BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254781211|ref|YP_003065624.1| hypothetical protein CLIBASIA_05590 [Candidatus Liberibacter asiaticus str. psy62] (234 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254781211|ref|YP_003065624.1| hypothetical protein CLIBASIA_05590 [Candidatus Liberibacter asiaticus str. psy62] Length = 234 Score = 479 bits (1234), Expect = e-137, Method: Compositional matrix adjust. Identities = 234/234 (100%), Positives = 234/234 (100%) Query: 1 MSDETDQLTPLPSTPPVVECERSQRSNPPPSKEEAVQSDPQGRNPSSSSSSTEEAGEPKP 60 MSDETDQLTPLPSTPPVVECERSQRSNPPPSKEEAVQSDPQGRNPSSSSSSTEEAGEPKP Sbjct: 1 MSDETDQLTPLPSTPPVVECERSQRSNPPPSKEEAVQSDPQGRNPSSSSSSTEEAGEPKP 60 Query: 61 PIEDYTLSCPDYVSEAEVTAHIEAFKEAGVDARVAQKVVDKLVDHGRKIGEQFGASLEEE 120 PIEDYTLSCPDYVSEAEVTAHIEAFKEAGVDARVAQKVVDKLVDHGRKIGEQFGASLEEE Sbjct: 61 PIEDYTLSCPDYVSEAEVTAHIEAFKEAGVDARVAQKVVDKLVDHGRKIGEQFGASLEEE 120 Query: 121 RKLLQTKLGSDYETREKDIARYFRKEKIPDNDVQSLISAWGFEKTFNFFDRYAQQNKESS 180 RKLLQTKLGSDYETREKDIARYFRKEKIPDNDVQSLISAWGFEKTFNFFDRYAQQNKESS Sbjct: 121 RKLLQTKLGSDYETREKDIARYFRKEKIPDNDVQSLISAWGFEKTFNFFDRYAQQNKESS 180 Query: 181 TGDTFVRSEGSQEADRDFDKVFNTPDFGSRVLSGDKEATKTLRQWAEKQATLNQ 234 TGDTFVRSEGSQEADRDFDKVFNTPDFGSRVLSGDKEATKTLRQWAEKQATLNQ Sbjct: 181 TGDTFVRSEGSQEADRDFDKVFNTPDFGSRVLSGDKEATKTLRQWAEKQATLNQ 234 >gi|254780227|ref|YP_003064640.1| pyrophosphate--fructose-6-phosphate 1-phosphotransferase [Candidatus Liberibacter asiaticus str. psy62] Length = 426 Score = 25.8 bits (55), Expect = 0.62, Method: Compositional matrix adjust. Identities = 12/35 (34%), Positives = 18/35 (51%) Query: 75 EAEVTAHIEAFKEAGVDARVAQKVVDKLVDHGRKI 109 E ++ AH AF AG A ++ L++H KI Sbjct: 24 EKDMVAHKVAFLTAGGIAPCLSSIIGMLINHYNKI 58 >gi|254780137|ref|YP_003064550.1| malic enzyme [Candidatus Liberibacter asiaticus str. psy62] Length = 779 Score = 23.1 bits (48), Expect = 4.8, Method: Composition-based stats. Identities = 9/17 (52%), Positives = 11/17 (64%) Query: 49 SSSTEEAGEPKPPIEDY 65 + + EEAG PIEDY Sbjct: 411 AKAAEEAGVASSPIEDY 427 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.308 0.126 0.355 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 145,240 Number of Sequences: 1233 Number of extensions: 5709 Number of successful extensions: 10 Number of sequences better than 100.0: 6 Number of HSP's better than 100.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 6 Number of HSP's gapped (non-prelim): 6 length of query: 234 length of database: 328,796 effective HSP length: 71 effective length of query: 163 effective length of database: 241,253 effective search space: 39324239 effective search space used: 39324239 T: 11 A: 40 X1: 16 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.6 bits) S2: 37 (18.9 bits)