RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254781212|ref|YP_003065625.1| hypothetical protein CLIBASIA_05595 [Candidatus Liberibacter asiaticus str. psy62] (109 letters) >1gut_A Mopii, molybdate binding protein II; molbindin; 1.5A {Clostridium pasteurianum} (A:) Length = 68 Score = 27.3 bits (61), Expect = 0.75 Identities = 13/42 (30%), Positives = 19/42 (45%), Gaps = 8/42 (19%) Query: 57 LMVEGG--LLSSVSNDSAHQLALLEGKR------SLAVHIAS 90 L + GG + S +S DS +L + EG S V I + Sbjct: 27 LEIAGGNKITSIISLDSVEELGVKEGAELTAVVKSTDVMILA 68 >3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} (A:275-342) Length = 68 Score = 27.3 bits (61), Expect = 0.83 Identities = 8/40 (20%), Positives = 14/40 (35%) Query: 47 TPEGRFVLTDLMVEGGLLSSVSNDSAHQLALLEGKRSLAV 86 G V + L ++ SA ++ L G + A Sbjct: 25 WVLGALVRVKVDCGVPLNVLITRRSAEEMELSPGVQIYAR 64 >2z00_A Dihydroorotase; zinc binding protein, hydrolase, metal-binding, pyrimidine biosynthesis, structural genomics, NPPSFA; 2.42A {Thermus thermophilus HB8} (A:1-50,A:319-426) Length = 158 Score = 27.1 bits (60), Expect = 0.87 Identities = 13/81 (16%), Positives = 25/81 (30%), Gaps = 20/81 (24%) Query: 47 TPEGRFVLTDLMVEGGLLSSVSNDSAHQ-------------------LALLEGKRSLAVH 87 G D+++ G + S+ A Q + LE L Sbjct: 11 DARGERGPADVLIGEGRILSLEGGEAKQVVDGTGCFLAPGLLRAPFGIPSLEVAFPLLYT 70 Query: 88 IASNCG-LSFERIVQMYSDNP 107 +R+V++++D P Sbjct: 71 ELHLKRGFPLQRLVELFTDGP 91 >1h9m_A MODG, molybdenum-binding-protein; molybdate homeostasis; 1.65A {Azotobacter vinelandii} (A:66-137) Length = 72 Score = 26.9 bits (60), Expect = 1.1 Identities = 10/42 (23%), Positives = 18/42 (42%), Gaps = 2/42 (4%) Query: 47 TPEGRFVLTDLMVEGG--LLSSVSNDSAHQLALLEGKRSLAV 86 L ++GG + S V+ ++ +L L G + AV Sbjct: 27 ETGAVNAEVTLALQGGTEITSMVTKEAVAELGLKPGASASAV 68 >2ob3_A Parathion hydrolase; metalloenzyme, TIM barrel, nerve agents; HET: KCX BTB; 1.04A {Brevundimonas diminuta} PDB: 1psc_A* 1jgm_A* 3cak_A* 1ez2_A* 1eyw_A* 1hzy_A 1i0b_A 1i0d_A 1p6b_A* 1p6c_A* 2oql_A* 2o4q_A* 3cs2_A* 3e3h_A* 1qw7_A* 1dpm_A* 2o4m_A* 1pta_A 3c86_A* 2d2j_A ... (A:) Length = 330 Score = 26.1 bits (55), Expect = 1.8 Identities = 4/26 (15%), Positives = 8/26 (30%) Query: 83 SLAVHIASNCGLSFERIVQMYSDNPR 108 + G+ E + + NP Sbjct: 296 LRVIPFLREKGVPQETLAGITVTNPA 321 >1fr3_A MOP, molybdate/tungstate binding protein; molybdate homeostasis, metal binding protein; 1.50A {Sporomusa ovata} (A:) Length = 67 Score = 26.1 bits (58), Expect = 1.8 Identities = 8/41 (19%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Query: 47 TPEGRFVLTDLMVEGG-LLSSVSNDSAHQLALLEGKRSLAV 86 + +G L+++++ DS L L+ G + A+ Sbjct: 17 VKGTVMAKIVMDYKGTELVAAITIDSVADLDLVPGDKVTAL 57 >1o12_A N-acetylglucosamine-6-phosphate deacetylase; structural genomics, TM0814, JCSG, PSI, protein structure initiative; 2.50A {Thermotoga maritima} (A:57-344) Length = 288 Score = 25.8 bits (55), Expect = 2.2 Identities = 14/98 (14%), Positives = 28/98 (28%), Gaps = 8/98 (8%) Query: 19 GYTVDSDALARQLEEDERRIRHYKHVYSTPEGR--FVLTDLMVEGGLLSSVSNDSAHQLA 76 D L+R+ + +++ + + L D G L D +L Sbjct: 181 ELICDGVHLSREXVKLVYKVKKANGIVLVTDSISAAGLKDGTTTLGDLVVKVKDGVPRLE 240 Query: 77 ---LLEGKRSLAV---HIASNCGLSFERIVQMYSDNPR 108 L + + G S + ++ S N Sbjct: 241 DGTLAGSTLFFSQAVKNFRKFTGCSITELAKVSSYNSC 278 >3k2g_A Resiniferatoxin-binding, phosphotriesterase- related protein; TIM barrel, binuclear zinc, protein structure initiative II (PSI II); 1.80A {Rhodobacter sphaeroides 2} (A:) Length = 364 Score = 25.8 bits (55), Expect = 2.3 Identities = 5/24 (20%), Positives = 8/24 (33%) Query: 85 AVHIASNCGLSFERIVQMYSDNPR 108 + GL + + NPR Sbjct: 