RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254781211|ref|YP_003065624.1| hypothetical protein CLIBASIA_05590 [Candidatus Liberibacter asiaticus str. psy62] (234 letters) >gnl|CDD|147324 pfam05088, Bac_GDH, Bacterial NAD-glutamate dehydrogenase. This family consists of several bacterial proteins which are closely related to NAD-glutamate dehydrogenase found in Streptomyces clavuligerus. Glutamate dehydrogenases (GDHs) are a broadly distributed group of enzymes that catalyse the reversible oxidative deamination of glutamate to ketoglutarate and ammonia. Length = 1526 Score = 32.1 bits (74), Expect = 0.14 Identities = 12/60 (20%), Positives = 21/60 (35%), Gaps = 3/60 (5%) Query: 43 RNPSSSSSSTEEAGEPKPPIEDYTLSCPDYVSE---AEVTAHIEAFKEAGVDARVAQKVV 99 RN E +P + P+ + + +A EAGV +A++V Sbjct: 1336 RNRRQPLDIAAEIERFRPGVAALRPQLPELLPGEEREALEERAQALVEAGVPEALARRVA 1395 >gnl|CDD|34937 COG5373, COG5373, Predicted membrane protein [Function unknown]. Length = 931 Score = 32.3 bits (73), Expect = 0.14 Identities = 11/52 (21%), Positives = 16/52 (30%) Query: 12 PSTPPVVECERSQRSNPPPSKEEAVQSDPQGRNPSSSSSSTEEAGEPKPPIE 63 P E S PP A + + S+ + A P P+E Sbjct: 63 APLPAAAESIASPEVPPPVPPAPAQEGEAPAAEQPSAVPAPSAAPAPAEPVE 114 >gnl|CDD|38826 KOG3620, KOG3620, KOG3620, Uncharacterized conserved protein [Function unknown]. Length = 1626 Score = 30.1 bits (67), Expect = 0.62 Identities = 10/62 (16%), Positives = 18/62 (29%), Gaps = 8/62 (12%) Query: 10 PLPSTPPVVECERSQRSNPPPSK--------EEAVQSDPQGRNPSSSSSSTEEAGEPKPP 61 +P P + Q+ P E+ V + G S +S E + Sbjct: 1202 VVPEPPSKNKGSPPQQEVKSPKPKKKGNKKPEQRVLKEQNGSADKMSKTSIPPGREEERE 1261 Query: 62 IE 63 + Sbjct: 1262 RK 1263 >gnl|CDD|34842 COG5245, DYN1, Dynein, heavy chain [Cytoskeleton]. Length = 3164 Score = 30.0 bits (67), Expect = 0.64 Identities = 28/114 (24%), Positives = 42/114 (36%), Gaps = 15/114 (13%) Query: 101 KLVDHGRKIGEQF-GASLE---EERKLLQTKLGSDYETREKDIARYFR-----KEKIPDN 151 D ++ E+ AS+E + + L +Y + +++ R R E D Sbjct: 1663 LCFDEFNRLSEETMSASVELYLSSKDKTKFFLQMNYGYKPRELTRSLRAIFGYAETRIDT 1722 Query: 152 DVQSLISAWGFEKTFNFFDRYAQQNKESSTG-----DTFVRSEGSQEADRDFDK 200 SLI W E DR QQ KESST D +R+ A + Sbjct: 1723 PDVSLIIDWYCEAIREKIDRLVQQ-KESSTSRQDLYDFGLRAIREMIAGHIGEA 1775 >gnl|CDD|111727 pfam02873, MurB_C, UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal domain. Members of this family are UDP-N-acetylenolpyruvoylglucosamine reductase enzymes EC:1.1.1.158. This enzyme is involved in the biosynthesis of peptidoglycan. Length = 103 Score = 27.6 bits (62), Expect = 2.7 Identities = 14/31 (45%), Positives = 20/31 (64%), Gaps = 2/31 (6%) Query: 95 AQKVVDKLVDHGR-KIGEQFGASLEEERKLL 124 A+ VVD L+ H R + E+FG LE E K++ Sbjct: 73 AEDVVD-LIRHVRQTVFEKFGIWLEPEVKII 102 >gnl|CDD|143456 cd07138, ALDH_CddD_SSP0762, Rhodococcus ruber 6-oxolauric acid dehydrogenase-like. The 6-oxolauric acid dehydrogenase (CddD) from Rhodococcus ruber SC1 which converts 