BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254781218|ref|YP_003065631.1| hypothetical protein CLIBASIA_05625 [Candidatus Liberibacter asiaticus str. psy62] (205 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254781218|ref|YP_003065631.1| hypothetical protein CLIBASIA_05625 [Candidatus Liberibacter asiaticus str. psy62] Length = 205 Score = 421 bits (1082), Expect = e-120, Method: Compositional matrix adjust. Identities = 205/205 (100%), Positives = 205/205 (100%) Query: 1 MFLNPFLETSLKSLQEYTLIITPEIRQYWKDVGTRIKDIRKANNKTQKEMAIGANQLESA 60 MFLNPFLETSLKSLQEYTLIITPEIRQYWKDVGTRIKDIRKANNKTQKEMAIGANQLESA Sbjct: 1 MFLNPFLETSLKSLQEYTLIITPEIRQYWKDVGTRIKDIRKANNKTQKEMAIGANQLESA 60 Query: 61 VNLFENGMCSTSIRYALYLRNEYEISFDWIYDGEVIDRRYEDVTNKKRLDPYAIGARLKS 120 VNLFENGMCSTSIRYALYLRNEYEISFDWIYDGEVIDRRYEDVTNKKRLDPYAIGARLKS Sbjct: 61 VNLFENGMCSTSIRYALYLRNEYEISFDWIYDGEVIDRRYEDVTNKKRLDPYAIGARLKS 120 Query: 121 IRKDKGMSQIEFGKLLGMPNSTLSNYEQGRTIPEIKPARKIKQVTKKHLDWIYFGDEVIV 180 IRKDKGMSQIEFGKLLGMPNSTLSNYEQGRTIPEIKPARKIKQVTKKHLDWIYFGDEVIV Sbjct: 121 IRKDKGMSQIEFGKLLGMPNSTLSNYEQGRTIPEIKPARKIKQVTKKHLDWIYFGDEVIV 180 Query: 181 PKSIKRAKGNQSSKKSKKDKKSSNP 205 PKSIKRAKGNQSSKKSKKDKKSSNP Sbjct: 181 PKSIKRAKGNQSSKKSKKDKKSSNP 205 >537021.9.peg.1101_1 Length = 37 Score = 38.5 bits (88), Expect = 9e-05, Method: Composition-based stats. Identities = 15/22 (68%), Positives = 19/22 (86%) Query: 164 VTKKHLDWIYFGDEVIVPKSIK 185 V KK LDWIYFGDE+I+PK ++ Sbjct: 1 VLKKSLDWIYFGDEMIIPKKLE 22 >gi|254780424|ref|YP_003064837.1| transcriptional regulator protein [Candidatus Liberibacter asiaticus str. psy62] Length = 144 Score = 30.4 bits (67), Expect = 0.024, Method: Compositional matrix adjust. Identities = 19/49 (38%), Positives = 27/49 (55%), Gaps = 2/49 (4%) Query: 103 VTNKKRLDPYAI--GARLKSIRKDKGMSQIEFGKLLGMPNSTLSNYEQG 149 V NKK +P I G R++ R GMSQ + G+ LG+ + YE+G Sbjct: 2 VGNKKIPNPVDINVGKRIRLRRMILGMSQEKLGECLGITFQQVQKYEKG 50 >gi|254780601|ref|YP_003065014.1| ATP-dependent RNA helicase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 573 Score = 24.3 bits (51), Expect = 1.8, Method: Compositional matrix adjust. Identities = 12/45 (26%), Positives = 21/45 (46%), Gaps = 4/45 (8%) Query: 155 IKPARKIKQVTKKHLDWIYFGDEVIVPKSIKRAKGNQSSKKSKKD 199 I P R++ + L+W+Y V+V I G S + ++D Sbjct: 80 IAPTRELAVQVGRELEWLYAKTGVVVAVCI----GGVSVHRERRD 120 >gi|254780750|ref|YP_003065163.1| DNA mismatch repair protein [Candidatus Liberibacter asiaticus str. psy62] Length = 920 Score = 23.5 bits (49), Expect = 2.5, Method: Compositional matrix adjust. Identities = 8/15 (53%), Positives = 12/15 (80%) Query: 130 IEFGKLLGMPNSTLS 144 I+ GKL G+PN+ +S Sbjct: 816 IQVGKLAGLPNTVIS 830 >537021.9.peg.1058_1 Length = 37 Score = 22.7 bits (47), Expect = 5.4, Method: Compositional matrix adjust. Identities = 9/19 (47%), Positives = 12/19 (63%) Query: 174 FGDEVIVPKSIKRAKGNQS 192 GDEVI+PK + R + S Sbjct: 5 LGDEVIIPKKLIRRSASLS 23 >gi|254780147|ref|YP_003064560.1| 50S ribosomal protein L11 [Candidatus Liberibacter asiaticus str. psy62] Length = 142 Score = 21.9 bits (45), Expect = 7.6, Method: Compositional matrix adjust. Identities = 12/37 (32%), Positives = 19/37 (51%), Gaps = 2/37 (5%) Query: 37 KDIRKANNKTQKEMAIGANQLESAVNLFENGMCSTSI 73 ++IRK ++M GA +E A+ + E CS I Sbjct: 104 ENIRKIAQLKMQDM--GAIDIEGAMRMVEGSACSMGI 138 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.315 0.133 0.379 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 130,294 Number of Sequences: 1233 Number of extensions: 5201 Number of successful extensions: 16 Number of sequences better than 100.0: 9 Number of HSP's better than 100.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 7 Number of HSP's gapped (non-prelim): 9 length of query: 205 length of database: 328,796 effective HSP length: 70 effective length of query: 135 effective length of database: 242,486 effective search space: 32735610 effective search space used: 32735610 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 36 (18.5 bits)