BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254781220|ref|YP_003065633.1| hypothetical protein CLIBASIA_05635 [Candidatus Liberibacter asiaticus str. psy62] (130 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254781220|ref|YP_003065633.1| hypothetical protein CLIBASIA_05635 [Candidatus Liberibacter asiaticus str. psy62] Length = 130 Score = 264 bits (674), Expect = 4e-73, Method: Compositional matrix adjust. Identities = 130/130 (100%), Positives = 130/130 (100%) Query: 1 MGQLKQYYLEEIEANYEFLSAVNPRMGIEPESNYEVEVIEKLERALKTSKKLIHFRDRTI 60 MGQLKQYYLEEIEANYEFLSAVNPRMGIEPESNYEVEVIEKLERALKTSKKLIHFRDRTI Sbjct: 1 MGQLKQYYLEEIEANYEFLSAVNPRMGIEPESNYEVEVIEKLERALKTSKKLIHFRDRTI 60 Query: 61 RTHILEDLIEEVNRIIVLAKAHKRRLELKIFEDNEVWRLLDEAREDCEGCENCSEHPDQE 120 RTHILEDLIEEVNRIIVLAKAHKRRLELKIFEDNEVWRLLDEAREDCEGCENCSEHPDQE Sbjct: 61 RTHILEDLIEEVNRIIVLAKAHKRRLELKIFEDNEVWRLLDEAREDCEGCENCSEHPDQE 120 Query: 121 HKEDYYASQI 130 HKEDYYASQI Sbjct: 121 HKEDYYASQI 130 >gi|254780122|ref|YP_003064535.1| hypothetical protein CLIBASIA_00005 [Candidatus Liberibacter asiaticus str. psy62] Length = 123 Score = 50.8 bits (120), Expect = 8e-09, Method: Compositional matrix adjust. Identities = 43/135 (31%), Positives = 69/135 (51%), Gaps = 17/135 (12%) Query: 1 MGQLKQYYLEEIEANYEFLSAVNPRMGIEPESNYEVEVIEK---LERALKTSKKLIHFRD 57 MG LK ++ +EI N+ F S N +P+ + E+++ E L+ + ++ Sbjct: 1 MGALKNHFHDEINENFYFHSHPNA----DPDISIEMQISENQRYLDEEISQCNAVVDVFK 56 Query: 58 RTIRTHILE--DLIEEVNRIIVLAKAHKRRLELKIFEDNEVWRLLDEAREDCEGCENCSE 115 R+ T IL+ D ++++ I L +A + L+ + E W E D E E E Sbjct: 57 RSDST-ILDKLDAMDDLKTYISLLQATAKNLKSLL---KEYW----EESLDGEDDEEIYE 108 Query: 116 HPDQEHKEDYYASQI 130 HPDQEH+EDYYA+QI Sbjct: 109 HPDQEHREDYYANQI 123 >gi|254780229|ref|YP_003064642.1| hypothetical protein CLIBASIA_00570 [Candidatus Liberibacter asiaticus str. psy62] Length = 1775 Score = 28.5 bits (62), Expect = 0.039, Method: Compositional matrix adjust. Identities = 20/50 (40%), Positives = 28/50 (56%), Gaps = 6/50 (12%) Query: 33 NYEVEVIEKLERALKTSKKL--IHFR----DRTIRTHILEDLIEEVNRII 76 NY IE LERA+K +K L HF+ D I+T +D +E + R+I Sbjct: 160 NYGYADIEDLERAIKENKPLKPPHFQNNLSDNQIQTAYFQDKLESILRLI 209 >gi|254780524|ref|YP_003064937.1| flagellar hook-associated protein FlgK [Candidatus Liberibacter asiaticus str. psy62] Length = 480 Score = 23.5 bits (49), Expect = 1.6, Method: Composition-based stats. Identities = 10/28 (35%), Positives = 18/28 (64%) Query: 35 EVEVIEKLERALKTSKKLIHFRDRTIRT 62 E+ + K+E++ S KLI F D+ ++T Sbjct: 447 ELSFLIKVEQSYNISNKLIMFTDKMLQT 474 >gi|254780375|ref|YP_003064788.1| hypothetical protein CLIBASIA_01300 [Candidatus Liberibacter asiaticus str. psy62] Length = 175 Score = 21.6 bits (44), Expect = 5.9, Method: Compositional matrix adjust. Identities = 10/33 (30%), Positives = 20/33 (60%) Query: 56 RDRTIRTHILEDLIEEVNRIIVLAKAHKRRLEL 88 RD + +LEDL +++ + ++L + HK+ L Sbjct: 59 RDYLSQKKVLEDLQKDIEQRVILLENHKKEYNL 91 >gi|254780975|ref|YP_003065388.1| D-ribulose-5 phosphate 3-epimerase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 224 Score = 21.2 bits (43), Expect = 6.7, Method: Compositional matrix adjust. Identities = 7/15 (46%), Positives = 14/15 (93%) Query: 64 ILEDLIEEVNRIIVL 78 ILED+I+E++ I+++ Sbjct: 125 ILEDVIDEIDMILIM 139 >gi|254780140|ref|YP_003064553.1| putative ABC transporter, substrate-binding protein [Candidatus Liberibacter asiaticus str. psy62] Length = 452 Score = 21.2 bits (43), Expect = 6.8, Method: Composition-based stats. Identities = 12/32 (37%), Positives = 16/32 (50%), Gaps = 2/32 (6%) Query: 45 ALKTSKKLIHFRDRTIRTHILEDLIEEVNRII 76 ALK + L F+D H D E++NR I Sbjct: 361 ALKENNSL--FKDAQRAMHTFRDTSEKINRYI 390 Score = 20.8 bits (42), Expect = 8.6, Method: Composition-based stats. Identities = 11/35 (31%), Positives = 18/35 (51%) Query: 15 NYEFLSAVNPRMGIEPESNYEVEVIEKLERALKTS 49 NY +A N I S + ++IE +E+ L T+ Sbjct: 145 NYFISNAENTSKKISDSSRHIQKIIENIEKPLTTT 179 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.317 0.135 0.385 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 83,505 Number of Sequences: 1233 Number of extensions: 3117 Number of successful extensions: 16 Number of sequences better than 100.0: 13 Number of HSP's better than 100.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 2 Number of HSP's gapped (non-prelim): 14 length of query: 130 length of database: 328,796 effective HSP length: 65 effective length of query: 65 effective length of database: 248,651 effective search space: 16162315 effective search space used: 16162315 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 33 (17.3 bits)