1734

 Score = 38.6 bits (88), Expect = 0.78,   Method: Composition-based stats.
 Identities = 18/61 (29%), Positives = 26/61 (42%)

Query: 3    DETDQLTPLPSTPPVVECERSQRSNPPPSKEEAVQSDPQGRNPSSSSSSTEEAGEPKPPI 62
            ++  Q  PL   P   E  + Q   P P KE+  Q +P    P       E+  +P+PP 
Sbjct: 1044 EQPKQPEPLKEQPKQPEPPKEQPKQPEPPKEQPKQPEPPKEQPKQPEPPKEQPKQPEPPK 1103

Query: 63   E 63
            E
Sbjct: 1104 E 1104


>gi|288923951|ref|ZP_06418026.1| WD-40 repeat protein [Frankia sp. EUN1f]
 gi|288344712|gb|EFC79166.1| WD-40 repeat protein [Frankia sp. EUN1f]
          Length = 643

 Score = 38.2 bits (87), Expect = 0.81,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 29/77 (37%), Gaps = 3/77 (3%)

Query: 6   DQLTPLPSTPPVVECERSQ---RSNPPPSKEEAVQSDPQGRNPSSSSSSTEEAGEPKPPI 62
           D+  P+P T P  E   S+    S P P  E A  S PQ          T EAG  KP  
Sbjct: 62  DEAVPVPETVPAAEAPESRSEPESEPRPVGEPAAASGPQPVGEPGPVGGTGEAGGRKPVD 121

Query: 63  EDYTLSCPDYVSEAEVT 79
           E      P    +A  T
Sbjct: 122 EPRAAGVPQAGGDAPST 138


>gi|198461726|ref|XP_002135813.1| GA23986 [Drosophila pseudoobscura pseudoobscura]
 gi|198140275|gb|EDY71050.1| GA23986 [Drosophila pseudoobscura pseudoobscura]
          Length = 462

 Score = 38.2 bits (87), Expect = 0.99,   Method: Composition-based stats.
 Identities = 25/68 (36%), Positives = 35/68 (51%), Gaps = 4/68 (5%)

Query: 22  RSQRSNPPPSKEEAVQSDPQGRNPSSSSSSTEEA--GEPKPPIEDYTLSCPDYVSEAEVT 79
           ++ R+    S  + V +DP   NP S+S +T EA  G P  P ED  LS    ++EAE  
Sbjct: 204 QTGRAGGGDSPGKKVPTDPNAPNPKSTSCTTREAEPGNPSHPKEDSDLSLG--LAEAEAG 261

Query: 80  AHIEAFKE 87
             + AF E
Sbjct: 262 GLLTAFDE 269


>gi|115740915|ref|XP_787471.2| PREDICTED: similar to Bsdc1 protein, partial [Strongylocentrotus
           purpuratus]
          Length = 508

 Score = 38.2 bits (87), Expect = 1.0,   Method: Composition-based stats.
 Identities = 40/140 (28%), Positives = 67/140 (47%), Gaps = 9/140 (6%)

Query: 14  TPPVVECERSQRSNPPPSKEEAVQSDPQGRNPSSSSSSTEEAGEPKPPIEDYTL-SCPD- 71
           T PV EC+   + +  PS+ E   +       SS S   E+  EP  PI+ + + S PD 
Sbjct: 335 TDPVPECDSVTKVDQDPSRPEPEPASQTSVLESSPSPVVEKESEPAAPIQTHQVSSTPDE 394

Query: 72  YVSEAEVT-AHIEAFKEAGVDARVAQKVVDKLVDHGRKI---GEQFGASLEEERKLLQTK 127
            + EA  T AH++  +  GV+   ++  VD+L   G  I   G+Q  +  E  + + QT 
Sbjct: 395 SIPEAPSTAAHLQ--RTVGVEEEGSKVKVDELRLEGLTIQTEGKQDDSKAETAKAMEQTS 452

Query: 128 -LGSDYETREKDIARYFRKE 146
            + S+   RE  ++  + K+
Sbjct: 453 PVASEASNRESSLSDDWEKD 472


>gi|327265065|ref|XP_003217329.1| PREDICTED: LOW QUALITY PROTEIN: epsin-3-like [Anolis carolinensis]
          Length = 639

