RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254781212|ref|YP_003065625.1| hypothetical protein CLIBASIA_05595 [Candidatus Liberibacter asiaticus str. psy62] (109 letters) >gnl|CDD|179291 PRK01390, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional. Length = 460 Score = 30.2 bits (69), Expect = 0.11 Identities = 25/94 (26%), Positives = 34/94 (36%), Gaps = 20/94 (21%) Query: 22 VDSD---ALARQLEEDERRIRHYKHVYSTPEGRFVLTDLMVEGGLLSSVSNDSAHQLALL 78 VD A+A +LE RR+ S G+ + + +GG L ++A L Sbjct: 224 VDDAYCRAIADRLEAAGRRV----VRISA--GKPLADGVYADGGKLVDARGGRQVEIADL 277 Query: 79 EGKRSL-----------AVHIASNCGLSFERIVQ 101 G SL A A GLS E I Sbjct: 278 RGIPSLPGAHNAQNAAAAYAAARALGLSPEEIAA 311 >gnl|CDD|183914 PRK13243, PRK13243, glyoxylate reductase; Reviewed. Length = 333 Score = 27.5 bits (61), Expect = 0.85 Identities = 13/36 (36%), Positives = 21/36 (58%), Gaps = 3/36 (8%) Query: 1 MVNFRKLADMIKSKVL---SRGYTVDSDALARQLEE 33 M+N +L M + +L +RG VD+ AL + L+E Sbjct: 221 MINEERLKLMKPTAILVNTARGKVVDTKALVKALKE 256 >gnl|CDD|129467 TIGR00370, TIGR00370, conserved hypothetical protein TIGR00370. Length = 202 Score = 26.7 bits (59), Expect = 1.2 Identities = 9/31 (29%), Positives = 14/31 (45%), Gaps = 2/31 (6%) Query: 79 EGKRSLAVHIASNCGLSFERIVQMYSDNPRY 109 E L +A LS E ++ ++S N Y Sbjct: 88 EFGPDLEE-VAKINQLSPEEVIDIHS-NGEY 116 >gnl|CDD|183316 PRK11790, PRK11790, D-3-phosphoglycerate dehydrogenase; Provisional. Length = 409 Score = 26.7 bits (60), Expect = 1.4 Identities = 15/36 (41%), Positives = 19/36 (52%), Gaps = 3/36 (8%) Query: 1 MVNFRKLADMIKSKVL---SRGYTVDSDALARQLEE 33 M+ +LA M +L SRG VD DALA L+ Sbjct: 220 MIGAEELALMKPGAILINASRGTVVDIDALADALKS 255 >gnl|CDD|179576 PRK03381, PRK03381, PII uridylyl-transferase; Provisional. Length = 774 Score = 26.5 bits (59), Expect = 1.5 Identities = 8/22 (36%), Positives = 10/22 (45%) Query: 23 DSDALARQLEEDERRIRHYKHV 44 D LAR L + R I + V Sbjct: 260 DRFDLARALSDAARTISYAVDV 281 >gnl|CDD|162454 TIGR01631, Trypano_RHS, trypanosome RHS (retrotransposon hot spot) family. This model describes full-length and part-length members of the RHS (retrotransposon hot spot) family in Trypanosoma brucei and Trypanosoma cruzi. Members of this family are frequently interrupted by non-LTR retrotransposons inserted at exactly the same relative position. Length = 760 Score = 25.9 bits (57), Expect = 2.2 Identities = 11/38 (28%), Positives = 15/38 (39%), Gaps = 3/38 (7%) Query: 75 LALLEGKRSLAVHIASNCG---LSFERIVQMYSDNPRY 109 +LE R LA C L F +V+ + RY Sbjct: 554 SLVLESTRELAAENFERCAVFALLFGNVVRGIARRLRY 591 >gnl|CDD|132300 TIGR03256, met_CoM_red_alp, methyl-coenzyme M reductase, alpha subunit. Members of this protein family are the alpha subunit of methyl coenzyme M reductase, also called coenzyme-B