RPS-BLAST 2.2.22 [Sep-27-2009]

Database: CddA 
           21,609 sequences; 6,263,737 total letters

Searching..................................................done

Query= gi|254781212|ref|YP_003065625.1| hypothetical protein
CLIBASIA_05595 [Candidatus Liberibacter asiaticus str. psy62]
         (109 letters)



>gnl|CDD|31252 COG1052, LdhA, Lactate dehydrogenase and related dehydrogenases
           [Energy production and conversion / Coenzyme metabolism
           / General function prediction only].
          Length = 324

 Score = 31.4 bits (71), Expect = 0.058
 Identities = 13/44 (29%), Positives = 20/44 (45%), Gaps = 5/44 (11%)

Query: 1   MVNFRKLADMIKSKVL---SRGYTVDSDALARQLEEDERRIRHY 41
           ++N  +LA M    +L   +RG  VD  AL   L+    +I   
Sbjct: 217 LINAEELAKMKPGAILVNTARGGLVDEQALIDALK--SGKIAGA 258


>gnl|CDD|35696 KOG0475, KOG0475, KOG0475, Cl- channel CLC-3 and related proteins
           (CLC superfamily) [Inorganic ion transport and
           metabolism].
          Length = 696

 Score = 28.4 bits (63), Expect = 0.44
 Identities = 11/27 (40%), Positives = 14/27 (51%)

Query: 80  GKRSLAVHIASNCGLSFERIVQMYSDN 106
           GK   +VHIA+  G  F +I   Y  N
Sbjct: 199 GKEGPSVHIATCIGNIFSKIFPKYRLN 225


>gnl|CDD|79366 cd03684, ClC_3_like, ClC-3-like chloride channel proteins.  This CD
            includes ClC-3, ClC-4, ClC-5 and ClC-Y1. ClC-3 was
           initially cloned from rat kidney. Expression of ClC-3
           produces outwardly-rectifying Cl currents that are
           inhibited by protein kinase C activation. It has been
           suggested that ClC-3 may be a ubiquitous
           swelling-activated Cl channel that has very similar
           characteristics to those of native volume-regulated Cl
           currents. The function of ClC-4 is unclear. Studies of
           human ClC-4 have revealed that it gives rise to Cl
           currents that rapidly activate at positive voltages, and
           are sensitive to extracellular pH, with currents
           decreasing when pH falls below 6.5. ClC-4 is broadly
           distributed, especially in brain and heart.   ClC-5 is
           predominantly expressed in the kidney, but can be found
           in the brain and liver. Mutations in the ClC-5 gene
           cause certain hereditary diseases, including Dent's
           disease, an X-chromosome linked syndrome characterised
           by proteinuria, hypercalciuria, and kidney stones
           (nephrolithiasis), leading to progressive renal failure.
             These proteins belong to the ClC superfamily of
           chloride ion channels, which share the unique
           double-barreled architecture and voltage-dependent
           gating mechanism. The gating is conferred by the
           permeating anion itself, acting as the gating charge.
           This domain is found in the eukaryotic halogen ion (Cl-
           and I-) channel proteins, that perform a variety of
           functions including cell volume regulation, the membrane
           potential stabilization, transepithelial chloride
           transport and charge compensation necessary for the
           acidification of intracellular organelles..
          Length = 445

 Score = 28.2 bits (63), Expect = 0.56
 Identities = 10/27 (37%), Positives = 12/27 (44%)

Query: 80  GKRSLAVHIASNCGLSFERIVQMYSDN 106
           GK    VHIA+  G    R+   Y  N
Sbjct: 97  GKEGPLVHIATCVGNIISRLFPKYRRN 123


>gnl|CDD|30460 COG0111, SerA, Phosphoglycerate dehydrogenase and related
           dehydrogenases [Amino acid transport and metabolism].
          Length = 324

 Score = 26.4 bits (58), Expect = 1.5
 Identities = 15/44 (34%), Positives = 21/44 (47%), Gaps = 5/44 (11%)

Query: 1   MVNFRKLADMIKSKVL---SRGYTVDSDALARQLEEDERRIRHY 41
           ++N  +LA M    +L   +RG  VD DAL   L  D  +I   
Sbjct: 214 LINAEELAKMKPGAILINAARGGVVDEDALLAAL--DSGKIAGA 255


>gnl|CDD|145796 pfam02826, 2-Hacid_dh_C, D-isomer specific 2-hydroxyacid
           dehydrogenase, NAD binding domain.  This domain is
           inserted into the catalytic domain, the large
           dehydrogenase and D-lactate dehydrogenase families in
           SCOP. N-terminal portion of which is represented by
           family pfam00389.
          Length = 176