 Score = 38.2 bits (87), Expect = 1.0,   Method: Composition-based stats.
 Identities = 20/59 (33%), Positives = 31/59 (52%), Gaps = 2/59 (3%)

Query: 6   DQLTPLPSTPPVVECERSQRSNPPP-SKEEAVQSDPQGRNPSSSS-SSTEEAGEPKPPI 62
           D   P+PS  P  +   + +++P P    +A  SDP G  P  SS  S++  G+P PP+
Sbjct: 342 DPWAPVPSRDPPSQGTSTNQASPGPWDLPQASASDPWGMKPQPSSVPSSDPWGKPSPPV 400


>gi|115939595|ref|XP_001192532.1| PREDICTED: similar to Bsdc1 protein [Strongylocentrotus purpuratus]
          Length = 512

 Score = 37.8 bits (86), Expect = 1.1,   Method: Composition-based stats.
 Identities = 40/140 (28%), Positives = 67/140 (47%), Gaps = 9/140 (6%)

Query: 14  TPPVVECERSQRSNPPPSKEEAVQSDPQGRNPSSSSSSTEEAGEPKPPIEDYTL-SCPD- 71
           T PV EC+   + +  PS+ E   +       SS S   E+  EP  PI+ + + S PD 
Sbjct: 339 TDPVPECDSVTKVDQDPSRPEPEPASQTSVLESSPSPVVEKESEPAAPIQTHQVSSTPDE 398

Query: 72  YVSEAEVT-AHIEAFKEAGVDARVAQKVVDKLVDHGRKI---GEQFGASLEEERKLLQTK 127
            + EA  T AH++  +  GV+   ++  VD+L   G  I   G+Q  +  E  + + QT 
Sbjct: 399 SIPEAPSTAAHLQ--RTVGVEEEGSKVKVDELRLEGLTIQTEGKQDDSKAETAKAMEQTS 456

Query: 128 -LGSDYETREKDIARYFRKE 146
            + S+   RE  ++  + K+
Sbjct: 457 PVASEASNRESSLSDDWEKD 476


>gi|4927850|gb|AAD33326.1|AF126786_1 mating-type protein beta 1 [Coprinopsis cinerea]
 gi|4927852|gb|AAD33327.1|AF126787_1 mating-type protein beta 1 [Coprinopsis cinerea]
 gi|4927854|gb|AAD33328.1|AF126788_1 mating-type protein beta 1 [Coprinopsis cinerea]
 gi|4927856|gb|AAD33329.1|AF126789_1 mating-type protein beta 1 [Coprinopsis cinerea]
          Length = 643

 Score = 37.8 bits (86), Expect = 1.2,   Method: Composition-based stats.
 Identities = 20/52 (38%), Positives = 26/52 (50%)

Query: 19  ECERSQRSNPPPSKEEAVQSDPQGRNPSSSSSSTEEAGEPKPPIEDYTLSCP 70
           E   +QRS  P SK    + +P+   PS + S  EE  EP P +   TLS P
Sbjct: 329 EATSNQRSKKPRSKPNHREINPEKALPSPAGSIQEELSEPSPVLSPQTLSHP 380


>gi|300868959|ref|ZP_07113563.1| putative Peptidase M23B [Oscillatoria sp. PCC 6506]
 gi|300333026|emb|CBN58755.1| putative Peptidase M23B [Oscillatoria sp. PCC 6506]
          Length = 523

 Score = 37.8 bits (86), Expect = 1.2,   Method: Composition-based stats.
 Identities = 20/62 (32%), Positives = 28/62 (45%), Gaps = 5/62 (8%)

Query: 16  PVVECERSQRSNPPPSKEEAVQSDPQGRNPSSSSSSTEEAGEPKPPIEDYTLSCPDYVSE 75
           P VE    + S  PPS  E    +P+   P  S+++ E A EP     +Y    P+Y  E
Sbjct: 63  PQVEIAAPEASEAPPSLPEPAAVEPETYAPEPSAAAPEYAPEP-----EYIPETPEYAPE 117

