RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254781219|ref|YP_003065632.1| hypothetical protein CLIBASIA_05630 [Candidatus Liberibacter asiaticus str. psy62] (200 letters) >gnl|CDD|131269 TIGR02214, spoVD_pbp, stage V sporulation protein D. This model describes the spoVD subfamily of homologs of the cell division protein FtsI, a penicillin binding protein. This subfamily is restricted to Bacillus subtilis and related Gram-positive species with known or suspected endospore formation capability. In these species, the functional equivalent of FtsI is desginated PBP-2B, a paralog of spoVD. Length = 636 Score = 29.0 bits (65), Expect = 0.88 Identities = 12/46 (26%), Positives = 23/46 (50%), Gaps = 1/46 (2%) Query: 79 HFIEGLIESERSKITEKFKPLAVAKVVSDELLHDKLNKILKKSVRN 124 H ++ + +S+ + + + F+P +VVS E KL L+ V Sbjct: 430 HIMKEISDSQNNAVDQTFEPEVKRQVVSKE-TTQKLRLALETVVSK 474 >gnl|CDD|179818 PRK04309, PRK04309, DNA-directed RNA polymerase subunit A''; Validated. Length = 383 Score = 27.9 bits (63), Expect = 1.9 Identities = 11/47 (23%), Positives = 25/47 (53%) Query: 81 IEGLIESERSKITEKFKPLAVAKVVSDELLHDKLNKILKKSVRNYSR 127 +E +E ++ +K K K+ +L +++ +I+++ VR Y R Sbjct: 7 LEEKLEDASLELPQKLKEELREKLEERKLTEEEVEEIIEEVVREYLR 53 >gnl|CDD|149191 pfam07976, Phe_hydrox_dim, Phenol hydroxylase, C-terminal dimerization domain. Phenol hydroxylase acts a homodimer, to hydroxylates phenol to catechol or similar product. The enzyme is comprised of three domains. The first two domains from the active site. The third domain, this domain, is involved in forming the dimerization interface. The domain adopts a thioredoxin-like fold. Length = 169 Score = 27.6 bits (62), Expect = 2.3 Identities = 9/32 (28%), Positives = 15/32 (46%), Gaps = 1/32 (3%) Query: 21 LDKWCEALYSPESYSNTY-REQKLRDKIIELR 51 LD E L SP+S + + D +I++ Sbjct: 80 LDALAEYLESPDSPLRRFTPKGADIDSVIDVL 111 >gnl|CDD|183266 PRK11663, PRK11663, regulatory protein UhpC; Provisional. Length = 434 Score = 27.4 bits (61), Expect = 2.7 Identities = 9/19 (47%), Positives = 14/19 (73%), Gaps = 1/19 (5%) Query: 73 ITYSLSHFIEGLIESERSK 91 ITY +S F+ G++ S+RS Sbjct: 69 ITYGVSKFVSGIV-SDRSN 86 >gnl|CDD|150993 pfam10412, TrwB_AAD_bind, Type IV secretion-system coupling protein DNA-binding domain. The plasmid conjugative coupling protein TrwB forms hexamers from six structurally very similar protomers. This hexamer contains a central channel running from the cytosolic pole (made up by the AADs) to the membrane pole ending at the transmembrane pore shaped by 12 transmembrane helices, rendering an overall mushroom-like structure. The TrwB_AAD (all-alpha domain) domain appears to be the DNA-binding domain of the structure. TrwB, a basic integral inner-membrane nucleoside-triphosphate-binding protein, is the structural prototype for the type IV secretion system coupling proteins, a family of proteins essential for macromolecular transport between cells and export. Length = 386 Score = 26.8 bits (60), Expect = 4.0 Identities = 12/33 (36%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Query: 147 YLEDFYKEIKHTFGNPADALSPHISELADEIHT 179 ++E FY+ NP DA SP+ S +E T Sbjct: 55 FVERFYRPGGDIILNPLDARSPNWS-PFNECET 86 >gnl|CDD|132392 TIGR03349, IV_VI_DotU, type IV / VI secretion system protein, DotU family. At least two families of proteins, often encoded by adjacent genes, show sequence similarity due to homology between type IV secretion systems and type VI secretion systems. One is the IcmF family (TIGR03348). The other is the family described by this model. Members include DotU from the Legionella pneumophila type IV secretion system. Many of the members of this protein family from type VI secretion systems have an additional C-terminal domain with OmpA/MotB homology. Length = 183 Score = 26.5 bits (59), Expect = 4.5 Identities = 12/64 (18%), Positives = 20/64 (31%), Gaps = 18/64 (28%) Query: 124 