BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Reference for composition-based statistics starting in round 2: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= gi|254781221|ref|YP_003065634.1| hypothetical protein CLIBASIA_05640 [Candidatus Liberibacter asiaticus str. psy62] (68 letters) Database: nr 14,124,377 sequences; 4,842,793,630 total letters Searching..................................................done Results from round 1 >gi|254781221|ref|YP_003065634.1| hypothetical protein CLIBASIA_05640 [Candidatus Liberibacter asiaticus str. psy62] gi|254040898|gb|ACT57694.1| hypothetical protein CLIBASIA_05640 [Candidatus Liberibacter asiaticus str. psy62] gi|317120685|gb|ADV02508.1| hypothetical protein SC1_gp140 [Liberibacter phage SC1] gi|317120727|gb|ADV02549.1| hypothetical protein SC2_gp140 [Liberibacter phage SC2] gi|317120788|gb|ADV02609.1| hypothetical protein SC2_gp140 [Liberibacter phage SC2] gi|317120829|gb|ADV02650.1| hypothetical protein SC1_gp140 [Liberibacter phage SC1] Length = 68 Score = 137 bits (345), Expect = 5e-31, Method: Compositional matrix adjust. Identities = 68/68 (100%), Positives = 68/68 (100%) Query: 1 MTIKKVLIASTLLSLCGCGLADEPKKLNPDQLCDAVCRLTLEEQKELQTKVNQRYEEHLT 60 MTIKKVLIASTLLSLCGCGLADEPKKLNPDQLCDAVCRLTLEEQKELQTKVNQRYEEHLT Sbjct: 1 MTIKKVLIASTLLSLCGCGLADEPKKLNPDQLCDAVCRLTLEEQKELQTKVNQRYEEHLT 60 Query: 61 KGAKLSSD 68 KGAKLSSD Sbjct: 61 KGAKLSSD 68 >gi|315122558|ref|YP_004063047.1| hypothetical protein CKC_04050 [Candidatus Liberibacter solanacearum CLso-ZC1] gi|313495960|gb|ADR52559.1| hypothetical protein CKC_04050 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 71 Score = 95.9 bits (237), Expect = 2e-18, Method: Compositional matrix adjust. Identities = 46/71 (64%), Positives = 58/71 (81%), Gaps = 3/71 (4%) Query: 1 MTIKKVLIASTLLS---LCGCGLADEPKKLNPDQLCDAVCRLTLEEQKELQTKVNQRYEE 57 M K LIASTL++ L GC LADEPKKLNPDQ+CDA+C LT ++Q+ELQ+KV+++YEE Sbjct: 1 MKTKTFLIASTLITSGLLAGCDLADEPKKLNPDQICDAICNLTTKQQEELQSKVDKKYEE 60 Query: 58 HLTKGAKLSSD 68 HL GAK+SSD Sbjct: 61 HLKTGAKISSD 71 >gi|315122912|ref|YP_004063401.1| hypothetical protein CKC_05840 [Candidatus Liberibacter solanacearum CLso-ZC1] gi|313496314|gb|ADR52913.1| hypothetical protein CKC_05840 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 71 Score = 94.0 bits (232), Expect = 6e-18, Method: Compositional matrix adjust. Identities = 44/71 (61%), Positives = 56/71 (78%), Gaps = 3/71 (4%) Query: 1 MTIKKVLIASTLLS---LCGCGLADEPKKLNPDQLCDAVCRLTLEEQKELQTKVNQRYEE 57 M K LIAS + + L GC LADEPKKLNPDQ+CDA+C+L L+EQ+ELQ+KV+Q+YE+ Sbjct: 1 MKTKTFLIASIIATSGLLAGCNLADEPKKLNPDQICDAICKLNLQEQQELQSKVDQKYED 60 Query: 58 HLTKGAKLSSD 68 HL G K+SSD Sbjct: 61 HLKTGTKISSD 71 >gi|315122557|ref|YP_004063046.1| hypothetical protein CKC_04045 [Candidatus Liberibacter solanacearum CLso-ZC1] gi|313495959|gb|ADR52558.1| hypothetical protein CKC_04045 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 74 Score = 75.1 bits (183), Expect = 3e-12, Method: Compositional matrix adjust. Identities = 37/71 (52%), Positives = 48/71 (67%), Gaps = 3/71 (4%) Query: 1 MTIKKVLIASTLLS---LCGCGLADEPKKLNPDQLCDAVCRLTLEEQKELQTKVNQRYEE 57 M K LIASTL++ L GC LADE KL PDQ+CD + +LT +EQ EL K+ ++YEE Sbjct: 4 MKTKTFLIASTLITSGLLAGCDLADESNKLTPDQICDGIVKLTKKEQDELHIKLKKKYEE 63 Query: 58 HLTKGAKLSSD 68 HL GAK+ + Sbjct: 64 HLKTGAKIYGN 74 >gi|309388934|gb|ADO76814.1| hypothetical protein Hprae_0660 [Halanaerobium praevalens DSM 2228] Length = 364 Score = 35.4 bits (80), Expect = 2.9, Method: Composition-based stats. Identities = 17/54 (31%), Positives = 31/54 (57%) Query: 3 IKKVLIASTLLSLCGCGLADEPKKLNPDQLCDAVCRLTLEEQKELQTKVNQRYE 56 I VL++ TL+ L GCG ++ +K P++ L+ +E+KE + ++YE Sbjct: 7 ILMVLLSITLVFLTGCGFKEKSQKPKPEEQIQTQTDLSSQERKEEIASLEEKYE 60 >gi|307180264|gb|EFN68297.1| ADP-ribosylation factor GTPase-activating protein 3 [Camponotus floridanus] Length = 524 Score = 33.5 bits (75), Expect = 8.7, Method: Composition-based stats. Identities = 15/26 (57%), Positives = 22/26 (84%) Query: 39 LTLEEQKELQTKVNQRYEEHLTKGAK 64 +T EEQ+EL T++ QRYE++LT+ AK Sbjct: 271 VTKEEQEELATRLAQRYEQNLTQQAK 296 Searching..................................................done Results from round 2 CONVERGED! >gi|254781221|ref|YP_003065634.1| hypothetical protein CLIBASIA_05640 [Candidatus Liberibacter asiaticus str. psy62] gi|254040898|gb|ACT57694.1| hypothetical protein CLIBASIA_05640 [Candidatus Liberibacter asiaticus str. psy62] gi|317120685|gb|ADV02508.1| hypothetical protein SC1_gp140 [Liberibacter phage SC1] gi|317120727|gb|ADV02549.1| hypothetical protein SC2_gp140 [Liberibacter phage SC2] gi|317120788|gb|ADV02609.1| hypothetical protein SC2_gp140 [Liberibacter phage SC2] gi|317120829|gb|ADV02650.1| hypothetical protein SC1_gp140 [Liberibacter phage SC1] Length = 68 Score = 99.7 bits (247), Expect = 1e-19, Method: Composition-based stats. Identities = 68/68 (100%), Positives = 68/68 (100%) Query: 1 MTIKKVLIASTLLSLCGCGLADEPKKLNPDQLCDAVCRLTLEEQKELQTKVNQRYEEHLT 60 MTIKKVLIASTLLSLCGCGLADEPKKLNPDQLCDAVCRLTLEEQKELQTKVNQRYEEHLT Sbjct: 1 MTIKKVLIASTLLSLCGCGLADEPKKLNPDQLCDAVCRLTLEEQKELQTKVNQRYEEHLT 60 Query: 61 KGAKLSSD 68 KGAKLSSD Sbjct: 61 KGAKLSSD 68 >gi|315122912|ref|YP_004063401.1| hypothetical protein CKC_05840 [Candidatus Liberibacter solanacearum CLso-ZC1] gi|313496314|gb|ADR52913.1| hypothetical protein CKC_05840 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 71 Score = 97.4 bits (241), Expect = 6e-19, Method: Composition-based stats. Identities = 44/71 (61%), Positives = 56/71 (78%), Gaps = 3/71 (4%) Query: 1 MTIKKVLIASTLLS---LCGCGLADEPKKLNPDQLCDAVCRLTLEEQKELQTKVNQRYEE 57 M K LIAS + + L GC LADEPKKLNPDQ+CDA+C+L L+EQ+ELQ+KV+Q+YE+ Sbjct: 1 MKTKTFLIASIIATSGLLAGCNLADEPKKLNPDQICDAICKLNLQEQQELQSKVDQKYED 60 Query: 58 HLTKGAKLSSD 68 HL G K+SSD Sbjct: 61 HLKTGTKISSD 71 >gi|315122558|ref|YP_004063047.1| hypothetical protein CKC_04050 [Candidatus Liberibacter solanacearum CLso-ZC1] gi|313495960|gb|ADR52559.1| hypothetical protein CKC_04050 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 71 Score = 97.4 bits (241), Expect = 6e-19, Method: Composition-based stats. Identities = 46/71 (64%), Positives = 58/71 (81%), Gaps = 3/71 (4%) Query: 1 MTIKKVLIASTLLS---LCGCGLADEPKKLNPDQLCDAVCRLTLEEQKELQTKVNQRYEE 57 M K LIASTL++ L GC LADEPKKLNPDQ+CDA+C LT ++Q+ELQ+KV+++YEE Sbjct: 1 MKTKTFLIASTLITSGLLAGCDLADEPKKLNPDQICDAICNLTTKQQEELQSKVDKKYEE 60 Query: 