Query: 76  AE 77
            E
Sbjct: 118 PE 119


>gi|167924173|ref|ZP_02511264.1| invertase/recombinase protein [Burkholderia pseudomallei BCC215]
          Length = 279

 Score = 37.4 bits (85), Expect = 1.6,   Method: Composition-based stats.
 Identities = 23/66 (34%), Positives = 34/66 (51%), Gaps = 3/66 (4%)

Query: 82  IEAFKEAGVDARVAQKVVDKLVDHGRKIGEQFGASLEEERKLLQTK---LGSDYETREKD 138
           +E F+ AGV  R  Q+ VD     GR +   FGA  E ER L++ +   LGS    +  +
Sbjct: 63  VERFEAAGVGLRSLQESVDTASIGGRLVFHLFGALAEFERNLIRAERLPLGSSRSAKSVN 122

Query: 139 IARYFR 144
           +  +FR
Sbjct: 123 MLCHFR 128


>gi|76818748|ref|YP_336347.1| invertase/recombinase protein [Burkholderia pseudomallei 1710b]
 gi|167744016|ref|ZP_02416790.1| invertase/recombinase protein [Burkholderia pseudomallei 14]
 gi|167821211|ref|ZP_02452891.1| invertase/recombinase protein [Burkholderia pseudomallei 91]
 gi|167851038|ref|ZP_02476546.1| invertase/recombinase protein [Burkholderia pseudomallei B7210]
 gi|167916321|ref|ZP_02503412.1| invertase/recombinase protein [Burkholderia pseudomallei 112]
 gi|76583221|gb|ABA52695.1| invertase/recombinase protein [Burkholderia pseudomallei 1710b]
          Length = 198

 Score = 37.4 bits (85), Expect = 1.6,   Method: Composition-based stats.
 Identities = 23/66 (34%), Positives = 34/66 (51%), Gaps = 3/66 (4%)

Query: 82  IEAFKEAGVDARVAQKVVDKLVDHGRKIGEQFGASLEEERKLLQTK---LGSDYETREKD 138
           +E F+ AGV  R  Q+ VD     GR +   FGA  E ER L++ +   LGS    +  +
Sbjct: 63  VERFEAAGVGLRSLQESVDTASIGGRLVFHLFGALAEFERNLIRAERLPLGSSRSAKSVN 122

Query: 139 IARYFR 144
           +  +FR
Sbjct: 123 MLCHFR 128


>gi|195447896|ref|XP_002071419.1| GK25143 [Drosophila willistoni]
 gi|194167504|gb|EDW82405.1| GK25143 [Drosophila willistoni]
          Length = 382

 Score = 37.1 bits (84), Expect = 1.9,   Method: Composition-based stats.
 Identities = 27/89 (30%), Positives = 37/89 (41%), Gaps = 19/89 (21%)

Query: 3   DETDQLTPLPSTPPVV---------ECERSQRSNPPPSKEEAVQSDPQGRNPSSSSSSTE 53
           + T    P P  PPVV         E +  Q  NP P  E+   ++PQ      S +  E
Sbjct: 265 ETTPSAEPTPEFPPVVADSAPIPVNEAKTEQSPNPEPQVEQTPVAEPQ------SEAKPE 318

Query: 54  EAGEPKPPIEDYTLSCPDYVSEAEVTAHI 82
            A  P P       S P+ VSEA+ +A +
Sbjct: 319 AASLPNPS----PTSAPEQVSEAQTSAEL 343


>gi|195392750|ref|XP_002055017.1| GJ19027 [Drosophila virilis]
 gi|194149527|gb|EDW65218.1| GJ19027 [Drosophila virilis]
          Length = 498

 Score = 37.1 bits (84), Expect = 2.3,   Method: Composition-based stats.
 Identities = 21/97 (21%), Positives = 42/97 (43%), Gaps = 15/97 (15%)

Query: 2   SDETDQLTPLPSTPPVVECERSQRSNPPPSKEEAVQSDPQGRNPSSSSSSTEEAGEPKPP 61
           S ET + T  P +PP         S P P    +V+    G + ++S ++  ++GEP   
Sbjct: 370 STETKEATQPPQSPPTA-------SGPVPVLPSSVEDKENGESTNTSQTAVPDSGEPSST 422

