BLAST/PSIBLAST alignment of GI: 254781213 and GI: 221213955 at iteration 1
>gi|221213955|ref|ZP_03586928.1| conserved hypothetical protein [Burkholderia multivorans CGD1] Length = 549
>gi|221166132|gb|EED98605.1| conserved hypothetical protein [Burkholderia multivorans CGD1] Length = 549
 Score =  210 bits (535), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 134/451 (29%), Positives = 217/451 (48%), Gaps = 31/451 (6%)

Query: 44  RMWDTTGSEACIKLSSLLSSLITPPGQKWHGLAESFSAYQAFLYKEDARSKKVREWCDQV 103
           RM+D+T   A     + + S+ITP  Q WH L  S  A              V+ +   V
Sbjct: 61  RMFDSTAPLALRNFVAAMDSMITPATQVWHRLKTSNDALNEV--------PSVKAYLQAV 112

Query: 104 TDTLFGFRERSRSGFVGCLQSFYTSVVEFGTGCFYMEADVDEKGLEEGIRYISVPLSNVY 163
              LF  R R + GF   + + Y S+  FG G   +E DV       GI Y +VP+  ++
Sbjct: 113 VRALFAVRYRWQGGFTTQMGATYQSIGLFGPGALMIEHDVGH-----GIVYRNVPMQRLW 167

Query: 164 MSVNHQNVVDSVYREFTFTVDQIVSKWGDKVLSSKMKSALARNENERFTIIHAVYPKSLT 223
            + N+  ++D  +  +  T+ Q   ++G + LS  M++AL R+  +  T  H V P++  
Sbjct: 168 FAENNAGLIDKTHVLWRLTLRQAAQRFGRENLSPSMQTALERDPEKTHTFYHVVEPRADR 227

Query: 224 DKKK-DKGNKGFHSKFVSVDENRFFEEKQIATFPYIVGRYRVRADEIYGRSPAMEALPTI 282
           D +K D  N  F S ++    +R  +     TFP+ +GR+ V  D++YG SPA +A+P I
Sbjct: 228 DPRKLDGRNMRFGSYWLDEGRDRIIQNSGFRTFPFAIGRFYVGTDDVYGGSPAYDAMPDI 287

Query: 283 RRLNETVNELAQFGRLSLHPPTIAVSEAKQRNFDLKPGYMNIGALSREGRSLFQPVQFGN 342
           R  N+      +  +  + PP +A  +     FDL+ G +N G L   G  + +P+  G 
Sbjct: 288 RMANDMAKTNIRGAQKMVDPPLLASEDGVLEGFDLRSGSLNWGGLDERGNEMVKPLLTGK 347

Query: 343 PLPYHEELNR-LKESIRSLFLLDLFQVLDDKASRSAAESMEKTREKGAFVGPLIGGLQSE 401
                 E ++  +++I   F + LFQ+L D    +A E +++ +EKG  + P +G  Q+E
Sbjct: 348 QAQIGIEFSQDTRQTINQWFYVTLFQILVDSGDMTATEVLQRAQEKGVLLAPTLGRTQAE 407

Query: 402 FIGAMISRELDILDSQGNLPEC------EGADNPPVSLLKVEYTSPLFKYQQAESVASAL 455
            +G +I RE+DIL   G  P         GAD      + VEY SPL K  +A   A+ L
Sbjct: 408 LLGPLIQREVDILAEAGQFPPMPQELIDAGAD------VDVEYDSPLNKAMRAGEGAAIL 461

Query: 456 QGVNTVVELGVKTG-DPSCMDHMDTDRVSRF 485
           Q +    +LGV    DP+    ++  R+ + 
Sbjct: 462 QWLQ---QLGVVAQFDPNAAKLVNGHRIGKL 489