RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254781212|ref|YP_003065625.1| hypothetical protein CLIBASIA_05595 [Candidatus Liberibacter asiaticus str. psy62] (109 letters) >d1jb0b_ f.29.1.1 (B:) Apoprotein a2, PsaB {Synechococcus elongatus [TaxId: 32046]} Length = 739 Score = 27.5 bits (61), Expect = 0.31 Identities = 15/70 (21%), Positives = 23/70 (32%), Gaps = 18/70 (25%) Query: 38 IRHYKHVYSTPEGRFVLTDLMVEGG-------------LLSSVSNDSAHQLALLEGKRSL 84 +R +Y +L L + G + + H LA L G SL Sbjct: 128 MRTNGDLYQGAIFLLILASLALFAGWLHLQPKFRPSLSWFKNAESRLNHHLAGLFGVSSL 187 Query: 85 A-----VHIA 89 A +H+A Sbjct: 188 AWAGHLIHVA 197 >d1onwa2 c.1.9.13 (A:63-346) Isoaspartyl dipeptidase, catalytic domain {Escherichia coli [TaxId: 562]} Length = 284 Score = 25.5 bits (54), Expect = 1.2 Identities = 9/92 (9%), Positives = 23/92 (25%) Query: 16 LSRGYTVDSDALARQLEEDERRIRHYKHVYSTPEGRFVLTDLMVEGGLLSSVSNDSAHQL 75 +G T+D + + I + +D N + + Sbjct: 183 ARKGGTIDITSSIDEPVAPAEGIARAVQAGIPLARVTLSSDGNGSQPFFDDEGNLTHIGV 242 Query: 76 ALLEGKRSLAVHIASNCGLSFERIVQMYSDNP 107 A E + + S ++ + + Sbjct: 243 AGFETLLETVQVLVKDYDFSISDALRPLTSSV 274 >d1guta_ b.40.6.1 (A:) Molybdate/tungstate binding protein MOP {Clostridium pasteurianum, MOP II [TaxId: 1501]} Length = 67 Score = 25.4 bits (56), Expect = 1.4 Identities = 13/42 (30%), Positives = 19/42 (45%), Gaps = 8/42 (19%) Query: 57 LMVEGG--LLSSVSNDSAHQLALLEGKR------SLAVHIAS 90 L + GG + S +S DS +L + EG S V I + Sbjct: 26 LEIAGGNKITSIISLDSVEELGVKEGAELTAVVKSTDVMILA 67 >d12asa_ d.104.1.1 (A:) Asparagine synthetase {Escherichia coli [TaxId: 562]} Length = 327 Score = 25.4 bits (56), Expect = 1.5 Identities = 12/29 (41%), Positives = 14/29 (48%), Gaps = 2/29 (6%) Query: 17 SRGYTVDSDALARQLEE--DERRIRHYKH 43 S G VD+D L QL DE R+ H Sbjct: 248 SMGIRVDADTLKHQLALTGDEDRLELEWH 276 >d1h9ma1 b.40.6.2 (A:1-73) Cytoplasmic molybdate-binding protein ModG {Azotobacter vinelandii [TaxId: 354]} Length = 73 Score = 25.1 bits (55), Expect = 1.7 Identities = 12/34 (35%), Positives = 16/34 (47%) Query: 53 VLTDLMVEGGLLSSVSNDSAHQLALLEGKRSLAV 86 V L L + V+ +SA L L GK +AV Sbjct: 25 VDILLGGGDKLAAVVTLESARSLQLAAGKEVVAV 58 >d1i0da_ c.1.9.3 (A:) Phosphotriesterase (parathion hydrolase, PTE) {Pseudomonas diminuta [TaxId: 293]} Length = 331 Score = 25.1 bits (53), Expect = 1.9 Identities = 4/16 (25%), Positives = 7/16 (43%) Query: 93 GLSFERIVQMYSDNPR 108 G+ E + + NP Sbjct: 306 GVPQETLAGITVTNPA 321 >d1h9ma2 b.40.6.2 (A:74-141) Cytoplasmic molybdate-binding protein ModG {Azotobacter vinelandii [TaxId: 354]} Length = 68 Score = 24.6 bits (54), Expect = 2.6 Identities = 10/32 (31%), Positives = 18/32 (56%), Gaps = 2/32 (6%) Query: 57 LMVEGG--LLSSVSNDSAHQLALLEGKRSLAV 86 L ++GG + S V+ ++ +L L G + AV Sbjct: 26 LALQGGTEITSMVTKEAVAELGLKPGASASAV 57 >d1e6va2 d.58.31.2 (A:8-272) Alpha chain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Length = 265 Score = 24.5 bits (53), Expect = 