Query: 62  IEDYTLSCPDYVSEAEVTAHIEAFKEAGVDARVAQKV 98
           ++ + +         EV +++E +     D    Q++
Sbjct: 423 VQTWNVD--------EVVSYVEKYYPREADVFKTQEI 451


>gi|308507413|ref|XP_003115890.1| hypothetical protein CRE_18494 [Caenorhabditis remanei]
 gi|308256425|gb|EFP00378.1| hypothetical protein CRE_18494 [Caenorhabditis remanei]
          Length = 1011

 Score = 36.7 bits (83), Expect = 2.5,   Method: Composition-based stats.
 Identities = 25/93 (26%), Positives = 44/93 (47%), Gaps = 7/93 (7%)

Query: 43  RNPSSSSSSTEEAGEPKPPIEDYTLSCPDY---VSEAEVTAHIEAFKEAGVDARV---AQ 96
           + P+SS+ S  EA  P P   + T S P     +   E+   +E  ++A ++  V   ++
Sbjct: 579 KTPTSSTKSEPEATTPSPTTSESTPSSPQTTRRILSEEIEKSVENLEKA-IEESVKNGSE 637

Query: 97  KVVDKLVDHGRKIGEQFGASLEEERKLLQTKLG 129
           K+ +K  +   +I  +    LEE  K LQ  +G
Sbjct: 638 KMNNKTAEAVEQIDRELEKRLEEAAKQLQDSVG 670


>gi|254410741|ref|ZP_05024519.1| transporter, MscS family [Microcoleus chthonoplastes PCC 7420]
 gi|196182096|gb|EDX77082.1| transporter, MscS family [Microcoleus chthonoplastes PCC 7420]
          Length = 736

 Score = 36.7 bits (83), Expect = 2.5,   Method: Composition-based stats.
 Identities = 25/73 (34%), Positives = 38/73 (52%), Gaps = 3/73 (4%)

Query: 27  NP--PPSKEEAVQSDPQGRNPSSSSSSTEEAGEPKPPIEDYTLSCPDYVSEAEVTAHIEA 84
           NP  P  +E A + +    N   +  +TEEA E K  IE+   S    + +AE T  +EA
Sbjct: 150 NPGSPEYEEAAKKVEAAKENLKVAQDATEEAAETKQKIEEDETS-SSALKKAEETGELEA 208

Query: 85  FKEAGVDARVAQK 97
            K+A  DA+ A++
Sbjct: 209 AKQAVEDAKKARE 221


>gi|198477593|ref|XP_002136537.1| GA28671 [Drosophila pseudoobscura pseudoobscura]
 gi|198142824|gb|EDY71537.1| GA28671 [Drosophila pseudoobscura pseudoobscura]
          Length = 397

 Score = 36.7 bits (83), Expect = 2.7,   Method: Composition-based stats.
 Identities = 23/54 (42%), Positives = 29/54 (53%), Gaps = 4/54 (7%)

Query: 36  VQSDPQGRNPSSSSSSTE--EAGEPKPPIEDYTLSCPDYVSEAEVTAHIEAFKE 87
           V +DP   NP S+S +T   EAG P  P ED  LS    ++EAE    + AF E
Sbjct: 266 VPTDPNAPNPKSTSCTTREAEAGNPSHPKEDSDLSLG--LAEAEAGGLLTAFDE 317


>gi|52076821|dbj|BAD45764.1| hypothetical protein [Oryza sativa Japonica Group]
          Length = 297

 Score = 36.3 bits (82), Expect = 3.3,   Method: Composition-based stats.
 Identities = 23/85 (27%), Positives = 34/85 (40%), Gaps = 9/85 (10%)

Query: 2  SDETDQLTPLPSTPPVVECERSQRSNPPPSKEEAVQS---------DPQGRNPSSSSSST 52
          +D   ++   PS PPVV   R      PP  E  V S          P+G  P  +S   
Sbjct: 12 TDRPPRIPVSPSRPPVVASPRDSPIASPPRPEPPVASPLGPEPPVASPRGPEPPVASPPV 71