6-oxolauric acid to dodecanedioic acid, and the aldehyde dehydrogenase (locus SSP0762) from Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305 and other similar sequences, are included in this CD. Length = 466 Score = 27.5 bits (62), Expect = 3.3 Identities = 14/48 (29%), Positives = 23/48 (47%) Query: 99 VDKLVDHGRKIGEQFGASLEEERKLLQTKLGSDYETREKDIARYFRKE 146 VD+ V R+ + A+ EER L ++ YE R ++A+ E Sbjct: 38 VDRAVAAARRAFPAWSATSVEERAALLERIAEAYEARADELAQAITLE 85 >gnl|CDD|147126 pfam04812, HNF-1B_C, Hepatocyte nuclear factor 1 (HNF-1), beta isoform C terminus. This family consists of a region found within the alpha isoform and at the C terminus of the beta isoform of the homeobox-containing transcription factor of HNF-1. Different isoforms of HNF-1 are generated by the differential use of polyadenylation sites and by alternative splicing. The C-terminal region of HNF-1 is responsible for the activation of transcription. Mutations and polymorphisms in HNF-1 cause the type 3 form of maturity-onset diabetes of the young (MODY3). Length = 233 Score = 27.6 bits (61), Expect = 3.5 Identities = 14/42 (33%), Positives = 18/42 (42%) Query: 10 PLPSTPPVVECERSQRSNPPPSKEEAVQSDPQGRNPSSSSSS 51 ST P + S PPSK V+ QG +SSS+ Sbjct: 10 SAASTNPTLSHHSHSPSPGPPSKLHGVRYSQQGSCEVTSSST 51 >gnl|CDD|39814 KOG4614, KOG4614, KOG4614, Inner membrane protein required for assembly of the F0 sector of ATP synthase [Posttranslational modification, protein turnover, chaperones]. Length = 287 Score = 27.4 bits (60), Expect = 3.9 Identities = 11/33 (33%), Positives = 17/33 (51%) Query: 118 EEERKLLQTKLGSDYETREKDIARYFRKEKIPD 150 E+ER L ++ Y R K++ K +IPD Sbjct: 61 EDERARLNDEMTRGYFARMKELKEEGGKSQIPD 93 >gnl|CDD|144035 pfam00296, Bac_luciferase, Luciferase-like monooxygenase. Length = 250 Score = 27.3 bits (61), Expect = 4.2 Identities = 12/42 (28%), Positives = 17/42 (40%), Gaps = 4/42 (9%) Query: 53 EEAGEPKPPIEDYTLSCPDYV---SEAEVTAHIEAFKEAGVD 91 AG + S P V + +V + A+ EAGVD Sbjct: 209 AAAGRDPADV-RVVASLPVIVAVGTPEQVAERLRAYAEAGVD 249 >gnl|CDD|114305 pfam05575, V_cholerae_RfbT, Vibrio cholerae RfbT protein. This family consists of several RfbT proteins from Vibrio cholerae. It has been found that genetic alteration of the rfbT gene is responsible for serotype conversion of Vibrio cholerae O1 and determines the difference between the Ogawa and Inaba serotypes, in that the presence of rfbT is sufficient for Inaba-to-Ogawa serotype conversion. Length = 286 Score = 26.6 bits (58), Expect = 5.6 Identities = 37/157 (23%), Positives = 68/157 (43%), Gaps = 20/157 (12%) Query: 72 YVSEAEVTAHIEAFKEAGVDARVAQKVVDKLVDH---GRKIGEQFGASLEEERKLLQTKL 128 ++++ ++ A IE E R+ ++ + LV+ G IGE G ++ E + ++ Sbjct: 100 HITQGKIIA-IEPLTEMENSIRMNVQLNNPLVEFHHFGCAIGENEGENIFEVYEF-DNRV 157 Query: 129 GSDYETREKDIARYFRKEKI-----------PDNDVQSLISAWGFE-KTFNFFDRYAQQN 176 S Y + DIA + ++ P N V I A G E + N + +++ Sbjct: 158 