2.7 Identities = 16/50 (32%), Positives = 24/50 (48%), Gaps = 7/50 (14%) Query: 33 EDERRIRHYKHVYSTPEGRFVL-------TDLMVEGGLLSSVSNDSAHQL 75 +ER + HY P G+ L TD+ VEG L+ V+N + Q+ Sbjct: 44 VEERGVPHYNPDIGVPLGQRKLMSYQVSGTDVFVEGDDLTFVNNAAMQQM 93 >d1fr3a_ b.40.6.1 (A:) Molybdate/tungstate binding protein MOP {Sporomusa ovata [TaxId: 2378]} Length = 67 Score = 24.2 bits (53), Expect = 3.0 Identities = 7/50 (14%), Positives = 19/50 (38%), Gaps = 7/50 (14%) Query: 47 TPEGRFVLTDLMVEGG-LLSSVSNDSAHQLALLEGKR------SLAVHIA 89 + +G L+++++ DS L L+ G + + + + Sbjct: 17 VKGTVMAKIVMDYKGTELVAAITIDSVADLDLVPGDKVTALVKATEMEVL 66 >d1dj0a_ d.265.1.1 (A:) Pseudouridine synthase I TruA {Escherichia coli [TaxId: 562]} Length = 264 Score = 24.2 bits (51), Expect = 3.0 Identities = 9/31 (29%), Positives = 11/31 (35%), Gaps = 2/31 (6%) Query: 76 ALLEGKRSLAVHIASNCGLSFERIVQMYSDN 106 L R+LA A GL + Y D Sbjct: 221 LLAAKDRTLAAATAKAEGLYLVAVD--YPDR 249 >d1hbna2 d.58.31.2 (A:2-269) Alpha chain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 268 Score = 24.1 bits (52), Expect = 3.5 Identities = 17/50 (34%), Positives = 22/50 (44%), Gaps = 7/50 (14%) Query: 33 EDERRIRHYKHVYSTPEGRFVL-------TDLMVEGGLLSSVSNDSAHQL 75 +R I Y TP G+ VL TD VEG L V+N + Q+ Sbjct: 47 AAKRGIPQYNPDIGTPLGQRVLMPYQVSTTDTYVEGDDLHFVNNAAMQQM 96 >d1w2ya_ a.204.1.1 (A:) Type II deoxyuridine triphosphatase {Campylobacter jejuni [TaxId: 197]} Length = 229 Score = 23.9 bits (51), Expect = 4.2 Identities = 16/86 (18%), Positives = 28/86 (32%), Gaps = 9/86 (10%) Query: 20 YTVDSDALARQLEEDERRIRHYKHVYSTPEGRF--VLTDLMVEGGLLSSVSNDSAHQLAL 77 D A+A ++ K EG +L D+ + S + L+ Sbjct: 94 NNKDFKAIATEVNAVSVFQDFCKEEEYPNEGDIYGILNDIELIIHKCSGFGFNLGELLST 153 Query: 78 LEGKRSLAVHIASNCGLSFERIVQMY 103 +A CGL+ E + + Y Sbjct: 154 YFT-------LAIKCGLNLEILYKTY 172 >d2z0da1 d.3.1.22 (A:5-354) Cysteine protease ATG4B {Human (Homo sapiens) [TaxId: 9606]} Length = 350 Score = 23.8 bits (51), Expect = 4.4 Identities = 11/36 (30%), Positives = 19/36 (52%) Query: 74 QLALLEGKRSLAVHIASNCGLSFERIVQMYSDNPRY 109 +LA+ + SLAVHIA + + E I ++ + Sbjct: 150 KLAVFDTWSSLAVHIAMDNTVVMEEIRRLCRTSVPC 185 >d2q7wa1 c.67.1.1 (A:1-396) Aspartate aminotransferase, AAT {Escherichia coli [TaxId: 562]} Length = 396 Score = 23.4 bits (49), Expect = 5.1 Identities = 7/21 (33%), Positives = 10/21 (47%) Query: 32 EEDERRIRHYKHVYSTPEGRF 52 +E R+R VY+ GR Sbjct: 355 KEQVLRLREEFGVYAVASGRV 375 >d1xrta2 c.1.9.6 (A:56-365) Two-domain dihydroorotase {Aquifex aeolicus [TaxId: 63363]} Length = 310 Score = 23.4 bits (49), Expect = 5.7 Identities = 5/26 (19%), Positives = 15/26 (57%) Query: 83 SLAVHIASNCGLSFERIVQMYSDNPR 108 A+ + +S +++++M++ NP Sbjct: 277 PSALELYRKGIISLKKLIEMFTINPA 302 >d2ay1a_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Paracoccus denitrificans [TaxId: 266]} Length = 394 Score = 23.0 bits (48), Expect = 6.4 Identities = 5/21 (23%), Positives = 9/21 (42%) Query: 32 