Query: 53 EEAGEPKPPIEDYTLSCPDYVSEAE 77
           E     PP+ +  ++ P  + +AE
Sbjct: 72 PEPPVTSPPVPEPPVASPQTLKDAE 96


>gi|322710899|gb|EFZ02473.1| hypothetical protein MAA_02055 [Metarhizium anisopliae ARSEF 23]
          Length = 905

 Score = 36.3 bits (82), Expect = 3.5,   Method: Composition-based stats.
 Identities = 20/46 (43%), Positives = 26/46 (56%), Gaps = 1/46 (2%)

Query: 15  PPVVECERSQRSNPPPSKEEAVQSDPQGRNPSSSSSSTEEAGEPKP 60
           PP+ EC     S+P PS+E A QS   G+  S S+S+T  A  P P
Sbjct: 413 PPLEECRPKMVSDPKPSEERASQSTKLGKRRSVSASNTYVA-RPSP 457


>gi|322501455|emb|CBZ36534.1| unnamed protein product [Leishmania donovani BPK282A1]
          Length = 1027

 Score = 36.3 bits (82), Expect = 3.9,   Method: Composition-based stats.
 Identities = 28/107 (26%), Positives = 45/107 (42%), Gaps = 11/107 (10%)

Query: 8   LTPLPSTPPVVECERSQRSNPPPSKEEAVQSDPQGRNPSSSS------SSTEEAGEPKPP 61
            TPL S P   +   +  SN  PS  +  ++  +G      S      ++T++AGE KPP
Sbjct: 302 FTPLQSAPRSHQTATAIHSNHTPSAADVERAGERGAKSGGRSVNEGIPAATKKAGEKKPP 361

Query: 62  IEDYTLSCPDYVSEAEVTAHIEAFKEAGVDARVAQKVVDKLVDHGRK 108
           ++      P   SE+ +T  +    EAG    + +      VD   K
Sbjct: 362 VQQ-----PLDTSESSITTSVSTAFEAGGSYSLVESPRTSTVDEAAK 403


>gi|115896102|ref|XP_796572.2| PREDICTED: similar to Hyperparathyroidism 2 (with jaw tumor),
           partial [Strongylocentrotus purpuratus]
          Length = 371

 Score = 35.9 bits (81), Expect = 4.1,   Method: Composition-based stats.
 Identities = 39/139 (28%), Positives = 65/139 (46%), Gaps = 7/139 (5%)

Query: 14  TPPVVECERSQRSNPPPSKEEAVQSDPQGRNPSSSSSSTEEAGEPKPPIEDYTL-SCPD- 71
           T PV EC+   + +  PS+ E   +       SS S   E+  EP  PI+ + + S PD 
Sbjct: 198 TDPVPECDSVTKVDQDPSRPEPEPASQTSVLESSPSPVVEKESEPAAPIQTHQVSSTPDE 257

Query: 72  YVSEAEVTAHIEAFKEAGVDARVAQKVVDKLVDHGRKI---GEQFGASLEEERKLLQTK- 127
            + EA  TA  +  +  GV+   ++  VD+L   G  I   G+Q  +  E  + + QT  
Sbjct: 258 SIPEAPSTA-ADLQRTVGVEEEGSKVKVDELRLEGLTIQTEGKQDDSKAETAKAMEQTSP 316

Query: 128 LGSDYETREKDIARYFRKE 146
           + S+   RE  ++  + K+
Sbjct: 317 VASEASNRESSLSDDWEKD 335


>gi|146094928|ref|XP_001467425.1| hypothetical protein [Leishmania infantum JPCM5]
 gi|134071790|emb|CAM70483.1| conserved hypothetical protein [Leishmania infantum JPCM5]
          Length = 1027

 Score = 35.9 bits (81), Expect = 4.3,   Method: Composition-based stats.
 Identities = 28/107 (26%), Positives = 44/107 (41%), Gaps = 11/107 (10%)

Query: 8   LTPLPSTPPVVECERSQRSNPPPSKEEAVQSDPQGRNPSSSS------SSTEEAGEPKPP 61
            TPL S P   +   +  SN  PS  +   +  +G      S      ++T++AGE KPP
Sbjct: 302 FTPLQSAPRSHQTATAIHSNHTPSAADVEHAGERGAKSGGRSVNEGILAATKKAGEKKPP 361

