RPS-BLAST 2.2.22 [Sep-27-2009]

Database: scop70_1_75 
           13,730 sequences; 2,407,596 total letters

Searching..................................................done

Query= gi|254781211|ref|YP_003065624.1| hypothetical protein
CLIBASIA_05590 [Candidatus Liberibacter asiaticus str. psy62]
         (234 letters)



>d1vhqa_ c.23.16.2 (A:) Putative sigma cross-reacting protein 27A
           (SCRP-27A, EllB) {Escherichia coli [TaxId: 562]}
          Length = 217

 Score = 26.9 bits (59), Expect = 1.4
 Identities = 10/73 (13%), Positives = 18/73 (24%)

Query: 71  DYVSEAEVTAHIEAFKEAGVDARVAQKVVDKLVDHGRKIGEQFGASLEEERKLLQTKLGS 130
           D     E    + A   +G  A        ++       GE    +     +  +   G 
Sbjct: 15  DGSEIHEAVLTLLAISRSGAQAVCFAPDKQQVDVINHLTGEAMTETRNVLIEAARITRGE 74

Query: 131 DYETREKDIARYF 143
                + D A   
Sbjct: 75  IRPLAQADAAELD 87


>d1sy7a1 c.23.16.3 (A:553-736) Catalase, C-terminal domain
          {Neurospora crassa [TaxId: 5141]}
          Length = 184

 Score = 26.8 bits (58), Expect = 1.6
 Identities = 4/25 (16%), Positives = 4/25 (16%)

Query: 71 DYVSEAEVTAHIEAFKEAGVDARVA 95
          D        A   A         V 
Sbjct: 12 DGYDNVAYDAAYAAISANQAIPLVI 36


>d1p5fa_ c.23.16.2 (A:) DJ-1 {Human (Homo sapiens) [TaxId: 9606]}
          Length = 186

 Score = 26.7 bits (58), Expect = 1.6
 Identities = 6/25 (24%), Positives = 10/25 (40%)

Query: 71 DYVSEAEVTAHIEAFKEAGVDARVA 95
              E E    ++  + AG+   VA
Sbjct: 10 KGAEEMETVIPVDVMRRAGIKVTVA 34


>d1vf7a_ f.46.1.1 (A:) Multidrug resistance protein MexA domain
           {Pseudomonas aeruginosa [TaxId: 287]}
          Length = 237

 Score = 27.0 bits (58), Expect = 1.7
 Identities = 8/33 (24%), Positives = 15/33 (45%)

Query: 77  EVTAHIEAFKEAGVDARVAQKVVDKLVDHGRKI 109
           E+     AF+ A V  +V   ++ +L   G  +
Sbjct: 5   ELPGRTNAFRIAEVRPQVNGIILKRLFKEGSDV 37


>d1u9ca_ c.23.16.2 (A:) GK2698 ortholog {Bacillus stearothermophilus
           [TaxId: 1422]}
          Length = 221

 Score = 26.3 bits (57), Expect = 2.6
 Identities = 16/63 (25%), Positives = 23/63 (36%)

Query: 77  EVTAHIEAFKEAGVDARVAQKVVDKLVDHGRKIGEQFGASLEEERKLLQTKLGSDYETRE 136
           E       F+E G D +VA     ++    R I E+  +  E E  L  T   S  +   
Sbjct: 27  EFAVPYLVFQEKGYDVKVASIQGGEVPLDPRSINEKDPSWAEAEAALKHTARLSKDDAHG 86

Query: 137 KDI 139
            D 
Sbjct: 87  FDA 89


>d1rl0a_ d.165.1.1 (A:) Dianthin 30 {Clove pink (Dianthus
           caryophyllus) [TaxId: 3570]}
          Length = 255

 Score = 25.3 bits (55), Expect = 4.2
 Identities = 4/26 (15%), Positives = 10/26 (38%)

Query: 136 EKDIARYFRKEKIPDNDVQSLISAWG 161
           +  + + F  +   +N V     +W 
Sbjct: 185 QNLVTKNFPNKFDSENKVIQFQVSWS 210