 Score = 26.7 bits (60), Expect = 1.6
 Identities = 15/44 (34%), Positives = 21/44 (47%), Gaps = 5/44 (11%)

Query: 1   MVNFRKLADMIKSKVL---SRGYTVDSDALARQLEEDERRIRHY 41
           ++N  +LA M    +L   +RG  VD DAL   L+    RI   
Sbjct: 106 LINAERLALMKPGAILINTARGGLVDEDALIAALK--SGRIAGA 147


>gnl|CDD|143502 cd06829, PLPDE_III_CANSDC, Type III Pyridoxal 5-phosphate
           (PLP)-Dependent Enzyme Carboxynorspermidine
           Decarboxylase.  Carboxynorspermidine decarboxylase
           (CANSDC) catalyzes the decarboxylation of
           carboxynorspermidine, the last step in the biosynthesis
           of norspermidine. It is homologous to eukaryotic
           ornithine decarboxylase (ODC) and diaminopimelate
           decarboxylase (DapDC), which are fold type III
           PLP-dependent enzymes that contain an N-terminal
           PLP-binding TIM-barrel domain and a C-terminal
           beta-sandwich domain, similar to bacterial alanine
           racemases. Based on this similarity, CANSDC may require
           homodimer formation and the presence of the PLP cofactor
           for its catalytic activity.
          Length = 346

 Score = 25.6 bits (57), Expect = 3.2
 Identities = 10/19 (52%), Positives = 10/19 (52%)

Query: 23  DSDALARQLEEDERRIRHY 41
           D DAL R LE  E R   Y
Sbjct: 167 DFDALERTLEAVEERFGEY 185


>gnl|CDD|34606 COG5001, COG5001, Predicted signal transduction protein containing
           a membrane domain, an EAL and a GGDEF domain [Signal
           transduction mechanisms].
          Length = 663

 Score = 25.4 bits (55), Expect = 3.7
 Identities = 14/61 (22%), Positives = 29/61 (47%), Gaps = 6/61 (9%)

Query: 1   MVNFRKLADMIKSKVLSRGYTVDSDAL-ARQLEEDERRIRHYKHVYSTPEGRFVLTDLMV 59
           + N+R+ +DM++S+V     T+   A   R+L ++  R+ +   +   P  R    +L  
Sbjct: 194 LTNYREFSDMVQSQV-----TLTQRAEETRRLSDENDRLANLDSLTGLPNRRRFFAELDA 248

Query: 60  E 60
            
Sbjct: 249 R 249


>gnl|CDD|73256 cd01302, Cyclic_amidohydrolases, Cyclic amidohydrolases, including
           hydantoinase, dihydropyrimidinase, allantoinase, and
           dihydroorotase, are involved in the metabolism of
           pyrimidines and purines, sharing the property of
           hydrolyzing the cyclic amide bond of each substrate to
           the corresponding N-carbamyl amino acids. Allantoinases
           catalyze the degradation of purines, while
           dihydropyrimidinases and hydantoinases, a microbial
           counterpart of dihydropyrimidinase, are involved in
           pyrimidine degradation. Dihydroorotase participates in
           the de novo synthesis of pyrimidines..
          Length = 337

 Score = 24.9 bits (54), Expect = 4.9
 Identities = 10/31 (32%), Positives = 17/31 (54%)

Query: 78  LEGKRSLAVHIASNCGLSFERIVQMYSDNPR 108
           LE +  + +      GLS E +V++ S+NP 
Sbjct: 251 LETRLPILLTEGVKRGLSLETLVEILSENPA 281


>gnl|CDD|36309 KOG1093, KOG1093, KOG1093, Predicted protein kinase (contains TBC
           and RHOD domains) [General function prediction only].
          Length = 725

 Score = 24.6 bits (53), Expect = 5.9
 Identities = 11/31 (35%), Positives = 16/31 (51%)

Query: 24  SDALARQLEEDERRIRHYKHVYSTPEGRFVL 54
           S +  RQ+E D  R   Y  + S+P+G   L
Sbjct: 387 SHSTDRQIEVDIPRCHQYDELLSSPKGHRKL 417


>gnl|CDD|132889 cd07049, BMC_EutL_repeat1, ethanolamine utilization protein S
          (EutS), Bacterial Micro-Compartment (BMC) domain repeat
          1.  EutL proteins are homologs of the carboxysome shell
          protein. They are encoded within the eut operon and
          might be required for the formation of the outer shell
          of the bacterial eut polyhedral organelles which are
          involved in the cobalamin-dependent degradation of
          ethanolamine. Although it has been suggested that EutL
          might form hexamers and further assemble into the flat
          facets of the polyhedral outer shell of the eut
          organelles at present no experimental evidence directly
          supports this view. EutL proteins contain two tandem
          BMC domains. This CD includes domain 1 (the first BMC
          domain of EutL).
          Length = 103

