Query         gi|254781216|ref|YP_003065629.1| hypothetical protein CLIBASIA_05615 [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 38
No_of_seqs    1 out of 3
Neff          1.0 
Searched_HMMs 39220
Date          Mon May 30 06:10:24 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254781216.hhm -d /home/congqian_1/database/cdd/Cdd.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 TIGR02034 CysN sulfate adenyly  38.3      12 0.00029   19.8   0.6   15    2-16    229-243 (411)
  2 PRK00768 nadE NAD synthetase;   18.4      31  0.0008   17.7  -0.2   11   15-25    264-274 (274)
  3 TIGR02540 gpx7 putative glutat  13.3 1.3E+02  0.0033   14.8   1.9   32    2-33    114-145 (153)
  4 pfam02994 Transposase_22 L1 tr  12.5      71  0.0018   16.1   0.4   21   14-34    247-267 (370)
  5 cd07050 BMC_EutL_repeat2 ethan  11.3      94  0.0024   15.5   0.7   13    2-14     48-60  (87)
  6 KOG4030 consensus               11.3 1.1E+02  0.0027   15.2   1.0   18   20-37     97-114 (197)
  7 pfam10333 Pga1 GPI-Mannosyltra  10.9 1.8E+02  0.0047   14.1   2.8   34    3-36    101-134 (180)
  8 cd03003 PDI_a_ERdj5_N PDIa fam   9.7 1.3E+02  0.0033   14.8   0.9   20    6-25      8-27  (101)
  9 cd06060 misato Human Misato sh   9.1      57  0.0014   16.5  -1.1   17    8-30     10-26  (493)
 10 TIGR00478 tly hemolysin A; Int   8.8      90  0.0023   15.6  -0.2   14    6-20    128-141 (240)

No 1  
>TIGR02034 CysN sulfate adenylyltransferase, large subunit; InterPro: IPR011779    Metabolic assimilation of sulphur from inorganic sulphate, requires sulphate activation by coupling to a nucleoside, for the production of high-energy nucleoside phosphosulphates. This pathway appears to be similar in all prokaryotic organisms. Activation is first achieved through sulphation of sulphate with ATP by sulphate adenylyltransferase (ATP sulphurylase) to produce 5'-phosphosulphate (APS), coupled by GTP hydrolysis. Subsequently, APS is phosphorylated by an APS kinase to produce 3'-phosphoadenosine-5'-phosphosulphate (PAPS) . In Escherichia coli, ATP sulphurylase is a heterodimer composed of two subunits encoded by cysD and cysN, with APS kinase encoded by cysC. These genes are located in a unidirectionally transcribed gene cluster, and have been shown to be required for the synthesis of sulphur-containing amino acids . Homologous to this E. coli activation pathway are nodPQH gene products found among members of the Rhizobiaceae family. These gene products have been shown to exhibit ATP sulphurase and APS kinase activity, yet are involved in Nod factor sulphation, and sulphation of other macromolecules . With members of the Rhizobiaceae family, nodQ often appears as a fusion of cysN (large subunit of ATP sulphurase) and cysC (APS kinase) , .; GO: 0016772 transferase activity transferring phosphorus-containing groups.
Probab=38.33  E-value=12  Score=19.77  Aligned_cols=15  Identities=53%  Similarity=0.966  Sum_probs=12.7

Q ss_pred             CCCCCCCCCCCCCCC
Q ss_conf             787856502011699
Q gi|254781216|r    2 GRPPETNFKGYIGTP   16 (38)
Q Consensus         2 grppetnfkgyigtp   16 (38)
                      -||-.|+|.||-||-
T Consensus       229 nRPn~tdFRGyaGt~  243 (411)
T TIGR02034       229 NRPNLTDFRGYAGTI  243 (411)
T ss_pred             ECCCCCCCCCHHHHE
T ss_conf             268886665222310


No 2  
>PRK00768 nadE NAD synthetase; Reviewed
Probab=18.41  E-value=31  Score=17.72  Aligned_cols=11  Identities=55%  Similarity=1.087  Sum_probs=7.9

Q ss_pred             CCCEEEEEEEE
Q ss_conf             99858999982
Q gi|254781216|r   15 TPPTIFIKFWN   25 (38)
Q Consensus        15 tpptifikfwn   25 (38)
                      -||++|.+||.
T Consensus       264 ~P~~~~~~~~~  274 (274)
T PRK00768        264 LPITIFDDFWK  274 (274)
T ss_pred             CCCCCCCCCCC
T ss_conf             98996455236