Query: 62  IEDYTLSCPDYVSEAEVTAHIEAFKEAGVDARVAQKVVDKLVDHGRK 108
           ++      P   SE+ +T  +    EAG    + +      VD   K
Sbjct: 362 VQQ-----PLDTSESSITTSVSTAFEAGGSYSLVESPRTSTVDEAAK 403


>gi|308182528|ref|YP_003926655.1| cell division protein [Helicobacter pylori PeCan4]
 gi|308064713|gb|ADO06605.1| cell division protein [Helicobacter pylori PeCan4]
          Length = 863

 Score = 35.9 bits (81), Expect = 4.5,   Method: Composition-based stats.
 Identities = 15/40 (37%), Positives = 26/40 (65%), Gaps = 4/40 (10%)

Query: 9   TP-LPSTPPVVECE---RSQRSNPPPSKEEAVQSDPQGRN 44
           TP +P++ P++E +    +Q++  PP KEE+ Q +PQ  N
Sbjct: 300 TPIMPASAPIIENDNKTENQKTPNPPKKEESPQENPQKEN 339


>gi|256394397|ref|YP_003115961.1| 3-hydroxyacyl-CoA dehydrogenase NAD-binding [Catenulispora
           acidiphila DSM 44928]
 gi|256360623|gb|ACU74120.1| 3-hydroxyacyl-CoA dehydrogenase NAD-binding [Catenulispora
           acidiphila DSM 44928]
          Length = 717

 Score = 35.9 bits (81), Expect = 4.9,   Method: Composition-based stats.
 Identities = 21/75 (28%), Positives = 39/75 (52%), Gaps = 8/75 (10%)

Query: 33  EEAVQSDPQGRNPSSSSSSTEEAGEPKPPIE---DYTLSCPDYVSEAEVTAHIEAFKEAG 89
           +EAV    +G +P+S   +  +AG P PP++   + TL+ P  + +    A    + E G
Sbjct: 515 DEAVAMVNEGLSPASIEQAGSQAGYPAPPLQLMDELTLTLPQKIRKEARAAAGADWTEHG 574

Query: 90  VDARVAQKVVDKLVD 104
            +A     V++++VD
Sbjct: 575 SEA-----VINRMVD 584


>gi|78191739|gb|ABB30032.1| glycoprotein precursor [Crimean-Congo hemorrhagic fever virus]
          Length = 1687

 Score = 35.5 bits (80), Expect = 6.2,   Method: Composition-based stats.
 Identities = 16/41 (39%), Positives = 22/41 (53%)

Query: 21 ERSQRSNPPPSKEEAVQSDPQGRNPSSSSSSTEEAGEPKPP 61
          E SQ  + P S    + SDP    PS+S+S  E +G+  PP
Sbjct: 44 EGSQGPSLPVSTASPIMSDPSITTPSASTSGLEGSGDTTPP 84


>gi|312218962|emb|CBX98907.1| hypothetical protein [Leptosphaeria maculans]
          Length = 217

 Score = 35.1 bits (79), Expect = 8.3,   Method: Composition-based stats.
 Identities = 32/109 (29%), Positives = 47/109 (43%), Gaps = 9/109 (8%)

Query: 1   MSDETDQLTPLPST----PPVVECERSQRSNPPPSKEEAVQSDPQGRNPSSSSSSTEEAG 56
           MSD+ +Q   LPST     P  E  + Q+    P    A    PQ  NP  ++ S+  +G
Sbjct: 1   MSDQQNQGASLPSTQSGGAPGYEGNQGQQQQHMPPPPLAPVIIPQNNNPIPTAISSPMSG 60

Query: 57  EPKPPIEDYTLSCPDYV-SEAEVTAHIEAFKEAGVDARVAQKVVDKLVD 104
            P  P    T   P YV   A    +  A    G+D RV + V+ ++ +
Sbjct: 61  NPMSP----TSGQPGYVPRRAAPEPNKRALYVGGLDPRVTEDVLRQIFE 105


>gi|156546387|ref|XP_001606911.1| PREDICTED: hypothetical protein [Nasonia vitripennis]
          Length = 2318