sulfoethylthiotransferase (EC 2.8.4.1). This enzyme, with alpha, beta, and gamma subunits, catalyzes the last step in methanogenesis. Several methanogens have encode two such enzymes, designated I and II; this model does not separate the isozymes. Length = 548 Score = 26.0 bits (57), Expect = 2.2 Identities = 17/49 (34%), Positives = 23/49 (46%), Gaps = 7/49 (14%) Query: 34 DERRIRHYKHVYSTPEGRFVL-------TDLMVEGGLLSSVSNDSAHQL 75 ++R I Y TP G+ VL TD VEG L V+N + Q+ Sbjct: 47 EKRGIPFYNPDIGTPLGQRVLMPYQVSGTDTFVEGDDLHFVNNAAMQQM 95 >gnl|CDD|183605 PRK12577, PRK12577, succinate dehydrogenase iron-sulfur subunit; Provisional. Length = 329 Score = 25.4 bits (56), Expect = 3.0 Identities = 16/39 (41%), Positives = 20/39 (51%), Gaps = 10/39 (25%) Query: 24 SDALARQLEEDERRIRHYKHVYSTPEGRFVLTDLMVEGG 62 + LAR+ +D R IRH R VL DL+ EGG Sbjct: 236 QEILARKDAQDSRAIRH----------RKVLVDLVKEGG 264 >gnl|CDD|179251 PRK01216, PRK01216, DNA polymerase IV; Validated. Length = 351 Score = 25.5 bits (56), Expect = 3.1 Identities = 10/22 (45%), Positives = 12/22 (54%) Query: 18 RGYTVDSDALARQLEEDERRIR 39 Y L + LEEDER+IR Sbjct: 309 TAYREAVRLLQKILEEDERKIR 330 >gnl|CDD|184420 PRK13960, PRK13960, phosphoribosylaminoimidazole-succinocarboxamide synthase; Provisional. Length = 367 Score = 25.4 bits (56), Expect = 3.2 Identities = 12/29 (41%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Query: 3 NFRKLADM-IKSKVLSRGYTVDSDALARQ 30 NF D+ + K+L G+ V SDALA+ Sbjct: 205 NFSSADDIDLYEKLLKEGFKVISDALAKL 233 >gnl|CDD|148981 pfam07677, A2M_recep, A-macroglobulin receptor. This family includes the receptor domain region of the alpha-2-macroglobulin family. Length = 90 Score = 25.6 bits (57), Expect = 3.2 Identities = 10/28 (35%), Positives = 15/28 (53%), Gaps = 1/28 (3%) Query: 14 KVLSRGYTVDSDALARQLEEDERRIRHY 41 K+LS G+T D + L + +R I Y Sbjct: 9 KLLS-GFTPDKEDLKQLSNGVDRYISRY 35 >gnl|CDD|180113 PRK05479, PRK05479, ketol-acid reductoisomerase; Provisional. Length = 330 Score = 25.4 bits (57), Expect = 3.4 Identities = 8/17 (47%), Positives = 11/17 (64%), Gaps = 3/17 (17%) Query: 56 DLMVEGGL---LSSVSN 69 DL+ EGG+ S+SN Sbjct: 237 DLIYEGGIANMRYSISN 253 >gnl|CDD|161972 TIGR00638, Mop, molybdenum-pterin binding domain. This model describes a multigene family of molybdenum-pterin binding proteins of about 70 amino acids in Clostridium pasteurianum, as a tandemly-repeated domain C-terminal to an unrelated domain in ModE, a molybdate transport gene repressor of E. coli, and in single or tandemly paired domains in several related proteins. Length = 69 Score = 25.4 bits (56), Expect = 3.5 Identities = 14/42 (33%), Positives = 22/42 (52%), Gaps = 2/42 (4%) Query: 56 DLMVEGG--LLSSVSNDSAHQLALLEGKRSLAVHIASNCGLS 95 DL++ GG L + ++ +S +L L GK AV A