RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254781220|ref|YP_003065633.1| hypothetical protein CLIBASIA_05635 [Candidatus Liberibacter asiaticus str. psy62] (130 letters) >3a00_A Guanylate kinase, GMP kinase; domain movement, dimerization, acetylation, ATP-binding, nucleotide-binding, phosphoprotein, transferase; 1.80A {Saccharomyces cerevisiae} PDB: 1ex6_A* 1ex7_A 1gky_A* 2zzz_A 2zzy_A (A:) Length = 186 Score = 31.2 bits (69), Expect = 0.044 Identities = 8/53 (15%), Positives = 17/53 (32%), Gaps = 5/53 (9%) Query: 29 EPESNYEVEVIEKLERALKTSKK-----LIHFRDRTIRTHILEDLIEEVNRII 76 + E E + + L ++ D+ I L+ +E+ I Sbjct: 130 KRLEGRGTETEESINKRLSAAQAELAYAETGAHDKVIVNDDLDKAYKELKDFI 182 >2yz2_A Putative ABC transporter ATP-binding protein TM_0222; cobalt transport, hydrolase, inner membrane, membrane, nucleotide- binding; 2.30A {Thermotoga maritima MSB8} (A:) Length = 266 Score = 26.4 bits (58), Expect = 1.4 Identities = 18/64 (28%), Positives = 30/64 (46%), Gaps = 8/64 (12%) Query: 21 AVNPRMGI--EPESNYEVEVIEKLERALKTSKKLIHFRDRTI--RTHILEDLIEEVNRII 76 P + I EP + E L R ++ K L +T+ +H +E +I V+R++ Sbjct: 154 VHEPDILILDEPLVGLDREGKTDLLRIVEKWKTL----GKTVILISHDIETVINHVDRVV 209 Query: 77 VLAK 80 VL K Sbjct: 210 VLEK 213 >2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} (C:1-214) Length = 214 Score = 26.0 bits (57), Expect = 1.8 Identities = 11/61 (18%), Positives = 26/61 (42%), Gaps = 8/61 (13%) Query: 29 EPESNYEVEVIEKLERALKTSKKLIHFRDRTI--RTHILEDLIEEVNRIIVLAKAHKRRL 86 EP S ++ + + L L ++ T+ TH ++ N+ ++L +K+ Sbjct: 154 EPTSALDLANQDIVLSLLI---DLAQSQNMTVVFTTHQPNQVVAIANKTLLL---NKQNF 207 Query: 87 E 87 + Sbjct: 208 K 208 >1vpl_A ABC transporter, ATP-binding protein; TM0544, structural genomics, joint center for structural genomics, JCSG; 2.10A {Thermotoga maritima MSB8} (A:1-98,A:164-256) Length = 191 Score = 25.8 bits (57), Expect = 2.0 Identities = 16/67 (23%), Positives = 28/67 (41%), Gaps = 8/67 (11%) Query: 18 FLSAVNPRMGI--EPESNYEVEVIEKLERALKTSKKLIHFRDRTI--RTHILEDLIEEVN 73 A NPR+ I EP S +V ++ + LK TI +H + ++ + Sbjct: 94 PEEAGNPRLAILDEPTSGLDVLNAREVRKILKQ----ASQEGLTILVSSHNMLEVEFLCD 149 Query: 74 RIIVLAK 80 RI ++ Sbjct: 150 RIALIHN 156 >3bh1_A UPF0371 protein DIP2346; structural genomics, unknown function, protein structure initiative, PSI-2; 2.51A {Corynebacterium diphtheriae NCTC13129} (A:1-344) Length = 344 Score = 25.8 bits (57), Expect = 2.2 Identities = 13/47 (27%), Positives = 25/47 (53%), Gaps = 4/47 (8%) Query: 63 HILEDLIEEVNRIIVLAKA----HKRRLELKIFEDNEVWRLLDEARE 105 +L+ + +EV ++ + HK R +L I + +V RL+D R+ Sbjct: 61 AMLDRIKDEVEILVCINAKDLERHKIRADLGISYEEDVLRLVDVFRD 107 >1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} (A:1-92,A:171-257) Length = 179 Score = 25.0 bits (55), Expect = 4.2 Identities = 10/67 (14%), Positives = 26/67 (38%), Gaps = 8/67 (11%) Query: 18 FLSAVNPRMGI--EPESNYEVEVIEKLERALKTSKKLIHFRDRTI--RTHILEDLIEEVN 73 F + NP+M + EP + + + + + + T H L+ ++ ++ Sbjct: 88 FQTPQNPKMIVMDEPIAGVAPGLAHDIFNHVLE----LKAKGITFLIIEHRLDIVLNYID 143 Query: 74 RIIVLAK 80 + V+ Sbjct: 144 HLYVMFN 150 >2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A (A:655-778,A:874-986) Length = 237 Score = 24.6 bits (54), Expect = 4.9 Identities = 10/64 (15%), Positives = 21/64 (32%), Gaps = 11/64 (17%) Query: 21 AVNPRMGI--EPESNYEVEVIEKLERALKTSKKLIHFRDRTI--RTHILEDLIEEVNRII 76 P + + EP + + + + L +ALK + + TH E + Sbjct: 168 WQRPHLIVLDEPTNYLDRDSLGALSKALKE-------FEGGVIIITHSAEFTKNLTEEVW 220 Query: 77 VLAK 80 + Sbjct: 221 AVKD 224 >2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} (A:1-228) Length = 228 Score = 24.5 bits (53), Expect = 5.4 Identities = 11/54 (20%), Positives = 20/54 (37%), Gaps = 5/54 (9%) Query: 29 EPESNYEVEVIEKLERALKTSKKLIHFRDRTI--RTHILEDLIEEVNRIIVLAK 80 EP S +++ L L+ + D I TH L + + + V+ Sbjct: 152 EPLSAVDLKTKGVLMEELR---FVQREFDVPILHVTHDLIEAAMLADEVAVMLN 202 >3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} (A:1-46,A:247-301,A:416-470) Length = 156 Score = 24.3 bits (52), Expect = 5.5 Identities = 5/22 (22%), Positives = 9/22 (40%) Query: 25 RMGIEPESNYEVEVIEKLERAL 46 + E E+ ++E R L Sbjct: 26 KEIKEKNLPLELTLVEASPRVL 47 >2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} (A:1-249) Length = 249 Score = 24.4 bits (53), Expect = 6.5 Identities = 9/58 (15%), Positives = 25/58 (43%), Gaps = 8/58 (13%) Query: 24 PRMGIEPESNYEV-EVIEKLERALKTSKKLIHFRDRTIRTHILEDLIEEVNRIIVLAK 80 P G++ + + +++ L + T + TH +E++ ++I++L Sbjct: 188 PAAGLDFIARESLLSILDSLSDSYPTLAXIYV-------THFIEEITANFSKILLLKD 238 >1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} (K:1-243) Length = 243 Score = 24.1 bits (52), Expect = 6.9 Identities = 12/54 (22%), Positives = 23/54 (42%), Gaps = 5/54 (9%) Query: 29 EPESNYEVEVIEKLERALKTSKKLIHFRDRTI--RTHILEDLIEEVNRIIVLAK 80 EP SN + + + +K ++ T+ +H D+ +R+ VL K Sbjct: 166 EPFSNLDARMRDSARALVK---EVQSRLGVTLLVVSHDPADIFAIADRVGVLVK 216 >1aor_A Aldehyde ferredoxin oxidoreductase; HET: PTE; 2.30A {Pyrococcus furiosus} (A:1-238,A:422-605) Length = 422 Score = 24.0 bits (52), Expect = 7.0 Identities = 14/63 (22%), Positives = 22/63 (34%), Gaps = 3/63 (4%) Query: 66 EDLIEEVNRIIVLAKAHKRRLELKIFEDNEV-WRLLDEAREDCEGCENCSEHPDQEHKED 124 ED ++ RI + + L D+ + R L+E EG +E Sbjct: 338 EDYLKIGERIWNAERLFNLKAGLDPARDDTLPKRFLEEPMP--EGPNKGHTVRLKEMLPR 395 Query: 125 YYA 127 YY Sbjct: 396 YYK 398 >3edo_A Flavoprotein, putative Trp repressor binding protein; YP_193882.1, flavoprotein in complex with FMN, structural genomics; HET: MSE FMN; 1.20A {Lactobacillus acidophilus ncfm} (A:) Length = 151 Score = 23.9 bits (51), Expect = 7.7 Identities = 3/51 (5%), Positives = 13/51 (25%) Query: 79 AKAHKRRLELKIFEDNEVWRLLDEAREDCEGCENCSEHPDQEHKEDYYASQ 129 A+ ++ ++ +V +A + + + Sbjct: 21 AEKINSEIKDSELKEVKVSEGTFDADXYKTSDIALDQIQGNKDFPEIQLDN 71 >1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} (A:1-237) Length = 237 Score = 23.8 bits (51), Expect = 7.7 Identities = 10/58 (17%), Positives = 25/58 (43%), Gaps = 9/58 (15%) Query: 24 PRMGIEPESNYEV-EVIEKLERALKTSKKLIHFRDRTIRTHILEDLIEEVNRIIVLAK 80 P I+ + E+ + ++ + + + TH E+ +E +R++VL + Sbjct: 172 PFAAIDTQIRRELRTFVRQVHDEMGVTSVFV--------THDQEEALEVADRVLVLHE 221 >2uyg_A 3-dehydroquinate dehydratase; typeii 3-dehydroquinase, lyase; 2.2A {Thermus thermophilus} (A:) Length = 149 Score = 23.8 bits (52), Expect = 8.5 Identities = 13/40 (32%), Positives = 22/40 (55%), Gaps = 6/40 (15%) Query: 9 LEEIEANYEFLSAVNPRMGIEPE---SNYEVEVIEKLERA 45 LEE+EA A +G+ +NYE ++IE +++A Sbjct: 26 LEELEAL---CEAWGAELGLGVVFRQTNYEGQLIEWVQQA 62 >2oni_A E3 ubiquitin-protein ligase NEDD4-like protein; alpha and beta protein (A + B), E3 ligase, HECT domain, UBL- conjugation pathway; HET: MSE; 2.20A {Homo sapiens} (A:38-125) Length = 88 Score = 23.6 bits (51), Expect = 9.0 Identities = 7/43 (16%), Positives = 16/43 (37%), Gaps = 3/43 (6%) Query: 54 HFRDRTIRTHILEDLIEEVNRIIVLAKAHKRRLELKIFEDNEV 96 F + R +I E+ + + + + L I ++E Sbjct: 5 RFEXKLHRNNIFEESYRRIXS---VKRPDVLKARLWIEFESEK 44 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.317 0.135 0.385 Gapped Lambda K H 0.267 0.0613 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 1,068,658 Number of extensions: 47986 Number of successful extensions: 241 Number of sequences better than 10.0: 1 Number of HSP's gapped: 241 Number of HSP's successfully gapped: 49 Length of query: 130 Length of database: 4,956,049 Length adjustment: 77 Effective length of query: 53 Effective length of database: 2,353,064 Effective search space: 124712392 Effective search space used: 124712392 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.3 bits)