 Score = 35.1 bits (79), Expect = 8.6,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 25/56 (44%), Gaps = 2/56 (3%)

Query: 10  PLPSTPPVVECE--RSQRSNPPPSKEEAVQSDPQGRNPSSSSSSTEEAGEPKPPIE 63
           P PS  P  + E     +S P PS E A  S+P     S    S E   EP+P +E
Sbjct: 650 PEPSAEPASDSEPVSEPKSEPEPSAEPASDSEPVSEPKSEPEPSAEPKSEPEPALE 705


>gi|198460493|ref|XP_002138841.1| GA25025 [Drosophila pseudoobscura pseudoobscura]
 gi|198137034|gb|EDY69399.1| GA25025 [Drosophila pseudoobscura pseudoobscura]
          Length = 1334

 Score = 35.1 bits (79), Expect = 8.8,   Method: Composition-based stats.
 Identities = 49/208 (23%), Positives = 83/208 (39%), Gaps = 24/208 (11%)

Query: 16  PVVECERSQRSNPPPSKEEAVQSDPQGRNPSSSSSSTEEAGEPKPPIEDYTLSCPDYVSE 75
           P  +C++ + SNP   KE    ++ +G+   +  SS     E K   ED   S  +  S 
Sbjct: 113 PADDCDKEKESNPVVEKENTADTEEEGKKAGAGESSVTRKSE-KTEAED---SAKEIESS 168

Query: 76  AEVTAHIEAFKEAGVDARVAQKVVDKLVDHGRKIGEQFGASLEEERKLLQTKLGSDYETR 135
            +    IE  K +       +KVVD   D       + G  ++EE     + +    E  
Sbjct: 169 VKAKEDIEEPKHSAEAESYVEKVVDNKED------SETGEEIKEE----ASHVKKPGEKT 218

Query: 136 EKDIARYFRKEKIPDNDVQSLISAWGFEKTFNFFDRYAQQN-KESSTGDTFVRSEGSQEA 194
             D +    KEK+  +     + A     + + FD  + Q+ K+S T D        + A
Sbjct: 219 NGDSSAAEIKEKLSQSTDDIFLDALDNITSSDDFDATSSQDLKKSQTSD-------EKTA 271

Query: 195 DRDFDKVFN--TPDFGSRVLSGDKEATK 220
           +   DKV +  +P +    +S D+E  K
Sbjct: 272 ETSEDKVISRESPTYALDDISSDEEILK 299


  Database: nr
    Posted date:  May 22, 2011 12:22 AM
  Number of letters in database: 999,999,966
  Number of sequences in database:  2,987,313
  
  Database: /data/usr2/db/fasta/nr.01
    Posted date:  May 22, 2011 12:30 AM
  Number of letters in database: 999,999,796
  Number of sequences in database:  2,903,041
  
  Database: /data/usr2/db/fasta/nr.02
    Posted date:  May 22, 2011 12:36 AM
  Number of letters in database: 999,999,281
  Number of sequences in database:  2,904,016
  
  Database: /data/usr2/db/fasta/nr.03
    Posted date:  May 22, 2011 12:41 AM
  Number of letters in database: 999,999,960
  Number of sequences in database:  2,935,328
  
  Database: /data/usr2/db/fasta/nr.04
    Posted date:  May 22, 2011 12:46 AM
  Number of letters in database: 842,794,627
  Number of sequences in database:  2,394,679
  
Lambda     K      H
   0.308    0.126    0.355 

Lambda     K      H
   0.267   0.0397    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,051,042,762
Number of Sequences: 14124377
Number of extensions: 78875164
Number of successful extensions: 364758
Number of sequences better than 10.0: 238
Number of HSP's better than 10.0 without gapping: 54
Number of HSP's successfully gapped in prelim test: 184
Number of HSP's that attempted gapping in prelim test: 363153
Number of HSP's gapped (non-prelim): 1424
length of query: 234
length of database: 4,842,793,630
effective HSP length: 135
effective length of query: 99
effective length of database: 2,936,002,735
effective search space: 290664270765
effective search space used: 290664270765
T: 11
A: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 79 (35.1 bits)