RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254781213|ref|YP_003065626.1| head-to-tail joining protein, putative [Candidatus Liberibacter asiaticus str. psy62] (556 letters) >d1fxkc_ a.2.5.1 (C:) Prefoldin alpha subunit {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 133 Score = 29.1 bits (65), Expect = 0.85 Identities = 8/55 (14%), Positives = 22/55 (40%), Gaps = 6/55 (10%) Query: 501 AEVEDIRQQREVQRRVMEEQHLQQQLQQTSQDIG----AKAAGRAMEKKLTHDMM 551 A + +I Q + + + + +QQQ++ I + ++ K + + Sbjct: 1 AALAEIVAQLNIYQS--QVELIQQQMEAVRATISELEILEKTLSDIQGKDGSETL 53 >d1gdha2 c.23.12.1 (A:2-100,A:292-321) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Length = 129 Score = 28.8 bits (64), Expect = 1.3 Identities = 6/31 (19%), Positives = 11/31 (35%) Query: 473 CMDHMDTDRVSRFSLWATNTPAVLIRDTAEV 503 DH+D D + N P + ++ Sbjct: 77 GFDHIDLDACKARGIKVGNAPHGATQAREDM 107 >d1qrea_ b.81.1.5 (A:) gamma-carbonic anhydrase {Archaeon Methanosarcina thermophila [TaxId: 2210]} Length = 210 Score = 27.7 bits (60), Expect = 2.5 Identities = 7/50 (14%), Positives = 16/50 (32%), Gaps = 2/50 (4%) Query: 481 RVSRFSLWATNTPAVLIRDTAEVEDIRQQREVQRRVMEEQHLQQQLQQTS 530 + + + A + + + E V HL + ++TS Sbjct: 163 YIPAGMVVTSQAEADKLPEVTDDYAYSHTNEAVVYV--NVHLAEGYKETS 210 >d2f4pa1 b.82.1.9 (A:2-135) Hypothetical protein TM1010 {Thermotoga maritima [TaxId: 2336]} Length = 134 Score = 25.7 bits (56), Expect = 9.1 Identities = 10/42 (23%), Positives = 12/42 (28%), Gaps = 3/42 (7%) Query: 65 ITPPGQK-WHGLAESFSAYQAFLYKEDARSKKVREWCDQVTD 105 PP WHG A + EW VT+ Sbjct: 85 EIPPNVVHWHG-AAPDEELV-HIGISTQVHLGPAEWLGSVTE 124 >d1h30a1 b.29.1.4 (A:261-451) Growth-arrest-specific protein Gas6 {Human (Homo sapiens) [TaxId: 9606]} Length = 191 Score = 25.5 bits (55), Expect = 9.9 Identities = 3/23 (13%), Positives = 8/23 (34%) Query: 103 VTDTLFGFRERSRSGFVGCLQSF 125 + + GC++S+ Sbjct: 166 IPFHEKDLVQPINPRLDGCMRSW 188 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.317 0.133 0.384 Gapped Lambda K H 0.267 0.0659 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 1,983,959 Number of extensions: 91277 Number of successful extensions: 281 Number of sequences better than 10.0: 1 Number of HSP's gapped: 281 Number of HSP's successfully gapped: 13 Length of query: 556 Length of database: 2,407,596 Length adjustment: 90 Effective length of query: 466 Effective length of database: 1,171,896 Effective search space: 546103536 Effective search space used: 546103536 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 55 (25.1 bits)