>d1f6va_ a.49.1.1 (A:) C-terminal domain of B transposition protein
           {Bacteriophage mu [TaxId: 10677]}
          Length = 91

 Score = 25.2 bits (55), Expect = 4.6
 Identities = 7/25 (28%), Positives = 11/25 (44%)

Query: 139 IARYFRKEKIPDNDVQSLISAWGFE 163
           IA+     K    DV+++  AW   
Sbjct: 4   IAKRTAINKTKKADVKAIADAWQIN 28


>d1cf5a_ d.165.1.1 (A:) Beta-momorcharin {Bitter gourd (Momordica
           charantia) [TaxId: 3673]}
          Length = 249

 Score = 24.9 bits (54), Expect = 6.1
 Identities = 7/26 (26%), Positives = 13/26 (50%)

Query: 136 EKDIARYFRKEKIPDNDVQSLISAWG 161
           E+ +A+Y      P+  + SL + W 
Sbjct: 166 ERHVAKYVATNFKPNLAIISLENQWS 191


>d1j1qa_ d.165.1.1 (A:) Antiviral protein S {Pokeweed (Phytolacca
           americana) [TaxId: 3527]}
          Length = 261

 Score = 24.9 bits (54), Expect = 6.1
 Identities = 7/30 (23%), Positives = 14/30 (46%)

Query: 132 YETREKDIARYFRKEKIPDNDVQSLISAWG 161
           ++  E  +   F ++  P++ V  L   WG
Sbjct: 179 FKYIENQVKTNFNRDFSPNDKVLDLEENWG 208


>d1rlja_ c.23.5.7 (A:) Flavoprotein NrdI {Bacillus subtilis [TaxId:
           1423]}
          Length = 135

 Score = 24.9 bits (54), Expect = 6.3
 Identities = 10/54 (18%), Positives = 17/54 (31%), Gaps = 6/54 (11%)

Query: 178 ESSTGDTFVRSEGSQEADRDFDKVFNTPDFGSRVLSGDKEATKTLRQWAEKQAT 231
               GD F +      +     + +  P      LSG  +  +   Q  E+  T
Sbjct: 82  NKVWGDNFAK------SADTISRQYQVPILHKFELSGTSKDVELFTQEVERVVT 129


>d1mrga_ d.165.1.1 (A:) alpha-Momorcharin (momordin) {Bitter gourd
           (Momordica charantia) [TaxId: 3673]}
          Length = 246

 Score = 24.5 bits (53), Expect = 7.5
 Identities = 6/26 (23%), Positives = 13/26 (50%)

Query: 136 EKDIARYFRKEKIPDNDVQSLISAWG 161
           E+ I     ++++P     SL ++W 
Sbjct: 168 EQQIQERAYRDEVPSLATISLENSWS 193


>d1nioa_ d.165.1.1 (A:) Beta-luffin {Smooth loofah (Luffa
           cylindrica) [TaxId: 3670]}
          Length = 247

 Score = 24.5 bits (53), Expect = 8.3
 Identities = 7/26 (26%), Positives = 11/26 (42%)

Query: 136 EKDIARYFRKEKIPDNDVQSLISAWG 161
           E  I +   K ++P     SL + W 
Sbjct: 168 EGQIIKRIPKNEVPSPAALSLENEWS 193


  Database: scop70_1_75
    Posted date:  Mar 27, 2010  6:21 PM
  Number of letters in database: 2,407,596
  Number of sequences in database:  13,730
  
Lambda     K      H
   0.308    0.126    0.355 

Gapped
Lambda     K      H
   0.267   0.0658    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 13730
Number of Hits to DB: 840,683
Number of extensions: 38212
Number of successful extensions: 120
Number of sequences better than 10.0: 1
Number of HSP's gapped: 120
Number of HSP's successfully gapped: 18
Length of query: 234
Length of database: 2,407,596
Length adjustment: 82
Effective length of query: 152
Effective length of database: 1,281,736
Effective search space: 194823872
Effective search space used: 194823872
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 51 (23.6 bits)