L+ Sbjct: 26 DLLLGGGTKLTAVITLESVAELGLKPGKEVYAVIKAPWVILA 67 >gnl|CDD|185419 PTZ00056, PTZ00056, glutathione peroxidase; Provisional. Length = 199 Score = 25.2 bits (55), Expect = 3.8 Identities = 10/38 (26%), Positives = 22/38 (57%), Gaps = 4/38 (10%) Query: 75 LALLEGKRSLAVHIASNCGLS---FERIVQMYSD-NPR 108 ++ L+ K + + AS CGL+ +++ +++S NP Sbjct: 34 MSSLKNKVLMITNSASKCGLTKKHVDQMNRLHSVFNPL 71 >gnl|CDD|181823 PRK09401, PRK09401, reverse gyrase; Reviewed. Length = 1176 Score = 24.9 bits (55), Expect = 4.3 Identities = 9/18 (50%), Positives = 13/18 (72%) Query: 22 VDSDALARQLEEDERRIR 39 VD + L R+++ED RIR Sbjct: 574 VDLEELLREIDEDRERIR 591 >gnl|CDD|180795 PRK07021, fliL, flagellar basal body-associated protein FliL; Reviewed. Length = 162 Score = 24.9 bits (55), Expect = 4.3 Identities = 16/43 (37%), Positives = 20/43 (46%), Gaps = 2/43 (4%) Query: 48 PEGRFVLTDLM--VEGGLLSSVSNDSAHQLALLEGKRSLAVHI 88 R L D + V LL +S A +LA EGK+ LA I Sbjct: 92 EATRERLKDYLPEVRSRLLLLLSRKHAAELATEEGKQKLAAEI 134 >gnl|CDD|178536 PLN02950, PLN02950, 4-alpha-glucanotransferase. Length = 909 Score = 25.1 bits (55), Expect = 4.8 Identities = 11/14 (78%), Positives = 11/14 (78%), Gaps = 1/14 (7%) Query: 32 EEDE-RRIRHYKHV 44 EEDE RR R YKHV Sbjct: 810 EEDEERRERFYKHV 823 >gnl|CDD|181799 PRK09361, radB, DNA repair and recombination protein RadB; Provisional. Length = 225 Score = 24.8 bits (55), Expect = 5.1 Identities = 9/42 (21%), Positives = 16/42 (38%), Gaps = 13/42 (30%) Query: 80 GKRSLAVHIASNC-------------GLSFERIVQMYSDNPR 108 GK ++ + +A GLS ER Q+ ++ Sbjct: 35 GKTNICLQLAVEAAKNGKKVIYIDTEGLSPERFKQIAGEDFE 76 >gnl|CDD|181414 PRK08410, PRK08410, 2-hydroxyacid dehydrogenase; Provisional. Length = 311 Score = 24.9 bits (55), Expect = 5.3 Identities = 9/36 (25%), Positives = 19/36 (52%), Gaps = 3/36 (8%) Query: 1 MVNFRKLADMIKSKVL---SRGYTVDSDALARQLEE 33 ++ +++L + +L RG V+ LA+ L+E Sbjct: 213 LIAYKELKLLKDGAILINVGRGGIVNEKDLAKALDE 248 >gnl|CDD|178021 PLN02399, PLN02399, phospholipid hydroperoxide glutathione peroxidase. Length = 236 Score = 24.5 bits (53), Expect = 7.0 Identities = 10/21 (47%), Positives = 15/21 (71%) Query: 75 LALLEGKRSLAVHIASNCGLS 95 L+ +GK L V++AS CGL+ Sbjct: 94 LSKFKGKVLLIVNVASKCGLT 114 >gnl|CDD|131592 TIGR02540, gpx7, putative glutathione peroxidase Gpx7. This model represents one of several families of known and probable glutathione peroxidases. This family is restricted to animals and designated GPX7. Length = 153 Score = 24.4 bits (53), Expect = 7.1 Identities = 9/16 (56%), Positives = 12/16 (75%) Query: 80 GKRSLAVHIASNCGLS 95 GK SL V++AS CG + Sbjct: 22 GKVSLVVNVASECGFT 37 >gnl|CDD|182585 PRK10606, btuE, putative glutathione peroxidase; Provisional. Length = 183 Score = 24.3 bits (53), Expect = 7.2 Identities = 12/36 (33%), Positives = 18/36 (50%), Gaps = 5/36 (13%) Query: 75 LALLEGKRSLAVHIASNCGLS-----FERIVQMYSD 105 L G L V++AS CGL+ E I + ++D Sbjct: 20 LEKYAGNVLLIVNVASKCGLTPQYEQLENIQKAWAD 55 >gnl|CDD|161956 TIGR00609, recB, exodeoxyribonuclease V, beta subunit. All proteins in this family for which functions are known are DNA-DNA helicases that are used as part of an exonuclease-helicase complex (made up of RecBCD homologs) that function to generate substrates for the initiation of recombination and recombinational repair. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University). Length = 1087 Score = 23.9 bits (52), Expect = 8.3 Identities = 20/67 (29%), Positives = 33/67 (49%), Gaps = 4/67 (5%) Query: 41 YKHVYSTPEGRFVLTDLMVEGGLLSSVSNDSAHQLALLEGKRSLAVHIASNCGLSFERIV 100 + + S P G +LT+L+ LL ++ ++L+LL R L I SN E I+ Sbjct: 589 GERLLSQPGGERILTNLLHLAELLQEAAHQERNKLSLL---RWLEDQI-SNEEEEEEEII 644 Query: 101 QMYSDNP 107 ++ SD Sbjct: 645 RLESDAE 651 >gnl|CDD|178976 PRK00317, mobA, molybdopterin-guanine dinucleotide biosynthesis protein MobA; Reviewed. Length = 193 Score = 24.0 bits (53), Expect = 8.7 Identities = 4/16 (25%), Positives = 6/16 (37%) Query: 25 DALARQLEEDERRIRH 40 L L ER++ Sbjct: 143 PDLEAYLAAGERKVMA 158 >gnl|CDD|179176 PRK00943, PRK00943, selenophosphate synthetase; Provisional. Length = 347 Score = 24.0 bits (53), Expect = 8.9 Identities = 9/29 (31%), Positives = 16/29 (55%) Query: 47 TPEGRFVLTDLMVEGGLLSSVSNDSAHQL 75 E R +L D GGLL +V+ ++ ++ Sbjct: 289 PDEQRALLCDPQTSGGLLVAVAPEAEAEV 317 >gnl|CDD|178513 PLN02925, PLN02925, 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase. Length = 733 Score = 23.9 bits (52), Expect = 8.9 Identities = 11/28 (39%), Positives = 16/28 (57%) Query: 81 KRSLAVHIASNCGLSFERIVQMYSDNPR 108 K A+ I +N G +RI+ Y D+PR Sbjct: 221 KYGRAMRIGTNHGSLSDRIMSYYGDSPR 248 >gnl|CDD|183351 PRK11873, arsM, arsenite S-adenosylmethyltransferase; Reviewed. Length = 272 Score = 23.8 bits (52), Expect = 10.0 Identities = 9/25 (36%), Positives = 16/25 (64%) Query: 48 PEGRFVLTDLMVEGGLLSSVSNDSA 72 P GRF ++D+++ G L + ND+ Sbjct: 175 PGGRFAISDVVLRGELPEEIRNDAE 199 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.320 0.134 0.372 Gapped Lambda K H 0.267 0.0684 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 1,756,579 Number of extensions: 100537 Number of successful extensions: 312 Number of sequences better than 10.0: 1 Number of HSP's gapped: 312 Number of HSP's successfully gapped: 43 Length of query: 109 Length of database: 5,994,473 Length adjustment: 75 Effective length of query: 34 Effective length of database: 4,373,873 Effective search space: 148711682 Effective search space used: 148711682 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.1 bits)