SSLYFKKNTDIADKVKNSQVLVRKLSSLDISPTNSVVIKIDAEGAEIEILNQIYEFTEKH 217 Query: 177 KESSTGDTFVRSEGS-QEADRDFDKVFN--TPDFGSR 210 F + G Q ++R FD++FN FGS+ Sbjct: 218 NGIEYYICFEFAMGHIQRSNRTFDEIFNIINSKFGSK 254 >gnl|CDD|145079 pfam01735, PLA2_B, Lysophospholipase catalytic domain. This family consists of Lysophospholipase / phospholipase B EC:3.1.1.5 and cytosolic phospholipase A2 EC:3.1.4 which also has a C2 domain pfam00168. Phospholipase B enzymes catalyse the release of fatty acids from lysophsopholipids and are capable in vitro of hydrolysing all phospholipids extractable form yeast cells. Cytosolic phospholipase A2 associates with natural membranes in response to physiological increases in Ca2+ and selectively hydrolyses arachidonyl phospholipids, the aligned region corresponds the the carboxy-terminal Ca2+-independent catalytic domain of the protein as discussed in. Length = 490 Score = 26.5 bits (59), Expect = 5.9 Identities = 18/88 (20%), Positives = 30/88 (34%), Gaps = 8/88 (9%) Query: 123 LLQTKLGSDYETREKDIARYFRKEKIPDNDVQSLISAWGFEKTFNFFDRYAQQNKESSTG 182 LL S + + ++F K+ D+D S F+ + Q +S T Sbjct: 239 LLVINSTSSLPSFLNILIKHFLKDLSEDSDDISQYPPNPFQDANDINQNATQSIVDSDTL 298 Query: 183 DTFVRSEGSQ--------EADRDFDKVF 202 E Q + +RD D +F Sbjct: 299 FLVDGGEDGQNIPLWPLLQPERDVDVIF 326 >gnl|CDD|37018 KOG1807, KOG1807, KOG1807, Helicases [Replication, recombination and repair]. Length = 1025 Score = 26.1 bits (57), Expect = 7.5 Identities = 25/125 (20%), Positives = 45/125 (36%), Gaps = 6/125 (4%) Query: 18 VECERSQRSNPPPSKEEAVQSDPQGRNPSSSSSSTEEAGEPKPPIEDYTLSCPDYVSEAE 77 +E E S+R PP + E + + +++ E EP +E Y P + E Sbjct: 84 IENESSERKCPPSTVGEHSMQEKRFSLTELTNALFEVEKEPAIDMESYRTL-PSRPTLEE 142 Query: 78 VTAHIEAFKEAGVDARVAQKVVDKLVD-HGRKIGEQFGASLEEERKLLQTKLGSDYETRE 136 + + + + +D H R + E F + L E LL K + Sbjct: 143 QVLATDPVLSNRIGGKY--DSLWSYLDLHFRLLREDFVSPLREGILLL--KKNKNLLGAR 198 Query: 137 KDIAR 141 +A+ Sbjct: 199 AAVAK 203 >gnl|CDD|39437 KOG4236, KOG4236, KOG4236, Serine/threonine protein kinase PKC mu/PKD and related proteins [Signal transduction mechanisms]. Length = 888 Score = 26.2 bits (57), Expect = 7.6 Identities = 15/44 (34%), Positives = 20/44 (45%), Gaps = 4/44 (9%) Query: 99 VDKLVDHGRKIGEQFGASLEEERKLLQTKLGSDYETREKDIARY 142 VDK + H Q L E L+ ++G Y T E D AR+ Sbjct: 813 VDKSLSHPWLQDYQTWLDLRE----LEVRIGERYITHESDDARW 852 >gnl|CDD|38806 KOG3600, KOG3600, KOG3600, Thyroid hormone receptor-associated protein complex, subunit TRAP240 [Transcription]. Length = 2238 Score = 26.2 bits (57), Expect = 7.7 Identities = 8/29 (27%), Positives = 12/29 (41%) Query: 28 PPPSKEEAVQSDPQGRNPSSSSSSTEEAG 56 PP S E + D R + + E+ G Sbjct: 324 PPTSPEYGCRGDVSCRQCAEAEYQGEDGG 352 >gnl|CDD|37788 KOG2577, KOG2577, KOG2577, Transcription factor E2F/dimerization partner (TDP) [Transcription]. Length = 354 Score = 26.2 bits (57), Expect = 7.8 Identities = 12/52 (23%), Positives = 21/52 (40%) Query: 2 