No 3  
>TIGR02540 gpx7 putative glutathione peroxidase Gpx7; InterPro: IPR013376    This model represents one of several families of known and probable glutathione peroxidases. It is restricted to animals and designated GPX7.; GO: 0004602 glutathione peroxidase activity, 0006979 response to oxidative stress.
Probab=13.30  E-value=1.3e+02  Score=14.84  Aligned_cols=32  Identities=31%  Similarity=0.576  Sum_probs=27.1

Q ss_pred             CCCCCCCCCCCCCCCCEEEEEEEECCCCCEEE
Q ss_conf             78785650201169985899998224430110
Q gi|254781216|r    2 GRPPETNFKGYIGTPPTIFIKFWNIEESSAIL   33 (38)
Q Consensus         2 grppetnfkgyigtpptifikfwnieessail   33 (38)
                      ++-|.=||=-|+-.|---.++||.=+++-+-.
T Consensus       114 ~K~P~WNFWKyLV~P~G~VV~~W~P~~~~~~i  145 (153)
T TIGR02540       114 KKEPRWNFWKYLVDPEGQVVKFWRPEEPVEEI  145 (153)
T ss_pred             CCCCCCCCEEEEECCCCCEEEECCCCCCHHHH
T ss_conf             78888340347678997085522898628886


No 4  
>pfam02994 Transposase_22 L1 transposable element.
Probab=12.55  E-value=71  Score=16.07  Aligned_cols=21  Identities=29%  Similarity=0.366  Sum_probs=16.3

Q ss_pred             CCCCEEEEEEEECCCCCEEEC
Q ss_conf             699858999982244301100
Q gi|254781216|r   14 GTPPTIFIKFWNIEESSAILH   34 (38)
Q Consensus        14 gtpptifikfwnieessailh   34 (38)
                      -||-.|.|||||++.---||.
T Consensus       247 ~tpRhIivkf~~~~~KEkiL~  267 (370)
T pfam02994       247 NTSRHIIVRTTNAENKERILK  267 (370)
T ss_pred             CCCCEEEEECCCCCCHHHHHH
T ss_conf             887548997575200899999


No 5  
>cd07050 BMC_EutL_repeat2 ethanolamine utilization protein S (EutS), Bacterial Micro-Compartment (BMC) domain repeat 2. EutL proteins are homologs of the carboxysome shell protein. They are encoded within the eut operon and might be required for the formation of the outer shell of the bacterial eut polyhedral organelles which are involved in the cobalamin-dependent degradation of ethanolamine. Although it has been suggested that EutL might form hexamers and further assemble into the flat facets of the polyhedral outer shell of eut organelles at present no experimental evidence directly supports this view. EutL proteins contain two tandem BMC domains. This CD includes domain 2 (the second BMC domain of EutL).
Probab=11.34  E-value=94  Score=15.49  Aligned_cols=13  Identities=46%  Similarity=0.618  Sum_probs=9.5

Q ss_pred             CCCCCCCCCCCCC
Q ss_conf             7878565020116
Q gi|254781216|r    2 GRPPETNFKGYIG   14 (38)
Q Consensus         2 grppetnfkgyig   14 (38)
                      |-|.||||-|-+-
T Consensus        48 ~PPSetNfgGalL   60 (87)
T cd07050          48 PPPSETNFGGALL   60 (87)
T ss_pred             CCCCCCCCCCEEE
T ss_conf             7996563464455


No 6  
>KOG4030 consensus
Probab=11.29  E-value=1.1e+02  Score=15.23  Aligned_cols=18  Identities=44%  Similarity=0.641  Sum_probs=14.2

Q ss_pred             EEEEEECCCCCEEECCCC
Q ss_conf             999982244301100367
Q gi|254781216|r   20 FIKFWNIEESSAILHNNA   37 (38)
Q Consensus        20 fikfwnieessailhnna   37 (38)
                      -.|+|-|....||-|||.
T Consensus        97 d~~sw~~r~dga~~hnne  114 (197)
T KOG4030          97 DEKSWGIRDDGAIAHNNE  114 (197)
T ss_pred             CCEEEEECCCCCHHCCCH
T ss_conf             632578704882001568


No 7  
>pfam10333 Pga1 GPI-Mannosyltransferase II co-activator. Pga1 is found only in yeasts and not in mammals. It localizes in the ER as a glycosylated integral membrane protein. It binds to the GPI-mannosyltransferase II subunit of the GPI and it is responsible for the second mannose addition to GPI precursors. The GPI-anchoring complex is a glycolipid that functions as a membrane anchor for many cell-surface proteins.
Probab=10.89  E-value=1.8e+02  Score=14.12  Aligned_cols=34  Identities=24%  Similarity=0.471  Sum_probs=27.6