58 HLTKGAKLSSD 68 HL GAK+SSD Sbjct: 61 HLKTGAKISSD 71 >gi|315122557|ref|YP_004063046.1| hypothetical protein CKC_04045 [Candidatus Liberibacter solanacearum CLso-ZC1] gi|313495959|gb|ADR52558.1| hypothetical protein CKC_04045 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 74 Score = 95.5 bits (236), Expect = 2e-18, Method: Composition-based stats. Identities = 37/71 (52%), Positives = 48/71 (67%), Gaps = 3/71 (4%) Query: 1 MTIKKVLIASTLLS---LCGCGLADEPKKLNPDQLCDAVCRLTLEEQKELQTKVNQRYEE 57 M K LIASTL++ L GC LADE KL PDQ+CD + +LT +EQ EL K+ ++YEE Sbjct: 4 MKTKTFLIASTLITSGLLAGCDLADESNKLTPDQICDGIVKLTKKEQDELHIKLKKKYEE 63 Query: 58 HLTKGAKLSSD 68 HL GAK+ + Sbjct: 64 HLKTGAKIYGN 74 >gi|315121945|ref|YP_004062434.1| hypothetical protein CKC_00975 [Candidatus Liberibacter solanacearum CLso-ZC1] gi|313495347|gb|ADR51946.1| hypothetical protein CKC_00975 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 79 Score = 40.4 bits (93), Expect = 0.076, Method: Composition-based stats. Identities = 18/56 (32%), Positives = 28/56 (50%), Gaps = 7/56 (12%) Query: 1 MTIKKVLIASTLLS---LCGCGLADEPKKLNPDQLCDAVCRLTLEEQKELQTKVNQ 53 M K LIAS + + L GC LADEPK + + D + + E++ V++ Sbjct: 1 MKTKTFLIASIIATSGLLAGCNLADEPK----NNIVDGLVTIPNNTTTEVKQAVSE 52 >gi|309388934|gb|ADO76814.1| hypothetical protein Hprae_0660 [Halanaerobium praevalens DSM 2228] Length = 364 Score = 37.7 bits (86), Expect = 0.52, Method: Composition-based stats. Identities = 17/72 (23%), Positives = 35/72 (48%), Gaps = 4/72 (5%) Query: 1 MTIKKV----LIASTLLSLCGCGLADEPKKLNPDQLCDAVCRLTLEEQKELQTKVNQRYE 56 M K L++ TL+ L GCG ++ +K P++ L+ +E+KE + ++YE Sbjct: 1 MKSKLFILMVLLSITLVFLTGCGFKEKSQKPKPEEQIQTQTDLSSQERKEEIASLEEKYE 60 Query: 57 EHLTKGAKLSSD 68 + ++ + Sbjct: 61 IESSTENQIFEN 72 Database: nr Posted date: May 22, 2011 12:22 AM Number of letters in database: 999,999,966 Number of sequences in database: 2,987,313 Database: /data/usr2/db/fasta/nr.01 Posted date: May 22, 2011 12:30 AM Number of letters in database: 999,999,796 Number of sequences in database: 2,903,041 Database: /data/usr2/db/fasta/nr.02 Posted date: May 22, 2011 12:36 AM Number of letters in database: 999,999,281 Number of sequences in database: 2,904,016 Database: /data/usr2/db/fasta/nr.03 Posted date: May 22, 2011 12:41 AM Number of letters in database: 999,999,960 Number of sequences in database: 2,935,328 Database: /data/usr2/db/fasta/nr.04 Posted date: May 22, 2011 12:46 AM Number of letters in database: 842,794,627 Number of sequences in database: 2,394,679 Lambda K H 0.314 0.138 0.372 Lambda K H 0.267 0.0419 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 1,070,424,354 Number of Sequences: 14124377 Number of extensions: 29689441 Number of successful extensions: 78374 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 3 Number of HSP's that attempted gapping in prelim test: 78359 Number of HSP's gapped (non-prelim): 14 length of query: 68 length of database: 4,842,793,630 effective HSP length: 40 effective length of query: 28 effective length of database: 4,277,818,550 effective search space: 119778919400 effective search space used: 119778919400 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 76 (33.9 bits)