SDETDQLTPLPSTPPVVECERSQRSNPPPSKEEAVQSDPQGRNPSSSSSSTE 53 + + +P + E S NP S+E S+ PS+S+S + Sbjct: 258 GSSSSSEDTISPSPYLPEQPASLALNPQQSEELLDSSNLLSFFPSTSASGSS 309 >gnl|CDD|173951 cd08192, Fe-ADH7, Iron-containing alcohol dehydrogenases-like, involved in the linear alkylbenzenesulfonate (LAS) degradation pathway. NAD-dependent iron-containing alcohol dehydrogenase-like. Proteins in this family are NAD-dependent alcohol dehydrogenases which are involved in the linear alkylbenzenesulfonate (LAS) degradation pathway. They catalyze the oxidation of beta-hydroxy CoA ester to beta-oxo CoA ester, which then be subject to CoA-dependent thiolysis to yield acetyl-CoA and 6-C8-SPC-CoA. The major laundry surfactant in worldwide use is commercial linear alkylbenzenesulfonate (LAS) which contains 20 congeners of linear alkanes (C10 to C13). LAS is fully biodegradable in oxic environments. Degradation involves microbial communities. Parvibaculum lavamentivorans DS-1T is a representative member of many heterotrophic, LAS-degrading communities, in which it catalyzes the first steps of LAS degradation. Strain DS-1T is a small heterotrophic bacterium able to omega-oxygenate the commercial surfactant linear alkylbenzenesulfonate (LAS) and shorten the side chain by beta-oxidation to yield sulfophenylcarboxylates (SPC). Parvibaculum lavamentivorans utilizes 3-C12-LAS as the sole carbon and energy source, and excretes largely 4-C6-SPC. Length = 370 Score = 26.4 bits (59), Expect = 7.9 Identities = 8/22 (36%), Positives = 13/22 (59%) Query: 74 SEAEVTAHIEAFKEAGVDARVA 95 +EA V A + A++ G D +A Sbjct: 66 TEAAVEAGLAAYRAGGCDGVIA 87 >gnl|CDD|143482 cd00622, PLPDE_III_ODC, Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme Ornithine Decarboxylase. This subfamily is composed mainly of eukaryotic ornithine decarboxylases (ODC, EC 4.1.1.17) and ODC-like enzymes from prokaryotes represented by Vibrio vulnificus LysineOrnithine decarboxylase. These are fold type III PLP-dependent enzymes that differ from most bacterial ODCs which are fold type I PLP-dependent enzymes. ODC participates in the formation of putrescine by catalyzing the decarboxylation of ornithine, the first step in polyamine biosynthesis. Members of this subfamily contain an N-terminal PLP-binding TIM-barrel domain and a C-terminal beta-sandwich domain, similar to bacterial alanine racemases. They exist as homodimers with active sites that lie at the interface between the TIM barrel domain of one subunit and the beta-sandwich domain of the other subunit. Homodimer formation and the presence of the PLP cofactor are required for catalytic activity. Also members of this subfamily are proteins with homology to ODC but do not possess any catalytic activity, the Antizyme inhibitor (AZI) and ODC-paralogue (ODC-p). AZI binds to the regulatory protein Antizyme with a higher affinity than ODC and prevents ODC degradation. ODC-p is a