NYSRDSGHLNRDVI----------FHSRYALI----RYLED----FYKEIKHTFGNPADA 165 + D++ F +Y + LE Y+ ++ G A Sbjct: 92 ERLLADPAEHLDLLELYYLCLSLGFEGKYRVEEDGREQLEALRDRLYRLLRGARGPVPPA 151 Query: 166 LSPH 169 LSPH Sbjct: 152 LSPH 155 >gnl|CDD|185541 PTZ00292, PTZ00292, ribokinase; Provisional. Length = 326 Score = 26.2 bits (58), Expect = 5.4 Identities = 18/65 (27%), Positives = 23/65 (35%), Gaps = 7/65 (10%) Query: 53 KFAKENGLKTVTEVCPKPKDITYSLSH----FIEGLI--ESERSKIT-EKFKPLAVAKVV 105 K AKE G TV P PK + ++ E E + IT + A Sbjct: 167 KEAKERGCYTVFNPAPAPKLAEVEIIKPFLKYVSLFCVNEVEAALITGMEVTDTESAFKA 226 Query: 106 SDELL 110 S EL Sbjct: 227 SKELQ 231 >gnl|CDD|161904 TIGR00507, aroE, shikimate 5-dehydrogenase. This model finds proteins from prokaryotes and functionally equivalent domains from larger, multifunctional proteins of fungi and plants. Below the trusted cutoff of 180, but above the noise cutoff of 20, are the putative shikimate dehydrogenases of Thermotoga maritima and Mycobacterium tuberculosis, and uncharacterized paralogs of shikimate dehydrogenase from E. coli and H. influenzae. The related enzyme quinate 5-dehydrogenase scores below the noise cutoff. A neighbor-joining tree, constructed with quinate 5-dehydrogenases as the outgroup, shows the Clamydial homolog as clustering among the shikimate dehydrogenases, although the sequence is unusual in the degree of sequence divergence and the presence of an additional N-terminal domain. Length = 270 Score = 26.2 bits (58), Expect = 5.8 Identities = 10/50 (20%), Positives = 15/50 (30%), Gaps = 3/50 (6%) Query: 131 HLNRDVIFHSRYALIRYLEDFYKEIKHTFGNPADALSPH---ISELADEI 177 L + + + LED A+ SP + DEI Sbjct: 25 QLGLEGPYIAFLVPPDDLEDALSGFFALGFKGANVTSPFKEEAFQFLDEI 74 >gnl|CDD|181535 PRK08673, PRK08673, 3-deoxy-7-phosphoheptulonate synthase; Reviewed. Length = 335 Score = 26.0 bits (58), Expect = 6.1 Identities = 13/37 (35%), Positives = 20/37 (54%), Gaps = 6/37 (16%) Query: 30 SPESYSNTYREQKLRDKIIELRRKFAKENGLKTVTEV 66 SP S+ Q L ++ ++L + +E GL VTEV Sbjct: 134 SPYSF------QGLGEEGLKLLAEAREETGLPIVTEV 164 >gnl|CDD|179436 PRK02507, PRK02507, proton extrusion protein PcxA; Provisional. Length = 422 Score = 26.1 bits (58), Expect = 7.1 Identities = 10/26 (38%), Positives = 15/26 (57%), Gaps = 2/26 (7%) Query: 40 EQKLRDKIIELRRKFAKE--NGLKTV 63 E+KL++K EL + E N +K V Sbjct: 278 EEKLKEKAEELAEEARYESLNAIKNV 303 >gnl|CDD|150362 pfam09674, DUF2400, Protein of unknown function (DUF2400). Members of this uncharacterized protein family are found sporadically, so far only among spirochetes, epsilon and delta proteobacteria, and Bacteroides. The function is unknown and its gene neighbourhoods show little conservation. Length = 230 Score = 25.6 bits (57), Expect = 8.5 Identities = 14/63 (22%), Positives = 24/63 (38%), Gaps = 4/63 (6%) Query: 38 YREQKLRDK---IIELRRKFAKENGLKTV-TEVCPKPKDITYSLSHFIEGLIESERSKIT 93 YR Q D I L+R + + L+ + + K + ++S FI+ E Sbjct: 69 YRFQNSEDLAALFIALKRIYEEHGSLEDLFLKAYQKSGTLQEAISAFIKAFFELNHPSRG 128 Query: 94 EKF 96 K Sbjct: 129 YKH 131 >gnl|CDD|179065 PRK00558, uvrC, excinuclease ABC subunit C; Validated. Length = 598 Score = 25.5 bits (57), Expect = 9.9 Identities = 8/19 (42%), Positives = 10/19 (52%) Query: 116 KILKKSVRNYSRDSGHLNR 134 K LK VR+Y R S + Sbjct: 34 KNLKNRVRSYFRKSHDSPK 52 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.318 0.135 0.387 Gapped Lambda K H 0.267 0.0751 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 3,295,084 Number of extensions: 208644 Number of successful extensions: 529 Number of sequences better than 10.0: 1 Number of HSP's gapped: 529 Number of HSP's successfully gapped: 35 Length of query: 200 Length of database: 5,994,473 Length adjustment: 89 Effective length of query: 111 Effective length of database: 4,071,361 Effective search space: 451921071 Effective search space used: 451921071 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 55 (24.9 bits)