>cd04774 HTH_YfmP Helix-Turn-Helix DNA binding domain of the YfmP transcription regulator. Helix-turn-helix (HTH) transcription regulator, YfmP, and related proteins; N-terminal domain. YfmP regulates the multidrug efflux protein, YfmO, and indirectly regulates the expression of the Bacillus subtilis copZA operon encoding a metallochaperone, CopZ, and a CPx-type ATPase efflux protein, CopA. These proteins belong to the MerR superfamily of transcription regulators that promote expression of several stress regulon genes by reconfiguring the spacer between the -35 and -10 promoter elements. Their conserved N-terminal domains contain predicted winged HTH motifs that mediate DNA binding, while the dissimilar C-terminal domains bind specific coactivator molecules.

Probab=90.63 E-value=1.3 Score=23.53 Aligned_cols=70 Identities=23% Similarity=0.333 Sum_probs=43.5 Q ss_pred CCHHHHHHHHCCCHHHHHHHH-CCCCCCCHHHHHHHHHHHCCCHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHH Q ss_conf 988999998489999999887-7998889999999999828999996145322100002321345546777999999999 Q gi|254781218|r 45 KTQKEMAIGANQLESAVNLFE-NGMCSTSIRYALYLRNEYEISFDWIYDGEVIDRRYEDVTNKKRLDPYAIGARLKSIRK 123 (205) Q Consensus 45 ltQ~elA~~~gis~~~is~~E-~G~~~psi~~l~~la~~~~vs~d~Ll~ge~~~~~~~~~~~~~~~d~~~iG~rLk~lR~ 123 (205) T Consensus 1 ytIgevA~~~Gvs~~tlRyYE~~GLl~P~-R~----~~gyR~--------------Y~----~~dl~---rL~~I~~l~~ 54 (96) T cd04774 1 YKVDEVAKRLGLTKRTLKYYEEIGLVSPE-RS----EGRYRL--------------YS----EEDLK---RLERILRLRE 54 (96) T ss_pred CCHHHHHHHHCCCHHHHHHHHHCCCCCCC-CC----CCCCCC--------------CC----HHHHH---HHHHHHHHHH T ss_conf 94889999989799999999987998998-69----999823--------------59----99999---9999999999 Q ss_pred HCCCCHHHHHHHHCCCH Q ss_conf 72983899999977999 Q gi|254781218|r 124 DKGMSQIEFGKLLGMPN 140 (205) Q Consensus 124 ~~glsq~elA~~lgis~ 140 (205) T Consensus 55 ~lGfsL~eIk~lL~~~~ 71 (96) T cd04774 55 VLGFSLQEVTHFLERPL 71 (96) T ss_pred HCCCCHHHHHHHHCCCC T ss_conf 57998999999981988

HHsearch alignment for GI: 254781218 and conserved domain: cd04774