novel ODC-like protein, present only in mammals, that is specifically exressed in the brain and testes. ODC-p may function as a tissue-specific antizyme inhibitory protein. Length = 362 Score = 25.9 bits (58), Expect = 8.8 Identities = 17/53 (32%), Positives = 23/53 (43%), Gaps = 4/53 (7%) Query: 74 SEAEVTAHIEAFKEAGVDARVAQKVVDKLVDHGRKIGEQFGASLEEERKLLQT 126 SE E+ + A + R+A L RK FGA EE R+LL+ Sbjct: 99 SEDELEKIAKHAPGAKLLLRIATDDSGALCPLSRK----FGADPEEARELLRR 147 >gnl|CDD|35786 KOG0566, KOG0566, KOG0566, Inositol-1,4,5-triphosphate 5-phosphatase (synaptojanin), INP51/INP52/INP53 family [Intracellular trafficking, secretion, and vesicular transport]. Length = 1080 Score = 26.1 bits (57), Expect = 9.6 Identities = 17/72 (23%), Positives = 26/72 (36%), Gaps = 10/72 (13%) Query: 8 LTPLPSTPPVVECERSQRSNPPPSKEEAVQSDPQGRNPSSSSSSTEEAGEPKPPIEDYTL 67 L P P PP S RS P +K + ++ + +S S A P Y + Sbjct: 982 LIPRPIRPP------SARSPSPSAKSPS-PTEAPNSSSTSMPSPASAATLSGPW---YVI 1031 Query: 68 SCPDYVSEAEVT 79 S P ++ Sbjct: 1032 SKPLAPPQSNNG 1043 >gnl|CDD|30613 COG0264, Tsf, Translation elongation factor Ts [Translation, ribosomal structure and biogenesis]. Length = 296 Score = 26.0 bits (57), Expect = 9.7 Identities = 16/69 (23%), Positives = 30/69 (43%), Gaps = 5/69 (7%) Query: 74 SEAEVTAHIEAFKEAGVDARVAQKVVDKL---VDHGRKIGEQFGASLEEERKLLQTKLGS 130 E + A F+E ++A+ ++K V+ + E G ++EEE L K+G Sbjct: 80 CETDFVAKNAEFQELA--NKIAKAALEKKPADVEELKAAFEPGGKTVEEEIAALIAKIGE 137 Query: 131 DYETREKDI 139 + R + Sbjct: 138 NISLRRFAV 146 >gnl|CDD|107203 cd01560, Thr-synth_2, Threonine synthase catalyzes the final step of threonine biosynthesis. The conversion of O-phosphohomoserine into threonine and inorganic phosphate is pyridoxal 5'-phosphate dependent. The Thr-synth_1 CD includes members from higher plants, cyanobacteria, archaebacteria and eubacterial groups. This CD, Thr-synth_2, includes enzymes from fungi and eubacterial groups, as well as, metazoan threonine synthase-like proteins.. Length = 460 Score = 26.0 bits (58), Expect = 10.0 Identities = 11/50 (22%), Positives = 26/50 (52%), Gaps = 5/50 (10%) Query: 124 LQTKLGSDYETREKDIARYFRKEKIPDNDVQSLISAWGFEKTFNFFDRYA 173 + + G Y+ ++ F ++IP++D++SLI ++ ++FF Sbjct: 42 IASWSGLSYQELAFEVLSLFIGDEIPEDDLKSLI-----DRAYSFFRHPD 86 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.308 0.126 0.355 Gapped Lambda K H 0.267 0.0535 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 2,769,470 Number of extensions: 138225 Number of successful extensions: 577 Number of sequences better than 10.0: 1 Number of HSP's gapped: 575 Number of HSP's successfully gapped: 58 Length of query: 234 Length of database: 6,263,737 Length adjustment: 91 Effective length of query: 143 Effective length of database: 4,297,318 Effective search space: 614516474 Effective search space used: 614516474 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.6 bits) S2: 56 (25.8 bits)