 Score = 24.3 bits (53), Expect = 6.8
 Identities = 9/30 (30%), Positives = 17/30 (56%), Gaps = 1/30 (3%)

Query: 63 LLSSVSNDSAHQLALLEGKRSLAVHIASNC 92
          ++ +V  D A +L+L    RSL + I ++ 
Sbjct: 6  VIPNVDPDLAKELSLPPHHRSLGI-ITADS 34


>gnl|CDD|144445 pfam00852, Glyco_transf_10, Glycosyltransferase family 10
           (fucosyltransferase).  This family of
           Fucosyltransferases are the enzymes transferring fucose
           from GDP-Fucose to GlcNAc in an alpha1,3 linkage. This
           family is know as glycosyltransferase family 10.
          Length = 353

 Score = 24.2 bits (53), Expect = 7.2
 Identities = 10/33 (30%), Positives = 15/33 (45%), Gaps = 1/33 (3%)

Query: 73  HQLALLEGKRSLAVHIASNCGLSFERIVQMYSD 105
               +LE K  L   + SNC    +R V+ Y +
Sbjct: 168 VLPEILEKKSKLVAWVVSNCNEPSKR-VKYYRE 199


>gnl|CDD|37377 KOG2166, KOG2166, KOG2166, Cullins [Cell cycle control, cell
           division, chromosome partitioning].
          Length = 725

 Score = 24.5 bits (53), Expect = 7.4
 Identities = 12/52 (23%), Positives = 23/52 (44%)

Query: 31  LEEDERRIRHYKHVYSTPEGRFVLTDLMVEGGLLSSVSNDSAHQLALLEGKR 82
           L+E+  R+ HY H  + P+   V+ D ++          + +   ALL   +
Sbjct: 233 LKEERERVTHYLHSSTEPKLVEVVEDELIVVFADDLEEMEHSGFRALLNDDK 284


>gnl|CDD|29985 cd00984, DnaB_C, DnaB helicase C terminal domain. The hexameric
           helicase DnaB unwinds the DNA duplex at the  chromosome
           replication fork. Although the mechanism by which DnaB
           both couples ATP hydrolysis to translocation along DNA
           and denatures the duplex is unknown, a change in the
           quaternary structure of the protein involving
           dimerization of the N-terminal domain has been observed
           and may occur during the enzymatic cycle. This
           C-terminal domain contains an ATP-binding site and is
           therefore probably the site of ATP hydrolysis..
          Length = 242

 Score = 24.0 bits (52), Expect = 8.7
 Identities = 8/25 (32%), Positives = 13/25 (52%)

Query: 80  GKRSLAVHIASNCGLSFERIVQMYS 104
           GK + A++IA N      + V  +S
Sbjct: 25  GKTAFALNIAENIAKKQGKPVLFFS 49


>gnl|CDD|36715 KOG1502, KOG1502, KOG1502, Flavonol reductase/cinnamoyl-CoA
          reductase [Defense mechanisms].
          Length = 327

 Score = 24.1 bits (52), Expect = 9.9
 Identities = 18/63 (28%), Positives = 28/63 (44%), Gaps = 4/63 (6%)

Query: 7  LADMIKSKVLSRGYTVDSDALARQLEEDERRIRHYKHVYSTPEGRFVLT-DLMVEGGLLS 65
          +   I   +LSRGYTV      R   EDE++  H + +    E   +   DL+ EG    
Sbjct: 18 IGSWIVKLLLSRGYTV--RGTVRDP-EDEKKTEHLRKLEGAKERLKLFKADLLDEGSFDK 74

Query: 66 SVS 68
          ++ 
Sbjct: 75 AID 77


  Database: CddA
    Posted date:  Feb 4, 2011  9:38 PM
  Number of letters in database: 6,263,737
  Number of sequences in database:  21,609
  
Lambda     K      H
   0.320    0.134    0.372 

Gapped
Lambda     K      H
   0.267   0.0644    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 21609
Number of Hits to DB: 1,238,886
Number of extensions: 55915
Number of successful extensions: 197
Number of sequences better than 10.0: 1
Number of HSP's gapped: 197
Number of HSP's successfully gapped: 26
Length of query: 109
Length of database: 6,263,737
Length adjustment: 75
Effective length of query: 34
Effective length of database: 4,643,062
Effective search space: 157864108
Effective search space used: 157864108
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 51 (23.6 bits)