EEDERRIRHYKHVYSTPEGRF 52 E +RI+ +Y + R Sbjct: 352 PEQVKRIKEEFGIYMVGDSRI 372 >d1ajsa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Pig (Sus scrofa), cytosolic form [TaxId: 9823]} Length = 412 Score = 23.0 bits (48), Expect = 6.4 Identities = 6/21 (28%), Positives = 10/21 (47%) Query: 32 EEDERRIRHYKHVYSTPEGRF 52 + + + KH+Y P GR Sbjct: 367 PKQVEYLINQKHIYLLPSGRI 387 >d2f8aa1 c.47.1.10 (A:12-195) Glutathione peroxidase {Human (Homo sapiens) [TaxId: 9606]} Length = 184 Score = 23.0 bits (48), Expect = 6.7 Identities = 11/35 (31%), Positives = 14/35 (40%) Query: 75 LALLEGKRSLAVHIASNCGLSFERIVQMYSDNPRY 109 L L GK L ++AS G + QM R Sbjct: 19 LGSLRGKVLLIENVASLGGTTVRDYTQMNELQRRL 53 >d1x2ga2 d.104.1.3 (A:1-246) Two-domain LplA, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 246 Score = 23.2 bits (49), Expect = 6.8 Identities = 5/28 (17%), Positives = 14/28 (50%) Query: 25 DALARQLEEDERRIRHYKHVYSTPEGRF 52 + + RQ+ +R + +++ + GR Sbjct: 21 ECIFRQMPATQRVLFLWRNADTVVIGRA 48 >d1seta1 a.2.7.1 (A:1-110) Seryl-tRNA synthetase (SerRS) {Thermus thermophilus, strain hb27 [TaxId: 274]} Length = 110 Score = 23.0 bits (49), Expect = 7.2 Identities = 7/34 (20%), Positives = 14/34 (41%), Gaps = 3/34 (8%) Query: 4 FRKLADMIKSKVLSRGYTVDSDALARQLEEDERR 37 R+ ++ + +G +D +AL L D Sbjct: 7 LRQEPEVFHRAIREKGVALDLEAL---LALDREV 37 >d2p82a1 d.3.1.22 (A:26-359) Cysteine protease ATG4A {Human (Homo sapiens) [TaxId: 9606]} Length = 334 Score = 23.0 bits (49), Expect = 7.4 Identities = 11/35 (31%), Positives = 19/35 (54%) Query: 73 HQLALLEGKRSLAVHIASNCGLSFERIVQMYSDNP 107 +LAL + SLAV+++ + + E I +M P Sbjct: 131 KKLALFDEWNSLAVYVSMDNTVVIEDIKKMCRVLP 165 >d3tata_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Escherichia coli [TaxId: 562]} Length = 397 Score = 23.0 bits (48), Expect = 7.7 Identities = 6/21 (28%), Positives = 7/21 (33%) Query: 32 EEDERRIRHYKHVYSTPEGRF 52 R+R VY GR Sbjct: 356 AAQVDRLREEFGVYLIASGRM 376 >d1e6ya2 d.58.31.2 (A:1002-1283) Alpha chain {Archaeon Methanosarcina barkeri [TaxId: 2208]} Length = 282 Score = 22.6 bits (48), Expect = 8.3 Identities = 12/52 (23%), Positives = 21/52 (40%), Gaps = 9/52 (17%) Query: 33 EDERRIRHY--KHVYSTPEGRFVL-------TDLMVEGGLLSSVSNDSAHQL 75 ++R I Y P G+ + TD++ E L V+N + Q+ Sbjct: 59 AEKRGIAFYNPMMHSGAPLGQRAITPYTISGTDIVCEPDDLHYVNNAAMQQM 110 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.320 0.134 0.372 Gapped Lambda K H 0.267 0.0438 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 381,731 Number of extensions: 15170 Number of successful extensions: 71 Number of sequences better than 10.0: 1 Number of HSP's gapped: 71 Number of HSP's successfully gapped: 28 Length of query: 109 Length of database: 2,407,596 Length adjustment: 68 Effective length of query: 41 Effective length of database: 1,473,956 Effective search space: 60432196 Effective search space used: 60432196 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.6 bits)