326 FLPRLRRHGLDDAALETLXVTNPR 349 >2vhl_A N-acetylglucosamine-6-phosphate deacetylase; N- acetyleglucosamine-6-phosphate, carbohydrate metabolism, hydrolase; HET: GLP PGE; 2.05A {Bacillus subtilis} (A:59-358) Length = 300 Score = 25.6 bits (55), Expect = 2.4 Identities = 14/74 (18%), Positives = 22/74 (29%), Gaps = 7/74 (9%) Query: 38 IRHYKHVYSTPEGRFVLT--DLMVEGGLLSSVSNDSAHQ-LALLEGKRSLAVHIASNCGL 94 I +G + + V G A L + EG R H+ Sbjct: 221 ITDSMRAKGLKDGVYEFGGQSVTVRGRTALLSDGTLAGSILKMNEGAR----HMREFTNC 276 Query: 95 SFERIVQMYSDNPR 108 S+ I + S+N Sbjct: 277 SWTDIANITSENAA 290 >3d64_A Adenosylhomocysteinase; structural genomics, ssgcid, S-adenosyl-L-homocysteine hydrolase, cytoplasm, NAD, one-carbon metabolism; HET: NAD; 2.30A {Burkholderia pseudomallei 1710B} PDB: 3glq_A* (A:247-409) Length = 163 Score = 24.8 bits (53), Expect = 3.8 Identities = 6/49 (12%), Positives = 15/49 (30%), Gaps = 2/49 (4%) Query: 3 NFRKLADMIKSKVLSRGYTVDSDALARQLEEDERRIRHYKHVYSTPEGR 51 + + + + + A RQ + I+ P+G+ Sbjct: 104 HMKAMRHNAIVCNIGHFDSEIDVASTRQYQ--WENIKPQVDHIIFPDGK 150 >1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} (A:124-315) Length = 192 Score = 24.4 bits (52), Expect = 5.6 Identities = 3/33 (9%), Positives = 6/33 (18%) Query: 16 LSRGYTVDSDALARQLEEDERRIRHYKHVYSTP 48 ++ + L Y P Sbjct: 143 VAVDQGGCVETLHPTSHTQPTYEVFGVVHYGVP 175 >1eia_A EIAV capsid protein P26; viral capsid, HIV, lentivirus, viral protein; 2.70A {Equine infectious anemia virus} (A:1-137) Length = 137 Score = 24.2 bits (52), Expect = 5.9 Identities = 1/15 (6%), Positives = 6/15 (40%) Query: 94 LSFERIVQMYSDNPR 108 + +++ P+ Sbjct: 120 EAMSEGIKVMIGKPK 134 >2z4i_A Copper homeostasis protein CUTF; outer memblane lipoprotein, beta barrel, OB-fold, 3D domain swapping, signaling protein activator; HET: P6G; 2.60A {Escherichia coli} PDB: 2z4h_A* (A:114-233) Length = 120 Score = 24.4 bits (53), Expect = 5.9 Identities = 12/45 (26%), Positives = 17/45 (37%), Gaps = 5/45 (11%) Query: 20 YTVDSDALARQLEEDERRIRH--YKHVYSTPEGRFVLTDLMVEGG 62 + V ++A +LE R K V + EG F L G Sbjct: 38 FXVANNA---ELERSYLAARGHSEKPVLLSVEGHFTLEGNPDTGA 79 >1onw_A Isoaspartyl dipeptidase; amidohydrolase, hydrolase, metalloprotease; HET: KCX; 1.65A {Escherichia coli} (A:64-347) Length = 284 Score = 24.4 bits (51), Expect = 6.1 Identities = 6/70 (8%), Positives = 16/70 (22%) Query: 38 IRHYKHVYSTPEGRFVLTDLMVEGGLLSSVSNDSAHQLALLEGKRSLAVHIASNCGLSFE 97 I + +D N + +A E + + S Sbjct: 204 IARAVQAGIPLARVTLSSDGNGSQPFFDDEGNLTHIGVAGFETLLETVQVLVKDYDFSIS 263 Query: 98 RIVQMYSDNP 107 ++ + + Sbjct: 264 DALRPLTSSV 273 >1zt2_A DNA primase small subunit; heterodimeric complex, replication, transferase; HET: DNA; 3.33A {Sulfolobus solfataricus} (A:97-106,A:143-236) Length = 104 Score = 24.0 bits (52), Expect = 7.6 Identities = 11/42 (26%), Positives = 15/42 (35%), Gaps = 3/42 (7%) Query: 18 RGY--TVDSDALARQLEEDERR-IRHYKHVYSTPEGRFVLTD 56 RG+ VD L+ DER+ I Y P + Sbjct: 44 RGFHVQVDCYGNCALLDSDERKEIAEYVMGIGVPGYPGGSEN 85 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.320 0.134 0.372 Gapped Lambda K H 0.267 0.0411 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 783,158 Number of extensions: 30471 Number of successful extensions: 134 Number of sequences better than 10.0: 1 Number of HSP's gapped: 134 Number of HSP's successfully gapped: 25 Length of query: 109 Length of database: 4,956,049 Length adjustment: 65 Effective length of query: 44 Effective length of database: 2,758,724 Effective search space: 121383856 Effective search space used: 121383856 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)