Q ss_pred             CCCCCCCCCCCCCCCEEEEEEEECCCCCEEECCC
Q ss_conf             8785650201169985899998224430110036
Q gi|254781216|r    3 RPPETNFKGYIGTPPTIFIKFWNIEESSAILHNN   36 (38)
Q Consensus         3 rppetnfkgyigtpptifikfwnieessailhnn   36 (38)
                      -|-+|.|+|-...-+.+|+.|--..+|-.+|..+
T Consensus       101 iPh~t~f~gt~sd~aRi~v~F~v~adSYP~l~d~  134 (180)
T pfam10333       101 IPHGTEFQGTWSDEARIYVTFKVVADSYPLLEDG  134 (180)
T ss_pred             ECCCCEECCCCCCCEEEEEEEEECCCCCCCCCCC
T ss_conf             2363556364466505999999525767631348


No 8  
>cd03003 PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains. This subfamily is comprised of the first TRX domain of ERdj5 located after the DnaJ domain at the N-terminal half of the protein. ERdj5 is a ubiquitous protein localized in the endoplasmic reticulum (ER) and is abundant in secretory cells. It's transcription is induced during ER stress. It interacts with BiP through its DnaJ domain in an ATP-dependent manner. BiP, an ER-resident member of the Hsp70 chaperone family, functions in ER-associated degradation and protein translocation.
Probab=9.69  E-value=1.3e+02  Score=14.82  Aligned_cols=20  Identities=15%  Similarity=0.512  Sum_probs=15.5

Q ss_pred             CCCCCCCCCCCCEEEEEEEE
Q ss_conf             56502011699858999982
Q gi|254781216|r    6 ETNFKGYIGTPPTIFIKFWN   25 (38)
Q Consensus         6 etnfkgyigtpptifikfwn   25 (38)
                      ..||...+......|++||.
T Consensus         8 ~~nF~~~v~~~~~~~V~FyA   27 (101)
T cd03003           8 RGDFDAAVNSGEIWFVNFYS   27 (101)
T ss_pred             HHHHHHHHHCCCEEEEEEEC
T ss_conf             88789998369829999968


No 9  
>cd06060 misato Human Misato shows similarity with Tubulin/FtsZ family of GTPases and is localized to the the outer membrane of mitochondria. It has a role in mitochondrial fusion and in mitochondrial distribution and morphology. Mutations in its Drosophila homolog (misato) lead to irregular chromosome segregation during mitosis. Deletion of the budding yeast homolog DML1 is lethal and unregulate expression of DML1 leads to mitochondrial dispersion and abnormalities in cell morphology. The Misato/DML1 protein family is conserved from yeast to human, but its exact function is still unknown.
Probab=9.13  E-value=57  Score=16.52  Aligned_cols=17  Identities=29%  Similarity=1.095  Sum_probs=9.8

Q ss_pred             CCCCCCCCCCEEEEEEEECCCCC
Q ss_conf             50201169985899998224430
Q gi|254781216|r    8 NFKGYIGTPPTIFIKFWNIEESS   30 (38)
Q Consensus         8 nfkgyigtpptifikfwnieess   30 (38)
                      +|-.||||      .|||+.|+.
T Consensus        10 ~~aN~vgt------HfWN~Qe~~   26 (493)
T cd06060          10 HYANFVGT------HWWNLQEAN   26 (493)
T ss_pred             CCCCCHHH------HHHHHHHHH
T ss_conf             75550656------567751422


No 10 
>TIGR00478 tly hemolysin A; InterPro: IPR004538 Hemolysins are exotoxins that attack blood cell membranes and cause cell rupture. The mechanism of action is not well defined. Hemolysin A is induced by sodium ribonucleate, and is produced by pathogenic bacterial strains. Hemolysin A from Treponema hyodysenteriae causes swine dysentry.; GO: 0003723 RNA binding, 0019836 hemolysis by symbiont of host red blood cells.
Probab=8.81  E-value=90  Score=15.57  Aligned_cols=14  Identities=50%  Similarity=1.009  Sum_probs=0.0

Q ss_pred             CCCCCCCCCCCCEEE
Q ss_conf             565020116998589
Q gi|254781216|r    6 ETNFKGYIGTPPTIF   20 (38)
Q Consensus         6 etnfkgyigtpptif   20 (38)
                      +|||+||. ||-+|+
T Consensus       128 R~N~rGy~-T~~d~~  141 (240)
T TIGR00478       128 RTNIRGYV-TPADIV  141 (240)
T ss_pred             CCCCCCCC-CHHHHH
T ss_conf             57874446-656540


Done!